Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD
An evaluation of sex-age-kill (SAK) model performance
Millspaugh, Joshua J.; Skalski, John R.; Townsend, Richard L.; Diefenbach, Duane R.; Boyce, Mark S.; Hansen, Lonnie P.; Kammermeyer, Kent
2009-01-01
The sex-age-kill (SAK) model is widely used to estimate abundance of harvested large mammals, including white-tailed deer (Odocoileus virginianus). Despite a long history of use, few formal evaluations of SAK performance exist. We investigated how violations of the stable age distribution and stationary population assumption, changes to male or female harvest, stochastic effects (i.e., random fluctuations in recruitment and survival), and sampling efforts influenced SAK estimation. When the simulated population had a stable age distribution and λ > 1, the SAK model underestimated abundance. Conversely, when λ < 1, the SAK overestimated abundance. When changes to male harvest were introduced, SAK estimates were opposite the true population trend. In contrast, SAK estimates were robust to changes in female harvest rates. Stochastic effects caused SAK estimates to fluctuate about their equilibrium abundance, but the effect dampened as the size of the surveyed population increased. When we considered both stochastic effects and sampling error at a deer management unit scale the resultant abundance estimates were within ±121.9% of the true population level 95% of the time. These combined results demonstrate extreme sensitivity to model violations and scale of analysis. Without changes to model formulation, the SAK model will be biased when λ ≠ 1. Furthermore, any factor that alters the male harvest rate, such as changes to regulations or changes in hunter attitudes, will bias population estimates. Sex-age-kill estimates may be precise at large spatial scales, such as the state level, but less so at the individual management unit level. Alternative models, such as statistical age-at-harvest models, which require similar data types, might allow for more robust, broad-scale demographic assessments.
Morzaria, Sanjay; Damrose, Edward J
2012-05-01
Although disease-specific quality-of-life (QOL) instruments are an invaluable outcome measure in spasmodic dysphonia, there is no consensus on which QOL instrument should be used. To determine the responsiveness of the Voice Handicap Index (VHI), Voice Handicap Index-10 (VHI-10), and Voice-Related Quality of Life (V-RQOL) to the treatment effect of botulinum toxin (Botox) in adductor spasmodic dysphonia (ADSD). Stanford University Voice and Swallowing Center. Prospective case series (level of evidence=4). Consecutive ADSD patients with a stable Botox dose-response relationship were recruited prospectively. VHI, VHI-10, and V-RQOL scores were obtained pretreatment and during the middle third of the posttreatment injection cycle. Thrity-seven patients completed the follow-up. The average total Botox dose was 0.88 units. The average follow-up time after injection was 7.84 weeks. The pretreatment QOL scores reflected the burden of the disease. All the three instruments were highly correlated in subscale and total scores. After treatment, all three instruments showed significant improvement. The VHI, VHI-10, and V-RQOL all reflected the morbidity associated with ADSD and were significantly responsive to the effect of Botox therapy. The choice of instrument should be based on physician preference. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.
Study on preservation of sweet apricot kernel (SAK) by γ-irradiation
International Nuclear Information System (INIS)
Wang Jide; Xu Fang
1992-01-01
This paper introduces the study on effect of insecticide and sterilization of SAK by 60 Co γ irradiation. The results declare that the proper dose kill the insect eggs on the surface of SAK is 3.5 kGy, the preserving period under ambient temperature is up to 7 months, the intactness rate is 100%, and the SAK can be safely stored through the summer. By the irradiation of 3.5 kGy, the sanitary quality of SAK can be notably improved and the amount of microbes can decrease by at least 99%. There are no remarkable changes of the main nutrition components of irradiated SAK
Szemraj, Janusz; Zakrzeska, Agnieszka; Brown, George; Stankiewicz, Adrian; Gromotowicz, Anna; Grędziński, Tomasz; Chabielska, Ewa
2011-01-01
SAK-RGD-K2-Hir and SAK-RGD-K2-Hirul are recombinant proteins that are derivatives of r-SAK (recombinant staphylokinase). They are characterized by their fibrin-specific plasminogen activation properties and their antithrombin and antiplatelet activities. The difference between these proteins is the presence of the antithrombotic fragment (hirudin or hirulog) in the C-terminal portion of the r-SAK. The aim of the present study was to examine the thrombolytic potentials of SAK-RGD-K2-Hir and SAK-RGD-K2-Hirul in an electrically induced carotid artery thrombosis model in rats and to compare the potentials to that of r-SAK. We determined that a bolus injection of SAK-RGD-K2-Hirul was more effective than one of r-SAK in the improvement and maintenance of carotid patency and in arterial thrombus weight reduction; however, it had the same potency as SAK-RGD-K2-Hir. The bleeding time, prothrombin time and activated partial thromboplastin time were significantly prolonged in the animals that were treated with either dose (1.5 or 3.0 mg/kg) of SAK-RGD-K2-Hir or SAK-RGD-K2-Hirul, whereas no changes were observed in the plasma fibrinogen concentration or the α2 plasmin inhibitor level. r-SAK alone did not change the bleeding time or coagulation parameters. In conclusion, our findings demonstrate the thrombolytic activity of intravenous bolus injection of the novel thrombolytic agent SAK-RGD-K2-Hirul in rats. Although this protein compares favorably with r-SAK, we were unable to show the presence of any beneficial effects of SAK-RGD-K2-Hirul over those of SAK-RGD-K2-Hir. Furthermore, our results suggest that high doses of SAK-RGD-K2-Hirul bear the risk of bleeding.
VHI-10 and SVHI-10 Differences in Singers' Self-perception of Dysphonia Severity.
Renk, Elizabeth; Sulica, Lucian; Grossman, Chad; Georges, Jenny; Murry, Thomas
2017-05-01
Previous investigations of the Voice Handicap Index (VHI)-10 in clinical practice noted that specific information relevant to singers was not forthcoming. Consequently, a second index, the Singing Voice Handicap Index (SVHI) as well as its shortened counterpart the SVHI-10, was developed. The purpose of this study was to directly compare the differences in scores between the VHI-10 and the SVHI-10 in a group of 50 singers. A retrospective chart review of 50 singers (26 women, 24 men) was performed between June 2014 and November 2014 at Weill Cornell Medical College, New York. Subjects completed both the VHI-10 and the SVHI-10 at their initial evaluation. The results from the VHI-10 and the SVHI-10 were then compared using paired t test and two-way analysis of variance. The SVHI-10 scores from the performers were significantly higher than those of the VHI-10 (P < 0.0001). The mean score on the VHI-10 was 12.1 compared with 20.4 on the SVHI-10 (maximum score for each questionnaire is 40). There were no significant gender differences when comparing the VHI-10 and the SVHI-10 on the overall scores or for individual items. The analysis of variance also found no significant gender difference (P = 0.865) and confirmed a significant difference between VHI-10 and SVHI-10 (P = 0.0003). Whereas singers may have general complaints about their voice, they also have specific complaints that relate only to their singing voice. Finding a significant difference between the scores of the VHI-10 and the SVHI-10 suggests the importance of assessing the singer's perception of voice severity using a tool that focuses on the singing voice. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Peeter Saks maksab karmavõlga / Paavo Kangur
Kangur, Paavo, 1966-
2006-01-01
Investeerimispanga Suprema Securities juhatuse esimees Peeter Saks oma sportlasekarjäärist, muudatustest investeerimispanga juhtkonnas ning panga tegevusest sportlaste toetamisel. Kommenteerib mäesuusataja Tiiu Nurmberg
Sakīna: contribución a su estudio
Directory of Open Access Journals (Sweden)
Tornero, Emilio
2013-06-01
Full Text Available This article explores the postkoranic evolution of the term sakīna. First, it examines what previous research has said about that. It then presents, translates, and analizes five texts—which had not been taken into consideration previously— pertaining to the Islamic and philosophical fields in which this term occurs. The texts have been taken from Ibn Ḥabīb, al-Tawḥīdī, the Arabic translation of the Golden Verses, and the two Commentaries on the Golden Verses attributed respectively to Iamblichus and Proclus. The article shows how the Koranic sakīna has evolved in these texts: it connotes pacification of violent animals in Ibn Habib, in al-Tawhidi it denotes a state close to Divinity of characters similar to Sufis: in the Golden Verses, the term sakīna is used to translate daímōn, thanks to which evils originating from innate discord among humans are eliminated; finally, the Commentaries on the Golden Verses contain explanations of this term that are both religious and rationalist.Estudio del término sakīna en su evolución postcoránica en el que se muestra, en primer lugar, lo que la investigación ha dicho sobre él, para, a continuación, presentar, traducir y analizar cinco textos pertenecientes al ámbito islámico y al filosófico en donde aparece dicho término y que no habían sido tenidos en cuenta hasta ahora. Estos textos proceden de: Ibn Ḥabīb, al-Tawḥīdī, traducción árabe de los Versos áureos, y Comentarios de Jámblico y de Proclo a estos Versos áureos. La sakīna coránica evoluciona en estos autores pasando a connotar una pacificación en los animales violentos en Ibn Habib y un estado cercano a la divinidad de caracteres próximos al de los sufíes en al-Tawhidi, mientras que en los Versos áureos se emplea sakīna para traducir daímōn, con sus efectos de eliminación de los males originados por la discordia innata a los hombres. En los Comentarios a los Versos áureos se dan explicaciones, de
Kuzańska, Anna; Niebudek-Bogusz, Ewa; Woźnicka, Ewelina; Kopczyńska, Jerzy; Sliwińska-Kowalska, Mariola
2009-01-01
The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in teachers as compared with the dysphonic non-teachers population. The subjective assessment of voice by VHI was performed in 105 teachers with dysphonia and 60 dysphonic subjects whose jobs did not involve vocal effort. The control group comprised 65 healthy individuals with normal voice. The results of total VHI score and each of its subscales, functional, emotional and physical, were significantly worse in the study groups (I and II) than in the control group (p teachers and 16% of non-teachers reported severe voice disability. All individuals in the control group assessed their voice problems as minor, their results fell within the range of the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can significantly contribute to the diagnosis of occupational and non-occupational dysphonia.
Dose-effective investigation of intraarterial r-Sak in canine model with acute cerebral infarctions
International Nuclear Information System (INIS)
Liu Sheng; Shi Haibin; Zhang Peng; Wang Chenghu; Zhou Chunguo; Li Linsun
2007-01-01
Objective: To compare the effect and complications of intraarterial thrombolysis with different doses of recombinant-staphylokinase (r-Sak) in canine model with acute cerebral infarction, and then to find out the most properly appropriate effective dose. Methods: The model with left cerebral embolism was established with interventional technique in 24 beagle adult dogs. They were randomly divided into 4 groups including control group(saline, 10 ml), group of low dose(r-Sak, 5 000 u/kg), middle dose(r-Sak, 10 000 u/kg) and high dose(r-Sak, 20 000 u/kg). Angiography and intraarterial thrombolysis were performed within 30 minutes after the embolization. Microcatheter was superselectively inserted into left carotid artery. Five hour's later with a repeated angiography at half, 1 and 2 hours after thrombolysis to observe the recanalization. Blood samples were collected at a series of time pre-and post-thrombolysis to test the plasma levels of PT, APTT and D-dimer. These canines were sacrificed, and their cerebri were taken out for pathologic study by the end of 24 hours. Results: The rates of efficacy within 2 hours after thrombolysis were 10.0% (1/10) in control group, 40.0% (4/10) in low dose group, 90.9% (10/11) in middle dose group and 100% (9/9) in high dose group. The rates of complete recanalization were 0, 10% (1/10), 36.4% (4/11) and 66.7% (6/9), correspondingly and respectively. There were statistically obvious differences between the 3 groups (P 0.05). Death occurred in 1 canine(high dose group) within 24 hours after thrombolysis with hemorrhagic lesion in parietal lobe of brain. No other severe complications ocurred. Conclusions: (1) Intraarterial thrombolysis with r-Sak within 5 hours after onset of thrombosis is effective and feasible. Intraarterial r-Sak shows strong thrombolytic effect for white thrombus including a few platelets. There is relative high rate of recanalization with no less than 10 000U/kg of r-Sak but accompanied with high risk of
Sandia reactor kinetics codes: SAK and PK1D
International Nuclear Information System (INIS)
Pickard, P.S.; Odom, J.P.
1978-01-01
The Sandia Kinetics code (SAK) is a one-dimensional coupled thermal-neutronics transient analysis code for use in simulation of reactor transients. The time-dependent cross section routines allow arbitrary time-dependent changes in material properties. The one-dimensional heat transfer routines are for cylindrical geometry and allow arbitrary mesh structure, temperature-dependent thermal properties, radiation treatment, and coolant flow and heat-transfer properties at the surface of a fuel element. The Point Kinetics 1 Dimensional Heat Transfer Code (PK1D) solves the point kinetics equations and has essentially the same heat-transfer treatment as SAK. PK1D can address extended reactor transients with minimal computer execution time
Aplikasi Penyusunan Laporan Keuangan Berbasis SAK Etap Pada Bagus Agriseta Mandiri
Directory of Open Access Journals (Sweden)
Mega Indah Puspita Sari
2016-03-01
Full Text Available The purpose of this study is to analyze the arrangement of existing financial report in Bagus Agriseta Mandiri and to conduct the implementation of financial report arrangement that is suitable with SAK ETAP in UKM Bagus Agriseta Mandiri. In this study, the researcher uses case study or field study research that is aimed to learn intensively on the background of problems, situation and the position of the event occurs in nowadays, to solve the problems occurs in company, also the environmental interaction of current social unit in its way (given. The result of this study shows that company only makes loss and profit report, but in its presentation, it still not appropriate with SAK ETAP and financial balance report, cash flow and company equity is not presented yet because of the company less comprehending the standard of arranging financial report. By the existence of SAK ETAP it is expected to create the uniformity in implementing accounting treatment and the presentation of financial report so that it can result appropriate information toward the need of users.
Romak, Jonathan J; Orbelo, Diana M; Maragos, Nicolas E; Ekbom, Dale C
2014-03-01
This study examines the correlation between two voice-specific patient-reported outcome measures: the Voice Handicap Index-10 (VHI-10) and Voice-Related Quality of Life (V-RQOL). Retrospective chart review. Eight hundred four patients presenting to our voice clinic between May 2009 and August 2011. All patients completed the VHI-10 and V-RQOL in a single sitting. Correlation between the two scales was examined using Spearman rank analysis. Calculated VHI-10 score was derived from V-RQOL score by direct conversion equation and compared with measured VHI-10 score. Receiver Operating Characteristic (ROC) curves were derived for diagnostic groups. Spearman correlation coefficient between the VHI-10 and V-RQOL was -0.91 (P dysphonia (V-RQOL AUC = 0.536 [SE ± 0.026]; VHI-10 AUC = 0.508 [SE ± 0.26]; P = 0.018) groups, with the V-RQOL showing relatively greater sensitivity. The VHI-10 and V-RQOL are highly correlated. However, VHI-10 score cannot be calculated from V-RQOL score using the tested equation. The V-RQOL may be more sensitive than the VHI-10 in detecting the impact of presbyphonia and muscle tension dysphonia. Copyright © 2014 The Voice Foundation. Published by Mosby, Inc. All rights reserved.
A study of VHI scores and acoustic features in street vendors as occupational voice users.
Natour, Yaser S; Darawsheh, Wesam B; Bashiti, Sara; Wari, Majd; Taha, Juhayna; Odeh, Thair
to investigate acoustic features of phonation and perception of voice handicap in street vendors. Eighty-eight participants (44 street vendors, 44 controls) were recruited. The mean age of the group was 38.9±16.0 years (range: 20-78 years). Scores of the Arabic version of the Voice Handicap Index (VHI-Arab) were used for analysis. Acoustic measures of fundamental frequency (F 0 ), jitter, shimmer, and signal-to-noise ratio (SNR) were also analyzed. Analysis showed a significant difference between street vendors and controls in the total score of the VHI-Arab (p<0.001) as well as scores of all three VHI-Arab subsections: functional (p<0.001), physical (p<0.001), and emotional (p=0.025). Weak correlations were found among all of the VHI scores and acoustic measures (-0.219≤ r≤0.355), except for SNR where a moderate negative correlations were found (r=-0.555; -0.4) between the VHI (physical and total) scores and SNR values. Significant differences also were found in F 0 , jitter, and SNR among specific subgroups of street vendors when stratified by weekly hours worked (p<0.05), and in jitter (p=0.39) when stratified by educational level. Perception of voice handicap and a possible effect on vocal quality in street vendors were noted. The effect of factors, namely work hours and educational level, on voice quality should be further studied. Copyright © 2017. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Meng Zhang
Full Text Available PsSAK1, a mitogen-activated protein (MAP kinase from Phytophthora sojae, plays an important role in host infection and zoospore viability. However, the downstream mechanism of PsSAK1 remains unclear. In this study, the 3'-tag digital gene expression (DGE profiling method was applied to sequence the global transcriptional sequence of PsSAK1-silenced mutants during the cysts stage and 1.5 h after inoculation onto susceptible soybean leaf tissues. Compared with the gene expression levels of the recipient P. sojae strain, several candidates of Myb family were differentially expressed (up or down in response to the loss of PsSAK1, including of a R2R3-type Myb transcription factor, PsMYB1. qRT-PCR indicated that the transcriptional level of PsMYB1 decreased due to PsSAK1 silencing. The transcriptional level of PsMYB1 increased during sporulating hyphae, in germinated cysts, and early infection. Silencing of PsMYB1 results in three phenotypes: a no cleavage of the cytoplasm into uninucleate zoospores or release of normal zoospores, b direct germination of sporangia, and c afunction in zoospore-mediated plant infection. Our data indicate that the PsMYB1 transcription factor functions downstream of MAP kinase PsSAK1 and is required for zoospore development of P. sojae.
Directory of Open Access Journals (Sweden)
Raeni Raeni
2013-06-01
Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.
Directory of Open Access Journals (Sweden)
Raeni Raeni
2016-01-01
Full Text Available The research was inspired by students’ readiness to be Accounting teachers with the rapid progress of science and technology and also free-market for workers. The objective of the study was to test the influence of Accounting learning based on SAK IFRS and self-efficacy toward students’ readiness to be Accounting teachers. The population of the research were Accounting education students in classess of 2010 until 2012. Thus, it used proportionate stratified random sampling. The respondents were 85 students in class 2010, 123 students in class 2011 and 154 students in class 2012. Then, the data were analyzed by percentage descriptive and doubled linear regression. The result of regression analysis showed that 1 Accounting learning based on SAK IFRS and self-efficacy contibuted positively and significantly for 52.4% toward students’ readiness to be Accounting students, 2 there was a positive and significant influence of Accounting learning based on SAK IFRS for 26.2% toward students’ readiness to be Accounting teachers, 3 there was a positive and significant influence of self-efficacy for 16.32% toward students’ readiness to be Accounting teachers. The familiarity level for learning Accounting based on SAK IFRS was high with the progress of science and technology and also full adoption from IFRS.
Popmane, Daiga
2008-01-01
Darbā tiek apskatīta viena no nevienādību teorijas sastāvdaļām – sakārtojuma nevienādības, kā arī daži to lietojumi. Darbā ir aplūkoti arī vairāki uzdevumi no dažādu gadu matemātikas olimpiādēm.
Campbell, Rebecca; Fehler-Cabral, Giannina; Bybee, Deborah; Shaw, Jessica
2017-10-01
Throughout the United States, hundreds of thousands of sexual assault kits (SAKs) (also termed "rape kits") have not been submitted by the police for forensic DNA testing. DNA evidence can help sexual assault investigations and prosecutions by identifying offenders, revealing serial offenders through DNA matches across cases, and exonerating those who have been wrongly accused. In this article, we describe a 5-year action research project conducted with 1 city that had large numbers of untested SAKs-Detroit, Michigan-and our examination into why thousands of rape kits in this city were never submitted for forensic DNA testing. This mixed methods study combined ethnographic observations and qualitative interviews to identify stakeholders' perspectives as to why rape kits were not routinely submitted for testing. Then, we quantitatively examined whether these factors may have affected police practices regarding SAK testing, as evidenced by predictable changes in SAK submission rates over time. Chronic resource scarcity only partially explained why the organizations that serve rape victims-the police, crime lab, prosecution, and victim advocacy-could not test all rape kits, investigate all reported sexual assaults, and support all rape survivors. SAK submission rates significantly increased once criminal justice professionals in this city had full access to the FBI DNA forensic database Combined DNA Index System (CODIS), but even then, most SAKs were still not submitted for DNA testing. Building crime laboratories' capacities for DNA testing and training police on the utility of forensic evidence and best practices in sexual assault investigations can help remedy, and possibly prevent, the problem of untested rape kits. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Nimmanee, Panjaphorn; Tam, Emily W T; Woo, Patrick C Y; Vanittanakom, Pramote; Vanittanakom, Nongnuch
2017-04-01
Stress-activated MAPK pathways are systems used to regulate the stress adaptation of most fungi. It has been shown that in Talaromyces marneffei (Penicillium marneffei), a pathogenic dimorphic fungus, the sakA gene is involved, not only in tolerance against oxidative and heat stresses, but also in playing a role in asexual development, yeast cell generation in vitro and survival inside macrophage cell lines. In this study, the role of the T. marneffei sakA gene on the nitrosative stress response and the regulation of gene expression were investigated. The susceptibility of the sakA mutant to NaNO2 was investigated using drop dilution assay and the expression of genes of interest were determined by RT-PCR, comparing them to the wild-type and complemented strains. The results demonstrated that the T. marneffei sakA gene played a role in the stress response to NaNO2, the expression of genes functioning in conidial development (brlA, abaA and wetA) and red pigment biosynthesis (pks3, rp1, rp2 and rp3). These findings suggest that T. marneffei sakA is broadly involved in a wide variety of cell activities, including stress response, cell morphogenesis, asexual development and pigmentation. © FEMS 2016. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Husain, Noreen; Yabuki, Yasushi; Shinoda, Yasuharu; Fukunaga, Kohji
2018-01-01
Hypothyroidism is a common disorder that is associated with psychological disturbances such as dementia, depression, and psychomotor disorders. We recently found that chronic treatment with the T-type calcium channel enhancer SAK3 prevents the cholinergic neurodegeneration induced by a single intraperitoneal (i.p.) injection of methimazole (MMI; 75 mg/kg), thereby improving cognition. Here, we evaluated the acute effect of SAK3 on cognitive impairments and its mechanism of action following the induction of hypothyroidism. Hypothyroidism was induced by 2 injections of MMI (75 mg/kg, i.p.) administered once per week. Four weeks after the final MMI treatment, MMI-treated mice showed reduced serum thyroxine (T4) levels and cognitive impairments without depression-like behaviors. Although acute SAK3 (1.0 mg/kg, p.o.) administration failed to ameliorate the decreased T4 levels and histochemical destruction of the glomerular structure, acute SAK3 (1.0 mg/kg, p.o.) administration significantly reduced cognitive impairments in MMI-treated mice. Importantly, the α7 nicotinic acetylcholine receptor (nAChR)-selective inhibitor methyllycaconitine (MLA; 12 mg/kg, i.p.) and T-type calcium channel-specific blocker NNC 55-0396 (25 mg/kg, i.p.) antagonized the acute effect of SAK3 on memory deficits in MMI-treated mice. We also confirmed that acute SAK3 administration does not rescue reduced olfactory marker protein or choline acetyltransferase immunoreactivity levels in the olfactory bulb or medial septum. Taken together, these results suggest that SAK3 has the ability to improve the cognitive decline caused by hypothyroidism directly through activation of nAChR signaling and T-type calcium channels. © 2018 S. Karger AG, Basel.
Energy Technology Data Exchange (ETDEWEB)
David O. Ogbe; Tao Zhu
2004-01-01
A one-year research program is conducted to evaluate the feasibility of applying solvent-based enhanced oil recovery processes to develop West Sak and Ugnu heavy oil resources found on the Alaska North Slope (ANS). The project objective is to conduct research to develop technology to produce and market the 300-3000 cp oil in the West Sak and Ugnu sands. During the first phase of the research, background information was collected, and experimental and numerical studies of vapor extraction process (VAPEX) in West Sak and Ugnu are conducted. The experimental study is designed to foster understanding of the processes governing vapor chamber formation and growth, and to optimize oil recovery. A specially designed core-holder and a computed tomography (CT) scanner was used to measure the in-situ distribution of phases. Numerical simulation study of VAPEX was initiated during the first year. The numerical work completed during this period includes setting up a numerical model and using the analog data to simulate lab experiments of the VAPEX process. The goal was to understand the mechanisms governing the VAPEX process. Additional work is recommended to expand the VAPEX numerical study using actual field data obtained from Alaska North Slope.
The Effects of a Voice Education Program on VHI Scores of Elementary School Teachers.
Faham, Maryam; Ahmadi, Akram; Drinnan, Michael; Saadatmand, Najme; Fatahi, Elahe; Jalalipour, Maryam
2016-11-01
Teachers seem to be vulnerable to voice disorders because of excessive use of their voice. The purpose of this study was to investigate the effects of a voice education program on the Vocal Handicap Index (VHI) scores of elementary school teachers in the Persian education system. This was a semi-experimental study, performed in Shiraz public schools. Ten schools were selected on their similarity in number of students and teachers, and allocated at random to training or control groups. Sixty-one teachers in the training group and 66 teachers in the control group completed the VHI in the first week. Teachers in the trained group received voice education for 4 weeks, and then continued to follow the program for a further 4 weeks. The control group received no training. After 8 weeks, all subjects completed the questionnaire again. Compliance was good for all practices except "breathing exercises" and "using amplifiers" where it was exceptionally poor. Teachers in the training group improved significantly in total VHI score (from 14.2 to 6.8), whereas the control group showed a significant worsening (from 10.1 to 13.7). These effects were significant (P teachers, even without dysphonia, in the middle of their teaching. Such a program may have a place in the Persian education system. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Li, Bo; Ling, Zongcheng; Zhang, Jiang; Chen, Jian; Ni, Yuheng; Liu, Chunli
2018-04-01
Wrinkle ridges are complex thrust faults commonly found in lunar mare basalts and caused by compressional stresses from both local basin and global Moon. In this paper, we select 59 single wrinkle ridges in Mare Serenitatis and 39 single wrinkle ridges in Mare Tranquillitatis according to WAC mosaic image. For each wrinkle ridge, several topographic profiles near its midpoint are generated to measure its height and maximum displacement (Dmax) through LOLA DEM data. Then we make 2D plots of displacement-length (L) for ridge population in the two maria. The Dmax-L ratios (γ) are derived by a linear fit method according to the D-L data. The γ value (2.13 × 10-2) of ridges in Mare Tranquillitatis is higher than the γ value (1.73 × 10-2) of ridges in Mare Serenitatis. In the last, the contractional strains (ε) in Mare Serenitatis and Mare Tranquillitatis are estimated to be ∼0.36% and 0.14% (assuming the fault plane dip θ is 25°). The values of the free-air gravity anomalies in Mare Serenitatis range from 78 to 358 mGal higher than those of the gravity anomalies in Mare Tranquillitatis which range from -70 to 120 mGal. The average thickness of basalts in Mare Tranquillitatis is 400 m, while that of basalts in Mare Serenitatis is 798 m. Moreover, the average age for ridge group in Mare Serenitatis is bigger than the wrinkle ridge's age in Mare Tranquillitatis. The formation of ridge group in Mare Serenitatis takes longer time than that in Mare Serenitatis. Therefore, we think the higher value of gravity anomalies, thicker basaltic units and longer formation time for wrinkle ridge in Mare Serenitatis maybe result in the higher value of contractional strain, although the formation of Tranquillitatis basin is earlier than that of Serenitatis basin.
Alves de Castro, Patrícia; Dos Reis, Thaila Fernanda; Dolan, Stephen K; Oliveira Manfiolli, Adriana; Brown, Neil Andrew; Jones, Gary W; Doyle, Sean; Riaño-Pachón, Diego M; Squina, Fábio Márcio; Caldana, Camila; Singh, Ashutosh; Del Poeta, Maurizio; Hagiwara, Daisuke; Silva-Rocha, Rafael; Goldman, Gustavo H
2016-11-01
The serine-threonine kinase TOR, the Target of Rapamycin, is an important regulator of nutrient, energy and stress signaling in eukaryotes. Sch9, a Ser/Thr kinase of AGC family (the cAMP-dependent PKA, cGMP- dependent protein kinase G and phospholipid-dependent protein kinase C family), is a substrate of TOR. Here, we characterized the fungal opportunistic pathogen Aspergillus fumigatus Sch9 homologue (SchA). The schA null mutant was sensitive to rapamycin, high concentrations of calcium, hyperosmotic stress and SchA was involved in iron metabolism. The ΔschA null mutant showed increased phosphorylation of SakA, the A. fumigatus Hog1 homologue. The schA null mutant has increased and decreased trehalose and glycerol accumulation, respectively, suggesting SchA performs different roles for glycerol and trehalose accumulation during osmotic stress. The schA was transcriptionally regulated by osmotic stress and this response was dependent on SakA and MpkC. The double ΔschA ΔsakA and ΔschA ΔmpkC mutants were more sensitive to osmotic stress than the corresponding parental strains. Transcriptomics and proteomics identified direct and indirect targets of SchA post-exposure to hyperosmotic stress. Finally, ΔschA was avirulent in a low dose murine infection model. Our results suggest there is a complex network of interactions amongst the A. fumigatus TOR, SakA and SchA pathways. © 2016 John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Solomon, S.C.
1979-01-01
The spatial and temporal relationships of linear rilles and mare ridges in the Serenitatis basin region of the moon are explained by a combination of lithospheric flexure in response to basin loading by basalt fill and a time-dependent global stress due to the thermal evolution of the lunar interior. The pertinent tectonic observations are the radial distance of basin concentric rilles or graben from the mare center; the location and orientation of mare ridges, interpreted as compressive features; and the restriction of graben formation to times older than 3.6 +- 0.2 b.y. ago, while ridge formation continued after emplacement of the youngest mare basalt unit (approx.3 b.y. ago). The locations of the graben are consistent with the geometry of the mare basalt load expected from the dimensions of multiring basins for values of the thickness of the elastic lithosphere beneath Serenitatis in the range 25--50 km at 3.6--3.8 b.y. ago. The locations and orientations of mare ridges are consistent with the load inferred from surface mapping and subsurface radar reflections for values of the elastic lithosphere thickness near 100 km at 3.0--3.4 b.y. ago. The thickening of the lithosphere beneath a major basin during the evolution of mare volcanism is thus clearly evident in the tectonics. The cessation of rille formation and the prolonged period of ridge formation are attributed to a change in the global horizontal thermal stress from extension to compression as the moon shifted from net expansion to overall cooling and contraction. Severe limits as placed on the range of possible lunar thermal histories. The zone of horizontal extensional stresses peripheral to mare loads favors the edge of mare basins as the preferred sites for mare basalt magma eruption in the later stages of mare fill, although subsidence may lead to accumulation of such young lavas in basin centers
Voice Handicap Index (VHI in Persian Speaking Parkinson\\'s Disease Patients
Directory of Open Access Journals (Sweden)
Fatemeh Madjdinasab
2014-04-01
Full Text Available Objectives: “Voice” is affected more and sooner than other speech subsystems in Parkinson's Disease (PD. Voice Handicap Index (VHI is the most applicable subjective self-rating questionnaire in VD patients. The aim of this study was the investigation of Voice handicap in Iranian PD patients. Methods & Materials: This cross-sectional, analytical and non-interventional study was done on 50 (35 males, 15 females patients who reported a VD related to their PD. They were selected from thepatients referring to movement disorders’ clinic in Rasool Akram Hospital affiliated withTehran University of medical sciences, through easy sampling. VHI total score (VHIT and its domains (functional-VHIF, Emotional VHIE, Physical VHIP was assessed in all of participants and by gender segregation. Results: 83% of patients reported voice handicap. There wasn't any difference between VHIT and its mentioned 3 domains in both sexes. There is positive correlation between VHIT, VHIE and VHIF with age. VHIT and VHIF had a positive relationship with disease duration (DD. The males VHIT and the mentioned domains had positive correlations with DD. Conclusion: Most of Iranian PD patients feel handicap due to voice disorder caused by PD and their quality of life was affected by voice impairment. Increase in age and disease duration caused more voice disorder and reduced quality of life especially patients feel more handicaps in functional domain (VHIF. In addition, the males feel more handicap than females when DD develops.
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1997-07-01
Full Text Available The effect of 4 different diets, in terms of protein quantity and quality, on total serum protein (TSP, albumin and globulin was investigated. Non-pregnant mares that were not lactating (n = 36, pregnant mares that had foaled (n = 24 and their foals (n = 24 were used in this study. Daily total protein intake had no effect on blood protein concentrations in the mares. Total protein intake and quality (available essential amino-acids did affect the body mass of mares during lactation. When mares were fed the minimum recommended (National Research Council 1989 total daily protein, foal mass decreased by approximately 25 % at weaning compared to the foals whose dams were on a higher level of protein intake. The TSP concentrations of foals at birth were on average 10 g/ℓ lower than those of the mares. Albumin concentrations of foals during the first 60 days of life were on average 2-3 g/ℓ lower than those of the mares. Globulin concentrations of foals were approximately 5 g/ℓ lower than those of mares at weaning.
Lu, Dan; Wen, Bei; Yang, Hui; Chen, Fei; Liu, Jun; Xu, Yanan; Zheng, Yitao; Zhao, Yu; Zou, Jian; Wang, Haiyang
2017-07-01
To investigate the differences and correlation between the Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) in teachers in China with and without voice disorders. This is a cross-sectional descriptive analytical study. The participants were 864 teachers (569 women, 295 men) whose vocal cords were examined using a flexible nasofibrolaryngoscope. Questionnaire results were obtained for both the VHI-10 and the V-RQOL. Of the 864 participants, 409 teachers had no voice disorders and 455 teachers had voice disorders. The most common voice complaint was hoarseness (n = 298) and the most common throat complaint was globus pharyngis (n = 79) in teachers with voice disorders. Chronic laryngitis (n = 218) and polyps and nodules (n = 182) were the most frequent diagnoses in teachers with voice disorders. Significant differences were seen on the VHI-10 between teachers with and those without voice disorders (P teachers with voice disorders (P teachers. Teachers with voice disorders have poor voice-related quality of life, with more impairment seen among female than male teachers. Different groups of voice disorders have different effects on voice-related quality of life. A moderate correlation was found between the results of the VHI-10 and the V-RQOL. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Foong Ming Moy
Full Text Available To establish the prevalence of voice disorder using the Malay-Voice Handicap Index 10 (Malay-VHI-10 and to study the determinants, quality of life, depression, anxiety and stress associated with voice disorder among secondary school teachers in Peninsular Malaysia.This study was divided into two phases. Phase I tested the reliability of the Malay-VHI-10 while Phase II was a cross-sectional study with two-stage sampling. In Phase II, a self-administered questionnaire was used to collect socio-demographic and teaching characteristics, depression, anxiety and stress scale (Malay version of DASS-21; and health-related quality of life (Malay version of SF12-v2. Complex sample analysis was conducted using multivariate Poisson regression with robust variance.In Phase I, the Spearman correlation coefficient and Cronbach alpha for total VHI-10 score was 0.72 (p 11. Compared to Malays, a greater proportion of ethnic Chinese teachers reported voice disorder while ethnic Indian teachers were less likely to report this problem. There was a higher prevalence ratio (PR of voice disorder among single or divorced/widowed teachers. Teachers with voice disorder were more likely to report higher rates of absenteeism (PR: 1.70, 95% CI 1.33, 2.19, lower quality of life with lower SF12-v2 physical (0.98, 95% CI 0.96, 0.99 and mental (0.97, 95% CI 0.96, 0.98 component summary scales; and higher anxiety levels (1.04, 95% CI 1.02, 1.06.The Malay-VHI-10 is valid and reliable. Voice disorder was associated with increased absenteeism, marginally associated with reduced health-related quality of life as well as increased anxiety among teachers.
Prevalence and characteristics of foal rejection in Arabian mares.
Juarbe-Díaz, S V; Houpt, K A; Kusunose, R
1998-09-01
Separate surveys of Thoroughbred, Paint, and Arabian mare owners revealed a higher than expected rate of foal rejection in Arabian mares. A behavioural history form was submitted by owners of foal rejecting and nonrejecting Arabian mares, and maternal behaviour and management practices compared. Four generation pedigrees of rejecting and nonrejecting Arabian mares were also examined. Foal rejecting mares were more likely to avoid, threaten, squeal at, chase, bite, and kick their foals post partum than nonrejecting mares. Nonrejecting mares were more likely to lick, nicker and defend their foals post partum than rejecting mares. No statistically significant relationship was found between foal rejection and the type of breeding method (natural vs. artificial insemination), the presence of people at birth, the presence of nearby horses at birth, or assistance of the first nursing bout. The presence at least once of 1 of 2 related sires was statistically higher in the pedigrees of rejecting vs. nonrejecting mares. Inherited and learned or environmental factors are likely to affect the expression of foal rejection behaviour.
2010-07-01
... part of the Navy Yard, Mare Island, south of the causeway between the City of Vallejo and Mare Island... Commander, Mare Island Naval Shipyard, Vallejo, California, shall navigate, anchor or moor in this area. [26...
Use of pipe saks on pipeline construction
Energy Technology Data Exchange (ETDEWEB)
Ghio, Alberto F.M.; Caciatori, Angelo [Galvao Engenharia S.A., Sao Paulo, SP (Brazil); Ruschi, Allan A.; Santos, Felipe A. dos; Barros, Horacio B. de; Loureiro, Regis R. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)
2009-07-01
The use of new technologies applied to pipeline construction and assembling, aimed at enhancing productivity has been searched by PETROBRAS, throughout its subcontractors, assemblers, by transference in the mentioned constructions. Along the construction of Cacimbas Catu Pipeline, Spread 1 A, placed between the Cacimbas Gas Treatment Station (Linhares, ES) and the future Compression Station of Sao Mateus (ES), one, by means of surveys, noticed that the length of flooded or prone to flooding areas was way superior to the ones foreseen in the basic design. One of the broadly used methods for assuring buoyancy control is concreting the pipes. Such method deeply impacts work's logistics in for instance, the pipe stringing work; in this one, a maximum load of two pipes can be transported until the area to applied, what leads to lower productivity and higher risk due to the increase of trips by heavy load trucks. As an alternative to regular concrete, the Pipe Sak System was adopted and such method improved productivity and decreased discontinuities. (author)
Apollo 15 mare units and their petrogenesis
International Nuclear Information System (INIS)
Binder, A.A.
1985-01-01
Samples from 12 different mare sites were identified and classified among the Apollo 15 samples. The genesis of the Apollo 15 mare units is summarized given the general model of mare basalt source regions and of more basalt genesis derived from a synthesis of the major oxide/major mineral, compatible siderophile, and incompatible trace element data and isotopic ratios of the Rb/Sr and Sm/Nd systems
Inflammation and fertility in the mare
DEFF Research Database (Denmark)
Christoffersen, Mette; Troedsson, Mats H.T.
2017-01-01
-inflammatory factors is required for resolving the breeding-induced inflammation within 24–36 hr in the reproductively healthy mare, whereas a subpopulation of mares is susceptible to development of a persistent infection that can interfere with fertility. The aetiology of persistent endometritis can be either...... bacterial or semen-induced and both scenarios can threaten the establishment of pregnancy. Several factors associated with susceptibility to persistent endometritis have been identified including altered innate immune response in the early inflammatory process, reduced myometrial contractions and impaired......) and bacterial endometritis in the mare....
Directory of Open Access Journals (Sweden)
Alessandra Sayuri Tutya
2011-09-01
Full Text Available OBJETIVO: Verificar como o impacto da disfonia em professores é caracterizado pelos protocolos QVV (Qualidade de Vida em Voz, IDV (Índice de Desvantagem Vocal e PPAV (Perfil de Participação e Atividades Vocais, e analisar a correspondência das informações obtidas por esses instrumentos. MÉTODOS: Quarenta e seis professores com queixa vocal que procuraram atendimento fonoaudiológico e foram diagnosticados com disfonia de base comportamental responderam aos questionários QVV, IDV e PPAV, em ordem aleatória. RESULTADOS: Professores disfônicos apresentaram pior qualidade de vida no QVV em relação à população de disfônicos. O IDV não apresentou devantagem vocal expressiva. No PPAV, os professores disfônicos apresentaram menor escore em efeitos na comunicação social. Os domínios orgânico (IDV e físico (QVV foram considerados iguais. O PPAV apresenta aspectos não contemplados nos demais protocolos; a auto-percepção do grau da disfonia apresentou correlação com todos os domínios dos três protocolos. No QVV, as questões com maior impacto pertencem ao físico e no IDV, ao orgânico. Já no PPAV, as duas questões de maior ocorrência relacionam-se ao efeito da voz na emoção. Assim, para esta população, sugere-se a aplicação do PPAV, por contemplar aspectos não contemplados nos demais, e do QVV, pelo reduzido número de questões e por apresentar maior impacto (escores total, emocional em relação ao IDV. CONCLUSÃO: QVV, IDV e PPAV não apresentam as mesmas informações em professores disfônicos. Os domínios físico (QVV e orgânico (IDV oferecem resultados semelhantes, contudo, o sócio-emocional do QVV evidenciou mais o impacto da alteração vocal em professores disfônicos que o IDV. O PPAV apresenta informações não contempladas nos demais protocolos.PURPOSE: To verify how the impact of dysphonia in teachers is characterized according to the protocols V-RQOL (Voice-Related Quality of Life, VHI (Voice
Effect of intrauterine autoplasma application on mare fertility
ŠTĚRBOVÁ, Hana
2010-01-01
The objective of this study was to evaluate the effect of intrauterine plasma infusion on conceiving rate in selected group of mares during the breeding seasons 2008 and 2009. The fresh sperm insemination was followed by the infusion of self-plasma and subsequently the successivity of the insemination was compared with the control group of mares. Next, there were observed following factors which could influence the effectiveness of conceiving: age of the mares, number of insemination doses, s...
Apollo 15 mare volcanism: constraints and problems
International Nuclear Information System (INIS)
Delano, J.W.
1985-01-01
The Apollo 15 landing site contains more volcanics in the form of crystalline basalts and pristine glasses, which form the framework for all models dealing with the mantle beneath that site. Major issues on the petrology of the mare source regions beneath that portion of Mare Imbrium are summarized
Effect of ovarian hormones on the phagocytic response of ovariectomized mares.
Ganjam, V K; McLeod, C; Klesius, P H; Washburn, S M; Kwapien, R; Brown, B; Fazeli, M H
1982-01-01
The reaction between ovarian hormones and experimental uterine infection (Streptococcus zooepidemicus) was investigated in 3 groups, each containing 6 ovariectomized mares. Group 1 served as controls ('anoestrus'), Group 2 mares were injected with oestrogen ('oestrus') and Group 3 with progesterone ('dioestrus') over a period of 5 weeks. All mares received an intrauterine inoculation of the bacteria 1 week after the start of hormonal treatment, and the results of the challenge were examined by endometrial biopsy and swabs once weekly. At the end of Week 1 no bacteria were recovered from the mares in Group 2. Group 1 mares were free of bacteria at the end of Week 2 but all Group 3 mares remained infected at least for the total period examined. Streptococcal phagocytosis was quantitated by chemiluminescence. Before the challenge-inoculation, phagocytosis was not significantly different in the 3 groups of mares. Bacterial cultures were negative for all three groups. However, within 48 h after infection, there was a significant increase (P less than 0.01) in phagocytosis in Group 2 and a significant suppression (P less than 0.05) in Group 3 mares. Patterns of streptococcal clearance from the uterus closely paralleled the changes in the magnitude of chemiluminescence response. The results suggest that ovarian hormonal status can modulate the phagocytic response in episodes of streptococcal-induced endometritus in mares.
Mare Pork: emotsionaalsed kangid on kõige tõhusamad / Mare Pork
Pork, Mare, 1950-
2010-01-01
Kliinilise psühholoogia professor Mare Pork tutvustab vestluses raamatut: Neale, Stephen; Spencer-Arnell, Lisa; Wilson, Liz. Emotsionaalse intelligentsuse treening : kuidas tõsta tippjuhi, arengutreeneri ja iseendaga tehtava töö tulemuslikkust. [Tallinn] : Äripäev, 2009
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1997-07-01
Full Text Available In the main experiment the total daily protein intake and quality (essential amino-acids was varied in 4 groups of mares. The incidence of oestrus in mares during the transitional period was unaffected by protein nutrition. Ovarian activity, as evaluated by follicular development and size of the ovaries, was affected. Mares that received low-quality protein (Groups 1 and 2 had a higher number of smaller follicles (<10 mm that developed during the transitional period compared to mares on a high-quality protein intake (Groups 3 and 4. The mares that received the high quality protein ovulated 2-3 weeks earlier in the breeding season in a synchronised period of 4-5 weeks compared to a period of 6-8 weeks in Groups 1 and 2. The duration of the subsequent oestrous cycles was not affected. There was no difference in the diameter of the largest follicle of mares between groups on the day before ovulation. In a separate experiment, 5 maiden Anglo-Arab mares, 4-5 years of age, were slaughtered at different stages during the anovulatory, transitional and ovulatory periods of the breeding cycle. The morphology of the ovaries and uteri of these mares was described and photographed for use as guidelines when comparing ovarian changes and follicular activity of mares.
Sotsiaaltöö koolis / Mare Leino
Leino, Mare, 1961-
2000-01-01
Rets. rmt. : Leino, Mare. Õpetaja sotsiaaltöö tegijana : sotsiaalpedagoogika : monograafia = Teacher as a social worker : social pedagogic : a monograph / Mare Leino ; Tallinna Pedagoogikaülikool. Tallinn : Tallinna Pedagoogikaülikooli Kirjastus, 2000. 146 lk. : ill. - (Acta Universitatis Scientiarum Socialium et Artis Educandi Tallinnensis. A, Humaniora =Proceedings of the Tallinn University of Social and Educational Sciences. A, Humaniora = Tallinna Pedagoogikaülikooli toimetised. A, Humaniora, 1023-1064 ; 18). Bibliogr. lk. 136-146. Kokkuv. inglise keeles
Reproductive Performance of Arabian and Thoroughbred Mares under Subtropical Conditions of Pakistan.
Warriach, H M; Memon, M A; Ahmad, N; Norman, S T; Ghafar, A; Arif, M
2014-07-01
Breeding records of 57 Arabian and 66 Thoroughbred mares were analysed to assess their reproductive performance under the subtropical conditions of Pakistan. The Arabian mares showed significantly higher conception rates (p500±32 days) was significantly (psummer (June to August) months. Age of mares affected the conception rates, as mares at ages 3 to 7 and 8 to 12 years of ages had significantly higher conception rates (psummer months.
Venner, Monica; Markus, R G; Strutzberg-Minder, K; Nogai, K; Beyerbach, M; Klug, E
2008-01-01
In 360 samples of colostrum and 36 samples of blood of warmblood mares, the concentration of immunoglobulin G (IgG) was evaluated in the post partal period with an ELISA and the results were compared to values obtained with 2 field methods--refractometry and colostrometry. A significant correlation (p refractometry (r = +0.93). So both field-methods seem suitable for evaluation of the colostral IgG-concentration in mares. Further the kinetic of the IgG concentration in colostrum, the volume of colostrum and the total amount of IgG was measured in the 12 hours post partum (p.p.) in each half udder of 36 mares of different parity. Immediately p.p. primiparous mares have a greater mean concentration of IgG (68 mg/ml) than multiparous mares (51 mg/ml). However, multiparous mares have a mean colostral volume of 1020 ml whereas, in primiparous mares, a mean volume of 527 ml was determined within the first three hours p.p. As a result of this the total amount of IgG was lower in primiparous (31.5 g) than in multiparous mares (48.5 g). A significant decrease of IgG concentration was measured in multiparous mares in the 1.5 hours following partum versus 3 hours in primiparous mares. The mean IgG concentration in the blood serum of the 36 mares immediately p.p. was 13.4 +/- 3.6 mg/ml. No significant correlation was observed between values of IgG concentration in the blood and in the colostrum of the mares.
Investigating the stratigraphy of Mare Imbrium flow emplacement with Earth-based radar
Morgan, G. A.; Campbell, B. A.; Campbell, D. B.; Hawke, B. R.
2016-08-01
The lunar maria are the product of extensive basaltic volcanism that flooded widespread portions of the Moon's surface. Constraining mare volcanic history therefore provides a window into the endogenic processes responsible for shaping the Moon. Due to the low magma viscosity and the associated thin nature of lava units, the majority of mare surface structures are masked and subdued by impact regolith. Subtle individual mare flow morphologies, coupled with spatial limitations in the use of crater size distributions to distinguish surface units close in age, restrict our understanding of mare stratigraphy. Earth-based 70 cm wavelength (P band) radar can reveal features beneath the regolith and highlight very subtle changes in the ilmenite content of the flows, providing a unique means to map mare units. Here we map volcanic units in Mare Imbrium using high-resolution (200 m/pixel), Earth-based P band data. Situated within the heat-producing potassium, rare earth element, and phosphorus terrane, Mare Imbrium experienced some of the most long-lived (and recent) lunar volcanism, and its surface exhibits a significant diversity of basaltic chemistry. Our investigation identifies at least four distinct stages of volcanic activity, originating from multiple sources within Imbrium. The most recent of these stages comprises extensive, yet relatively thin volcanic flow units that left remnant kipukas of older mare material distributed across much of the basin. From a future mission perspective, it may be possible to collect samples expressing a wide range in age from small areas of Mare Imbrium. Our map also places important constraints on the interpretation of the Chang'e-3 Lunar Penetrating Radar measurements.
Mare Pork : Koolitus olgu puhkus ja pingutus / Mare Pork ; interv. Urve Vilk
Pork, Mare
2008-01-01
Ilmunud ka: Delovõje Vedomosti 12. märts lk. 16-17. Koolitaja Mare Pork leiab, et töös võiks olla rohkem lõbu ja loovust ning koolitus võiks olla nii korralik pingutus kui ka korralik puhkus täis-ümberlülitusega
Determinants of gestation length in Thoroughbred mares on German stud farms.
Ewert, Mareike; Lüders, Imke; Böröcz, Jozsef; Uphaus, Hubert; Distl, Ottmar; Sieme, Harald
2018-04-01
The aim of the present study was to analyze the effects of stallion and mare, their ages, and maternal lineage on the gestation length (GL) in Thoroughbreds. In addition, additive genetic effects of the dam, stallion and fetus were analyzed. Data were taken from 1993 through 2009, and included 16,226 pregnancies from 5959 Th oroughbred mares mated with 290 different stallions. All analyses were performed using linear mixed models. The GL ranged from 306 to 390 days, with a mean length of 347.0 ± 14.4 days. Mating of mares with stallions aged 17 years and older resulted in a significantly longer GL compared to younger stallions. Furthermore, the GL significantly increased with the increasing age of the mares, and the GL was longer with male foals. The month and year of breeding, as well as the mare´s breeding history (parity and reproductive status) also affected GL. The mare and stallion themselves explained 18% and 4% of the variance in GL. Coefficients of inbreeding of mares and foals had no significant effect on GL. The heritability for the GL was 0.17 for the dam and 0.006 for the fetus, whereas an additive genetic paternal effect was not estimable. The relative proportions among the additive genetic and permanent environmental contributions of the dam were 76.5% and 23.5%. A maternal lineage effect was not obvious. Copyright © 2018 Elsevier B.V. All rights reserved.
MARES: Navigation, Control and On-board Software
Aníbal Matos; Nuno Cruz
2009-01-01
MARES, or Modular Autonomous Robot for Environment Sampling, is a 1.5m long AUV, designed and built by the Ocean Systems Group. The vehicle can be programmed to follow predefined trajectories, while collecting relevant data with the onboard sensors. MARES can dive up to 100m deep, and unlike similar-sized systems, has vertical thrusters to allow for purely vertical motion in the water column. Forward velocity can be independently defined, from 0 to 2 m/s. Major application areas include pollu...
Temporal feeding pattern may influence reproduction efficiency, the example of breeding mares.
Directory of Open Access Journals (Sweden)
Haifa Benhajali
Full Text Available Discomfort in farm animals may be induced by inappropriate types or timing of food supplies. Thus, time restriction of meals and lack of roughage have been shown to be one source of emergence of oral stereotypies and abnormal behaviour in horses which have evolved to eat high-fibre diets in small amounts over long periods of time. This feeding pattern is often altered in domestic environment where horses are often fed low fibre meals that can be rapidly consumed. This study aimed at determining the effect of the temporal pattern of feeding on reproductive efficiency of breeding mares, One hundred Arab breeding mares were divided into two groups that differed only in the temporal pattern of roughage availability: only at night for the standard feeding pattern group (SFP mares, night and day for the "continuous feeding" group (CF mares. The total amount of roughage provided was the same as the CF mares received half of the hay during the day while in paddock (haynets. Mares were tested for oestrus detection by teasing with one stallion and were then examined clinically by rectal palpations and ultrasound before being mated naturally or inseminated by fresh or frozen semen. Multivariate logistic regression was used to analyse data. The treatment affected significantly the reproductive efficiency of the mares with fewer oestrus abnormalities (p = 0.0002 and more fertility (p = 0.024 in CF mares (conception rate = 81% versus 55% in SFP mares. Ensuring semi-continous feeding by providing roughage may be a way of fulfilling the basic physiological needs of the horses' digestive system, reducing stress and associated inhibitors of reproduction. To our knowledge, this study provides the first evidence of an impact of temporal feeding patterns on reproductive success in a Mammal. Temporal patterns of feeding may be a major and underestimated factor in breeding.
SOME SERUM BIOCHEMICAL CONSTITUENTS OF MARES DURING DIFFERENT PHASES OF REPRODUCTIVE CYCLE
Directory of Open Access Journals (Sweden)
F. Ali, L. A. Lodhi, Z. I. Qureshi, H. A. Samad and R. U. Shahid1.
2004-07-01
Full Text Available Serum glucose, total proteins, calcium and inorganic phosphorus were determined in estrual, pregnant, infertile and regular breeder mares, each group comprising of 10 animals. The mares were grouped on the basis of rectal examination, history and records. There was a significant (P0.05 difference in the serum phosphorus levels among all the groups of mares.
Characteristics in mineral compositions of lunar latest mare volcanism revealed from spectral data
Kato, S.; Morota, T.; Yamaguchi, Y.; Watanabe, S.; Otake, H.; Ohtake, M.; Nimura, T.
2016-12-01
Lunar mare basalts provide insights into the composition and thermal history of the lunar mantle. According to crater counting analysis with remote sensing data, the ages of mare basalts suggest a first peak of magma activity at 3.2-3.8 Ga and a second peak at 2 Ga. In order to understand the mechanism for causing the second peak and its magma source, we reassess the correlation between the titanium contents and the eruption ages of mare basalt units using the compositional and chronological data updated by SELENE (Kaguya). In the Procellarum KREEP Terrane, where the latest mare basalt units are concentrated, an increase in the mean titanium content is observed in the Eratosthenian Period, as reported by previous studies. We found that, however, a rapid increase in mean titanium content occurred near 2.3 Ga. This result suggests that the magma source of the mare basalts changed at this particular age. Moreover, the high-titanium basaltic eruptions are correlated with the second peak in mare volcanism at 2 Ga. The latest mare volcanism may have been induced by a super-hot plume originating from the core-mantle boundary. In this study, to reveal the difference between the volcanic activities before and after 2.3 Ga, we developed the method to estimate the mineral components and elemental compositions of lunar mare basalts by using the Kaguya Spectral Profiler data. We will introduce the detail of the method and discuss about the difference between the mineral compositions of mare basalts before and after 2.3 Ga based on our preliminary results.
Directory of Open Access Journals (Sweden)
A. L. M. Marinho
2015-06-01
Full Text Available When compared with other domestic animals the equine species is that present the minors reproductive indices. Besides some parameters of estrous cycle are variable to we consider each mare individually, what hinders the reproductive handling, these females respond the alterations of seasonality, this fact limits in reproduction its potential. Therefore, the uses of innovative reproductive biotechnologies and hormonal protocols have shown indispensable for the producers who wish to increase the reproductive rate of this species. Hormontherapy has shown great efficiency in handling the estrous cycle of these females. Thus, this literature review aimed to perform an update regarding hormonal protocols used in the equine species. Dealt with the main hormones used to control the estrous cycle of mares, as prostaglandin F2a (PGF2α, estrogens, progestogens, human chorionic gonadotropin (hCG, the gonadotropin-releasing hormone (GnRH, equine pituitary extract (EPE, the purified equine follicle stimulating hormone (eFSH and oxytocin. It became evident that the knowledge of hormontherapy applied in equine reproduction is of utmost importance, allowing higher profitability by improving the reproductive efficiency of animals of high genetic value, generating benefits for both the professional as to the owner
Experimental exposure of pregnant mares to the asinine-94 strain of equine arteritis virus
Directory of Open Access Journals (Sweden)
J.T. Paweska
1997-07-01
Full Text Available Clinical, virological and serological responses were evaluated in 10 pregnant mares after different challenge exposures to the asinine-94 strain of equine arteritis virus (EAV. The outcome of maternal infection on the progeny was also investigated. Mares were inoculated intranasally (n = 4, intramuscularly (n = 2, intravenously (n = 1, or contact-exposed (n = 3. All inoculated mares developed pyrexia, 5 showed mild clinical signs related to EAV infection and 2 remained asymptomatic. Viraemia was detected in all the inoculated animals and shedding of virus from the respiratory tract occurred in 6. Five mares were re-challenged intranasally 7 and 15 weeks after inoculation. Clinical signs of the disease in these mares were limited to mild conjunctivitis. After re-challenge, virus was recovered from buffy coat cultures of 2 mares 2-6 days after re-infection. EAV was not recovered from colostrum and milk samples during the 1st week post partum. All inoculated mares seroconverted to EAV 8-12 days post inoculation and also seroconverted after re-challenge. No clinical signs of EAV infection were observed in the 3 mares kept in close contact during the post-inoculation and re-challenge periods. Serum neutralising antibody to the virus was detected in 1 in-contact mare only, while a detectable concentration of specific IgG was found by ELISA in the colostrum of 1 of the other in-contact mares. Eight of the mares gave birth to clinically normal foals, although 1 was born prematurely. Shortly after birth, 7 foals developed fever and variable clinical signs; 5 foals became septicaemic and 3 of them died 2-5 days after birth, while the remaining 2 were euthanased at 1 month of age. EAV was not recovered from the placenta, from buffy coat fractions of blood collected from foals immediately after birth and 1-3 days later, or from a range of tissues taken from the 3 foals that died and 2 that were euthanased. Virus was not isolated from tissues collected from
Adams, J. B.; Head, J. W., III; Mccord, T. B.; Pieters, C.; Zisk, S.
1978-01-01
Spectral reflectance measurements of five Luna 24 samples and new telescopic reflectance spectra of 10-20 km areas of seven sites in Mare Crisium have been used to calibrate multispectral images of mare units. Based on these data, three major mare units are defined in the Crisium basin and their stratigraphy is interpreted. The oldest mare unit is exposed in the ejecta of the craters Picard and Peirce and along the outer edge of the southeastern part of the basin. The next younger unit includes the Luna 24 site and generally follows a topographic annulus along the basin margin. The youngest mare unit occupies the central part of the basin. It is concluded that subsidence occurred throughout the emplacement of mare units, including extensive warping and downfaulting of the inner part of the Crisium basin.
von Reitzenstein, Marcela; Callahan, Megan A; Hansen, Peter J; LeBlanc, Michelle M
2002-09-01
An experiment was conducted to determine whether the uterotonic effects of oxytocin, a drug used to treat mares that have a delay in uterine clearance were affected by the sedative detomidine (an alpha2-agonist), a drug used to treat fractious mares. An additional objective was to identify propagation patterns of uterine contractions and determine whether these patterns differed between normal mares and mares with delayed uterine clearance (DUC). Intrauterine pressure was measured in five reproductively normal mares and four mares with DUC during estrus using an 8-F Milar catheter with two discrete pressure sensors. Mares received one of three treatments in random order: detomidine (0.001 mg/kg; i.v.); detomidine followed in 10 min by oxytocin (10 IU; i.v.); and saline (0.9% NaCl 0.5 ml; i.v.) followed in 10 min by oxytocin. All treatments induced waves of contractions; however, only three mares with DUC exhibited contractions after administration of detomidine. Normal mares experienced more uterine contractions (P detomidine before oxytocin increased the number of contractions (P Detomidine had no effect in mares with delayed clearance. All mares had more propagating than non-propagating uterine contractions (74 +/- 8 versus 25 +/- 8%, respectively). Normal mares exhibited a normal propagation pattern more frequently (P detomidine increased the number (P detomidine augmented the uterotonic effect of oxytocin in normal mares but not in mares with DUC. Data suggest that mares with DUC have a defect in myoelectrical signaling and a decrease in the contractile strength of the uterine muscle.
Yoghurt fermentation trials utilizing mare milk: comparison with cow milk
Directory of Open Access Journals (Sweden)
R. Giangiacomo
2011-03-01
Full Text Available Mare milk shows a very interesting nutritional composition, similar to human milk. Whey protein fraction represents about 50% of total proteins, with a good amount of essential amino acids, and high lysozyme concentration (Jauregui-Adell, 1975. Mare milk contains essential fatty acids, progenitors of ω3 and ω6, higher than cow milk (Csapò et al., 1995; Curadi et al., 2002. In east european countries mare milk is utilized in dietetics and therapeutics for gastroenteric and cardiac pathologies (Sharmanov et al., 1982; Mirrakimov et al., 1986, or as a drink obtained from lactic and alcoholic fermentation (Koumiss...
Naming Lunar Mare Basalts: Quo Vadimus Redux
Ryder, G.
1999-01-01
Nearly a decade ago, I noted that the nomenclature of lunar mare basalts was inconsistent, complicated, and arcane. I suggested that this reflected both the limitations of our understanding of the basalts, and the piecemeal progression made in lunar science by the nature of the Apollo missions. Although the word "classification" is commonly attached to various schemes of mare basalt nomenclature, there is still no classification of mare basalts that has any fundamental grounding. We remain basically at a classification of the first kind in the terms of Shand; that is, things have names. Quoting John Stuart Mill, Shand discussed classification of the second kind: "The ends of scientific classification are best answered when the objects are formed into groups respecting which a greater number of propositions can be made, and those propositions more important than could be made respecting any other groups into which the same things could be distributed." Here I repeat some of the main contents of my discussion from a decade ago, and add a further discussion based on events of the last decade. A necessary first step of sample studies that aims to understand lunar mare basalt processes is to associate samples with one another as members of the same igneous event, such as a single eruption lava flow, or differentiation event. This has been fairly successful, and discrete suites have been identified at all mare sites, members that are eruptively related to each other but not to members of other suites. These eruptive members have been given site-specific labels, e.g., Luna24 VLT, Apollo 11 hi-K, A12 olivine basalts, and Apollo 15 Green Glass C. This is classification of the first kind, but is not a useful classification of any other kind. At a minimum, a classification is inclusive (all objects have a place) and exclusive (all objects have only one place). The answer to "How should rocks be classified?" is far from trivial, for it demands a fundamental choice about nature
Schnobrich, M R; Gordon, D L; Scoggin, C F; Bradecamp, E A; Canisso, I F
2017-03-25
Urine pooling, as a persistent condition, is a cause of infertility in mares due to endometrial inflammation and sperm toxicity. Identification of urometra can be challenging in mares presenting with the condition intermittently, or when urine flows into the uterus but is undetectable in the vagina. Currently, there are no reported objective methods to confirm the clinical diagnosis of urine contamination in intrauterine-fluid accumulations. Since creatinine is present in high concentrations in urine and does not diffuse across cell membranes, creatinine concentration should be increased in mares with urometra, but negligible in normal and mares with intrauterine fluid accumulation (non-urometra cases). To test this hypothesis, creatinine concentrations of intrauterine fluid were measured in mares with a clinical diagnosis of urine accumulation (n=9) or intrauterine fluid containing no urine (n=10). Results showed that creatinine concentrations (mg/dl) were significantly higher in mares that had a clinical diagnosis of urometra (42.8±12.6, range 4.1-109.2) compared with those that did not (0.38±0.1, range 0-0.9). Also, two mares after urethral extension surgery demonstrated a remarkable reduction in creatinine concentrations. This study highlights an undocumented approach to confirm a clinical diagnosis of urometra in mares; the authors anticipate that testing for creatinine in the uterine fluid of mares may become a standard tool for identifying urometra in mares and confirming the success of urogenital surgeries. British Veterinary Association.
Sevinga, M; Hesselink, JW; Barkema, H.W.
2002-01-01
Because the incidence of retained placenta in Friesian mares is estimated to be high, and no reports have been published on the reproductive performance of Friesian mares after retained placenta, we studied postpartum reproductive performance in Friesian brood mares with (n = 54) and without (n =
Markiewicz-Kęszycka, Maria; Czyżak-Runowska, Grażyna; Wójtowski, Jacek; Jóźwik, Artur; Pankiewicz, Radosław; Łęska, Bogusława; Krzyżewski, Józef; Strzałkowska, Nina; Marchewka, Joanna; Bagnicka, Emilia
2015-08-30
Mares' milk is becoming increasingly popular in Western Europe. This study was thus aimed at investigating the impact of stage of lactation and season on chemical composition, somatic cell count and some physicochemical parameters of mares' colostrum and milk, and at developing a method for the determination of vitamin C (ascorbic acid) in mares' milk and to determine its content in fresh and stored milk. The analysis conducted showed an effect of the stage of lactation on contents of selected chemical components and physicochemical parameters of mares' milk. In successive lactation periods levels of fat, cholesterol, energy value, citric acid and titratable acidity decreased, whereas levels of lactose and vitamin C, as well as the freezing point, increased. Analysis showed that milk produced in autumn (September, October, November) had a higher freezing point and lower concentrations of total solids, protein, fat, cholesterol, citric acid and energy value in comparison to milk produced in summer (June, July, August). Mares' milk was characterised by low somatic cell count throughout lactation. In terms of vitamin C stability the most advantageous method of milk storage was 6-month storage of lyophilised milk. In general, the results confirmed that mares' milk is a raw material with a unique chemical composition different from that produced by other farm animals. © 2014 Society of Chemical Industry.
Villa Rocca al Mares = Villa in Rocca al Mare / Raul Vaiksoo ; intervjueerinud Margit Mutso
Vaiksoo, Raul, 1955-
2011-01-01
Tallinnas Loigu t. 3 asuva villa arhitektuursest lahendusest. Majas on kasutatud palju klaasi, konstruktsioonid on avatud. Arhitekt Raul Vaiksoo, kaasautor Kristo Vaiksoo, sisearhitektid Raul Vaiksoo ja Krista Aren (Raul Vaiksoo Arhitektuuribüroo). Raul Vaiksoo pälvis Rocca al Mare villa eest EK arhitektuuri sihtkapitali 2010. a. arhitektuuripreemia
Mare Orientale: Widely Accepted Large Impact or a Regular Tectonic Depression?
Kochemasov, G. G.
2018-04-01
Mare Orientale is one of the critical features on Moon surface explaining its tectonics. The impact origin of it is widely accepted, but an attentive examination shows that this large Mare is a part of endogenous tectonic structure, not a random impact.
[A case of 63,X/64,XX mosaicism in a subfertile pony mare].
Pieńkowska-Schelling, A; Handler, J; Neuhauser, S; Schelling, C
2016-04-01
The present case report describes a 6-year old subfertile pony mare, which became pregnant after the eleventh artificial insemination. The examination of the ovaries and the uterus did not reveal any abnormal clinical findings and the mare showed a regular oestrous cycle. Based on cytogenetic and molecular genetic analyses it became possible to elucidate the observed subfertility. The mosaic karyotype of the mare consisted of 63,X (20%) and 64,XX (80%) cells. A PCR analysis failed to amplify sequences from the equine SRY gene. The observed classic 63,X/64,XX mosaicism is a plausible explanation for the subfertility of the mare.
Miks tuli "Kevade" läinud aastal teisiti / Mare Müürsepp
Müürsepp, Mare
2008-01-01
"Aasta rosina" auhinna võitnud Oskar Lutsu "Kevade" kommenteeritud kooliväljaandest "Kui Arno isaga koolimajja jõudis..." (Tallinn : Ilo, 2007), mille koostasid Aili Kalavus ja Mare Müürsepp ning illustreeris Mare Hunt
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1997-07-01
Full Text Available The effect of total protein intake and protein quality on the serum concentrations of certain reproductive hormones during the anovulatory, transitional and ovulatory periods were studied in 36 Anglo-Arab mares. High-quality protein stimulated FSH and LH production during the late transitional period. Serum progestagen and melatonin concentrations were unaffected by the quality of protein nutrition during the anovulatory period. Mares receiving high-quality protein exhibited a 10-14-day cyclical pattern of FSH release approximately 4-6 weeks earlier than the mares fed the lower-quality protein diet, and also ovulated 3-4 weeks earlier than the mares on the lower-quality protein diet. Progesterone concentrations during the 1st oestrous cycle after the anovulatory period were unaffected by protein quality in the diet.
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1998-07-01
Full Text Available Sixty-four Thoroughbred and Anglo-Arab mares aged 6-12 years were used, of which 40 were non-lactating and 24 lactating. Foals from these 24 mares were weaned at the age of 6 months. Non-lactating and lactating mares were divided into 4 dietary groups each. The total daily protein intake and the protein quality (essential amino-acid content differed in the 4 groups of non-lactating and 4 groups of lactating mares. The mares were covered and the effect of the quantity and quality of dietary protein on serum progestagen concentrations during pregnancy was studied. A sharp decline in serum progestagen concentrations was recorded in all dietary groups from Days 18 to 40 of pregnancy, with some individual mares reaching values of less than 4 ng/mℓ. Serum progestagen concentrations recorded in some of the non-lactating mares on the low-quality protein diet increased to higher values (p<0.05 than those of mares in the other 3 dietary groups at 35-140 days of pregnancy. A similar trend was observed for the lactating mares on a low-quality protein diet at 30-84 days of pregnancy. No such trends were observed in any of the other dietary groups. High-quality protein supplementation increased serum progestagen concentrations during the 1st 30 days of pregnancy. Lactation depressed serum progestagen concentrations until after the foals were weaned.
Influence of composition of feed and lactation period on mineral composition of Mare's
Directory of Open Access Journals (Sweden)
Miroslav Fišera
2018-03-01
Full Text Available Normal 0 21 false false false CS X-NONE X-NONE Effects of lactation period and feed on essential minerals composition of mare's milk were studied. Average Ca, P, Na and Mg concentrations in feed DM were 0.66, 4.30, 0.13 and 2.21 g.kg-1 of DM (dry matter, respectively. In regard to milk all elements concentrations were not similar to each other due to the changes of the lactation day differences. Average Ca, P, Na and Mg concentrations (in DM caused by breed differences and lactation days were 1.95, 1.08, 0.53 and 0.22 g.kg-1, respectively. During the milk period, a high-quality feed were maintaining the major mineral composition of mare's milk in 1.5 - 2 times higher amount than milk of mare fed with pasture and a low-quality feed. The colostrum stage of mare was much shorter than other animals, the mare's milk on the 2nd day of lactation showed properties of initial milk in which its composition, particularly in minerals, were two times higher when compare to that on milk periods that was started from 5th day after parturition. It seemed that some factors, except well physiological conditions, such as mare's age, number of foaling, sex of foal etc. did not affect milk nutrient composition.
Soome Citycon ostis Eesti omanikelt Rocca al Mare kaubanduskeskuse / Kadri Masing
Masing, Kadri
2005-01-01
Ilmunud ka: Delovõje Vedomosti 27. juuli lk. 4. Rocca al Mare kaubanduskeskuse soomlastest uued omanikud hakkavad laiendama sealset kaubanduspinda, mille arendamiseks on ette nähtud 3 aastat ning sellest peaks saama Eesti üks suurimaid müügikeskusi. Vt. samas: Konkurendid rõõmustavad. Lisa: Uus omanik tahab muuta Rocca al Mare suurimaks
The Thickness and Volume of Young Basalts Within Mare Imbrium
Chen, Yuan; Li, Chunlai; Ren, Xin; Liu, Jianjun; Wu, Yunzhao; Lu, Yu; Cai, Wei; Zhang, Xunyu
2018-02-01
Basaltic volcanism is one of the most important geologic processes of the Moon. Research on the thickness and volume of late-stage basalts of Mare Imbrium helps better understand the source of lunar volcanism and eruption styles. Based on whether apparent flow fronts exist or not, the late-stage basalts within Mare Imbrium were divided into two groups, namely, Upper Eratosthenian basalts (UEm) and Lower Eratosthenian basalts (LEm). Employing the topographic profile analysis method for UEm and the crater excavation technique for LEm, we studied the thickness and distribution of Eratosthenian basalts in Mare Imbrium. For the UEm units, their thicknesses were estimated to be 16-34 (±2) m with several layers of individual lava ( 8-13 m) inside. The estimated thickness of LEm units was 14-45(±1) m, with a trend of reducing thickness from north to south. The measured thickness of late-stage basalts around the Chang'E-3 landing site ( 37 ± 1 m) was quite close to the results acquired by the lunar penetrating radar carried on board the Yutu Rover ( 35 m). The total volume of the late-stage basalts in Mare Imbrium was calculated to be 8,671 (±320) km3, which is 4 times lower than that of Schaber's estimation ( 4 × 104 km3). Our results indicate that the actual volume is much lower than previous estimates of the final stage of the late basaltic eruption of Mare Imbrium. Together, the area flux and transport distance of the lava flows gradually decreased with time. These results suggest that late-stage volcanic evolution of the Moon might be revised.
33 CFR 334.1160 - San Pablo Bay, Calif.; target practice area, Mare Island Naval Shipyard, Vallejo.
2010-07-01
... practice area, Mare Island Naval Shipyard, Vallejo. 334.1160 Section 334.1160 Navigation and Navigable... REGULATIONS § 334.1160 San Pablo Bay, Calif.; target practice area, Mare Island Naval Shipyard, Vallejo. (a..., Mare Island Naval Shipyard, Vallejo, California, will conduct target practice in the area at intervals...
Tracey Emin - 20 aastat vabadust / Mare Tralla
Tralla, Mare, 1967-
2008-01-01
Edinburghi kunstifestivali "Fringe" raames Šoti moodsa kunsti rahvusgaleriis kuni 9. XI avatud Tracey Emini retrospektiivist "Tracey Emini 20 aastat". Kunstnikust ja tema loomingust. Festivali programmi oli valitud ka Mare Tralla projekt "Kaitstud"
Oxender, W D; Noden, P A; Hafs, H D
1977-02-01
On December 11, 1974, 15 seasonally anestrous mares were assigned at random to 1 of 3 experimental groups: outdoor-control, indoor-control, or indoor light-treated (a 16-hour photo-period). This experiment was terminated on April 21, 1975. The five mares in the indoor light-treated group ovulated 59.0+/-6.9 days later, which was 74 days earlier (P less than 0.01) than 2 of the 5 outdoor-controls (the other 3 ovulated after April 21 during a subsequent experiment) and 50 days earlier (P less than 0.05) than the indoor-controls. Durations of the 1st estrus for the 3 groups of mares were 13.3+/-3.6, 8.4+/-2.0, and 6.0+/-1.0 days for the indoor light-treated, indoor-control, and outdoor-control groups, respectively. The indoor light-treated mares averaged 4.2 estrous cycles before April 21, the indoor-control mares averaged 1.4 estrous cycles, and 2 of 5 outdoor-control mares ovulated 1 time during the experiment. The peripheral blood luteinizing hormone (LH), estradiol, and progesterone concentrations were minimal during winter anestrous. The hormone changes normally associated with estrous cycle activity in mares--maximal estradiol and luteinizing hormone concentrations near ovulation and maximal progesterone concentration during diestrus--were observed in all mares beginning at the 1st estrus. Hair loss was observed earlier in the light-treated mares, than in either of the other groups. In conclusion, a 16-hour photo-period initiated in early December for anestrous brood mares caused endocrinologically normal estrous cycles to begin within 2 months. This may allow breeding and foaling considerably earlier than normally expected.
Sharpton, V. L.; Head, J. W., III
1983-01-01
Two subsurface reflecting horizons have been detected by the Apollo Lunar Sounder Experiment (ALSE) in the southern Mare Serenitatis which appear to be regolith layers more than 2 m thick, and are correlated with major stratigraphic boundaries in the southeastern Mare Serenitatis. The present stratigraphic boundaries in the southeastern Mare Serenitatis. The present analysis implies that the lower horizon represents the interface between the earliest mare unit and the modified Serenitatis basin material below. The depth of volcanic fill within Serenitatis is highly variable, with an average thickness of mare basalts under the ALSE ground track of 1.6 km. Comparisons with the Orientale basin topography suggests that a major increaae in load thickness could occur a few km basinward of the innermost extent of the traverse. The history of volcanic infilling of Mare Serenitatis was characterized by three major episodes of volcanism.
Tundetargad meeskonnad on head suhtekorraldajad / Mare Pork
Pork, Mare
2003-01-01
Psühholoogiaprofessor Mare Pork defineerib meeskonna emotsionaalse intelligentsuse mõiste ja kirjeldab kõrge EQ-ga meeskonna tunnuseid. Lisad: Mis arendab meeskonna EQ-d?; Meeskonna emotsionaalne intelligentsus EQ nelja komponendi järgi
Neutrophil extracellular traps formation by bacteria causing endometritis in the mare.
Rebordão, M R; Carneiro, C; Alexandre-Pires, G; Brito, P; Pereira, C; Nunes, T; Galvão, A; Leitão, A; Vilela, C; Ferreira-Dias, G
2014-12-01
Besides the classical functions, neutrophils (PMNs) are able to release DNA in response to infectious stimuli, forming neutrophil extracellular traps (NETs) and killing pathogens. The pathogenesis of endometritis in the mare is not completely understood. The aim was to evaluate the in vitro capacity of equine PMNs to secrete NETs by chemical activation, or stimulated with Streptococcus equi subspecies zooepidemicus (Szoo), Escherichia coli (Ecoli) or Staphylococcus capitis (Scap) strains obtained from mares with endometritis. Ex vivo endometrial mucus from mares with bacterial endometritis were evaluated for the presence of NETs. Equine blood PMNs were used either without or with stimulation by phorbol-myristate-acetate (PMA), a strong inducer of NETs, for 1-3h. To evaluate PMN ability to produce NETs when phagocytosis was impaired, the phagocytosis inhibitor cytochalasin (Cyt) was added after PMA. After the addition of bacteria, a subsequent 1-h incubation was carried out in seven groups. NETs were visualized by 4',6-diamidino-2-phenylindole (DAPI) and anti-histone. Ex vivo samples were immunostained for myeloperoxidase and neutrophil elastase. A 3-h incubation period of PMN + PMA increased NETs (p Ecoli or Scap (p < 0.05). Ex vivo NETs were present in mares with endometritis. Scanning electron microscopy showed the spread of NETs formed by smooth fibers and globules that can be aggregated in thick bundles. Formation of NETs and the subsequent entanglement of bacteria suggest that equine NETs might be a complementary mechanism in fighting some of the bacteria causing endometritis in the mare. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Hemoperitoneum secondary to cecocolic dilation in a pregnant mare
Directory of Open Access Journals (Sweden)
Alejandro R. Palomar
2017-06-01
Full Text Available Hemoperitoneum is known as the abnormal accumulation of blood within the abdominal cavity, most commonly caused by gastrointestinal bleeding, abdominal abscesses, liver tumors, migration of parasitic larvae (Strongylus vulgaris, direct trauma and blood clotting disorders. Lethargy, anorexia, weakness, muscle twitching, sweating, hyperthermia, tachycardia, tachypnea, and the accumulation of free fluid in the abdomen were the most commonly recorded signs. In this report, a pregnant mare was diagnosed with hemoperitoneum secondary to cecocolic dilatation, due to corn ingestion. The protocol for clinical treatment and tests varies in similar reported cases. Due to this, the present report discusses the outcome of a clinical case and suggests a medical protocol -based on evidence – for treatment in a pregnant mare. The treatment was aimed to stop the bleeding, while normalize or maintain a stable blood pressure and provide supportive therapy. The mare presented colic pains due to fermentation of the corn, which were solved in few hours. The final abdominal ultrasonogram showed intra-abdominal hypoechoic fluid and living fetus.
Equine alpha-fetoprotein levels in Lipizzaner mares with normal pregnancies and with pregnancy loss.
Vincze, Boglárka; Gáspárdy, András; Kulcsár, Margit; Baska, Ferenc; Bálint, Ádám; Hegedűs, György Tamás; Szenci, Ottó
2015-12-01
Alpha-fetoprotein has proved to be a good indicator of fetal well-being in human medicine for decades. Although this molecule is present in most of the mammalian species including horses, reference values in healthy and high-risk pregnant mares have not yet been published. The aim of the present study was to determine whether equine alpha-fetoprotein (eqAFP) is a good indicator of complicated pregnancies in Lipizzaner mares. A total of 111 serum samples from 30 mares have been analyzed for eqAFP levels throughout gestation (Days 60-325). After the pregnancy was confirmed, 23 mares had normal pregnancies with viable foals, six had late embryonic loss, and one of the mares aborted in the ninth gestational month. Equine alpha-fetoprotein concentrations significantly differed in the normal group (72.93 ± 49.25 pg/mL; mean ± standard deviation) and in the complicated pregnancy loss group (152 ± 36.48 pg/mL; mean ± standard deviation). The mares' age, gestational age, and the conception rate significantly affected the alpha-fetoprotein concentrations in the normal group. Furthermore, notable individual differences occurred in eqAFP concentrations between mares. Equine alpha-fetoprotein seems to be an important indicator of fetal well-being in horses, but there are still some unanswered questions (levels in foals of different age, ponies, and draft horses) regarding this serum protein. Large-scale studies are needed to assess the specificity, sensitivity, and reliability of this test as a possible future diagnostic tool for fetal well-being in horses. Copyright © 2015 Elsevier Inc. All rights reserved.
Sevinga, M; Hesselink, JW; Barkema, H.W.
2001-01-01
Postpartum reproductive performance was studied in 54 Friesian brood mares with and 50 without retained placenta. Retained placenta was defined as failure to expel all fetal membranes within 3 hours after the delivery of the foal. The group of mares with retained placenta was subdivided into mares
Directory of Open Access Journals (Sweden)
Fernanda M. Pazinato
Full Text Available Abstract: The placenta is a transitory organ that originates from maternal and fetal tissues, the function of which is transporting nutrients from the mother to the fetus. The aim of this study was describe the histological features of placentas in healthy Thoroughbred mares at foaling and evaluate their relation with the gross placental and data of these mares. For this study 188 Thoroughbred mares were used. It was performed clinical observation for signs of placentitis during daily health checks and ultrasonic examination monthly to assess the fetus and placenta. All of the mares that exhibited clinical signs of placentitis were treated during gestation. The parturition was assisted, the placentas were grossly evaluated and samples were collected immediately after expulsion. The following data were considered for each mare: age, gestational age, number of parturition, time for placental expulsion, umbilical-cord length, placental weight and clinical signs of placentitis. Histological evaluation of the placentas revealed extensive cytoplasmic vacuolization of the epithelial areolar cells, presence of inflammatory infiltrates and hypoplasia-atrophy of the microcotyledons. Most of the gross placental findings were consistent with the histological results. In conclusion the mares with a vacuolated placental chorionic epithelium were older and had experienced a larger number of births. Great part of the mares with inflammatory infiltrates did not showed any clinical signs of placentitis during gestation.
Heavy metals pollution influences the soil of Baia Mare city Roumania
International Nuclear Information System (INIS)
Dumitrescu, L.; Petrescu, L.; Stanescu, L.F.; Bilal, E.
2010-01-01
For a connection between the environment close by industrial area and residential area; where the consequences heavy metal pollution are more acute, we had drawn samples inside Romplumb S.A. factory in Baia Mare city (Romania), the main heavy metal pollution agent, close by this factory, cross roads, areas close by parks and areas far off the main pollution agent. These samples had drawn both on the surface soil and 15 cm depth. In this subchapter we will present the analyses types and the results of these analyses taking into account the chemistry composition of drawing samples. A half of each sample was crushed very fine for ICP, XRF. From uncrushed half a part was crushed at 2 accordance with ICP results and these distributions on maps, we can see that the biggest heavy metals amount is in N-E of Baia Mare (zone I) due to the main pollution factor, Romplumb S.A... The pollution for zone II is not as big as zone I. Heavy metals in this zone are due to emission released by Romplumb S.A. and Phonix S.A. which are carry by air and due to the cross roads. The high amount of heavy metal from Baia Mare soils affects more and more people health. Health Direction Baia Mare made a lot of investigation on Baia Mare Soil. The results of these investigations are: - The hope life is smaller with 2,2 years than usual - Mortality is bigger with 10-15% than usual - Avitaminoza D*2 is 65-95% - Metabolism diseases due to Pb are frequent with 40-60%
In vitro screening of mare's milk antimicrobial effect and antiproliverative activity.
Guri, Anilda; Paligot, Michele; Crèvecoeur, Sebastien; Piedboeuf, Benoit; Claes, Jonathan; Daube, Georges; Corredig, Milena; Griffiths, M W; Delcenserie, Veronique
2016-01-01
The aims of this study were to examine the effect of mare's milk on virulence gene expression of Salmonella Typhimurium and observe its potential activity on proliferation of adenocarcinoma Caco-2 cells. Different supernatants of mare's milk, raw or heat-treated at 65°C for 15 s or 30 min, were studied. The changes in hilA gene expression of Salmonella Typhimurium in presence of mare's milk supernatants were assessed using a reporter luminescent strain. A significant decrease in hilA gene expression was observed with all tested supernatants. Virulence gene expression was then assessed using qPCR on a wild-type strain of Salmonella Typhimurium. A significant decrease of hilA and ssrB2 gene expression was observed with raw milk supernatants but not with heat-treated supernatants. The same supernatants were administered to Caco-2 cells to measure their proliferation rate. A significant reduction of proliferative effect was observed only with raw milk supernatants. This study reports that raw mare's milk was able to modulate virulence gene expression of Salmonella Typhimurium and exerts antiproliferative effects on Caco-2 cells. These results may offer new approaches for promoting gastrointestinal health. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Relationship between the latest activity of mare volcanism and topographic features of the Moon
Kato, Shinsuke; Morota, Tomokatsu; Yamaguchi, Yasushi; Watanabe, Sei-ichiro; Otake, Hisashi; Ohtake, Makiko
2016-04-01
Lunar mare basalts provide insights into compositions and thermal history of lunar mantle. According to crater counting analysis with remote sensing data, the model ages of mare basalt units indicate a second peak of magma activity at the end of mare volcanism (~2 Ga), and the latest eruptions were limited in the Procellarum KREEP Terrane (PKT), which has high abundances of heat-producing elements. In order to understand the mechanism for causing the second peak and its magma source, we examined the correlation between the titanium contents and eruption ages of mare basalt units using compositional and chronological data updated by SELENE/Kaguya. Although no systematic relationship is observed globally, a rapid increase in mean titanium (Ti) content occurred at 2.3 Ga in the PKT, suggesting that the magma source of mare basalts changed at that time. The high-Ti basaltic eruption, which occurred at the late stage of mare volcanism, can be correlated with the second peak of volcanic activity at ~2 Ga. The latest volcanic activity can be explained by a high-Ti hot plume originated from the core-mantle boundary. If the hot plume was occurred, the topographic features formed by the hot plume may be remained. We calculated the difference between topography and selenoid and found the circular feature like a plateau in the center of the PKT, which scale is ~1000 km horizontal and ~500 m vertical. We investigated the timing of ridge formation in the PKT by using stratigraphic relationship between mare basalts and ridges. The ridges were formed before and after the high-Ti basaltic eruptions and seem to be along with the plateau. These results suggest that the plateau formation is connected with the high-Ti basaltic eruptions.
Tall-building development process in downtown Maringá-PR, Brazil
Directory of Open Access Journals (Sweden)
José Roberto Machado
2012-02-01
Full Text Available This work describes the urbanization process taking place in the city of Maringá, in the context of the tallbuilding development at its main economic axis, the city center. This research aims to conduct an in-depth analysis of the role played by the housing industry in the development of tall buildings at downtown Maringá, the origin of the capital associated to such process, and the rationale for building them in Zone 1 (downtown. This is also analyzed considering local environmental information and infrastructural considerations involved in this process.
Juhid otsustavad saatuste üle / Mare Pork
Pork, Mare
2001-01-01
Ilmunud ka: Spekter, nr. 1, 2002, lk. 25-26. Psühholoogiaprofessor ja juhtimiskonsultant Mare Pork sellest, et tunded mõjutavad juhte rohkem, kui nad seda tajuvad ning, et juhid mõjutavad omakorda inimsaatusi. Erinevatest meetoditest juhtide hindamiseks, 360o tagasiside meetod
Where was the 1898 Mare Island Earthquake? Insights from the 2014 South Napa Earthquake
Hough, S. E.
2014-12-01
The 2014 South Napa earthquake provides an opportunity to reconsider the Mare Island earthquake of 31 March 1898, which caused severe damage to buildings at a Navy yard on the island. Revising archival accounts of the 1898 earthquake, I estimate a lower intensity magnitude, 5.8, than the value in the current Uniform California Earthquake Rupture Forecast (UCERF) catalog (6.4). However, I note that intensity magnitude can differ from Mw by upwards of half a unit depending on stress drop, which for a historical earthquake is unknowable. In the aftermath of the 2014 earthquake, there has been speculation that apparently severe effects on Mare Island in 1898 were due to the vulnerability of local structures. No surface rupture has ever been identified from the 1898 event, which is commonly associated with the Hayward-Rodgers Creek fault system, some 10 km west of Mare Island (e.g., Parsons et al., 2003). Reconsideration of detailed archival accounts of the 1898 earthquake, together with a comparison of the intensity distributions for the two earthquakes, points to genuinely severe, likely near-field ground motions on Mare Island. The 2014 earthquake did cause significant damage to older brick buildings on Mare Island, but the level of damage does not match the severity of documented damage in 1898. The high intensity files for the two earthquakes are more over spatially shifted, with the centroid of the 2014 distribution near the town of Napa and that of the 1898 distribution near Mare Island, east of the Hayward-Rodgers Creek system. I conclude that the 1898 Mare Island earthquake was centered on or near Mare Island, possibly involving rupture of one or both strands of the Franklin fault, a low-slip-rate fault sub-parallel to the Rodgers Creek fault to the west and the West Napa fault to the east. I estimate Mw5.8 assuming an average stress drop; data are also consistent with Mw6.4 if stress drop was a factor of ≈3 lower than average for California earthquakes. I
Lunar mare TiO2 abundances estimated from UV/Vis reflectance
Sato, Hiroyuki; Robinson, Mark S.; Lawrence, Samuel J.; Denevi, Brett W.; Hapke, Bruce; Jolliff, Bradley L.; Hiesinger, Harald
2017-11-01
The visible (400-700 nm) and near-infrared (700-2800 nm) reflectance of the lunar regolith is dominantly controlled by variations in the abundance of plagioclase, iron-bearing silicate minerals, opaque minerals (e.g., ilmenite), and maturation products (e.g., agglutinate glass, radiation-produced rims on soil grains, and Fe-metal). The same materials control reflectance into the near-UV (250-400 nm) with varying degrees of importance. A key difference is that while ilmenite is spectrally neutral in the visible to near-infrared, it exhibits a diagnostic upturn in reflectance in the near-UV, at wavelengths shorter than about 450 nm. The Lunar Reconnaissance Orbiter Wide Angle Camera (WAC) filters were specifically designed to take advantage of this spectral feature to enable more accurate mapping of ilmenite within mare soils than previously possible. Using the reflectance measured at 321 and 415 nm during 62 months of repeated near-global WAC observations, first we found a linear correlation between the TiO2 contents of the lunar soil samples and the 321/415 nm ratio of each sample return site. We then used the coefficients from the linear regression and the near-global WAC multispectral mosaic to derive a new TiO2 map. The average TiO2 content is 3.9 wt% for the 17 major maria. The highest TiO2 values were found in Mare Tranquillitatis (∼12.6 wt%) and Oceanus Procellarum (∼11.6 wt%). Regions contaminated by highland ejecta, lunar swirls, and the low-TiO2 maria (e.g., Mare Frigoris, the northeastern units of Mare Imbrium) exhibit very low TiO2 values (2.6 Ga), whereas only medium to high TiO2 values (average = 6.8 wt%, minimum = 4.5 wt%) are found for younger mare units (<2.6 Ga).
Klõsheiko, Mare Vint, effid / Harry Liivrand
Liivrand, Harry, 1961-
2005-01-01
Tallinna Kinomajas esilinastusid 28. okt. kolm uut dokumentaalfilmi eesti kunstnikest : "F.F.F.F. läheb laiali" (Kuukulgur Film 2005, rezh. Marko Raat, "Mare Vint" (Exitfilm 2005, rezh. Anri Rulkov) ja "Jaan Klõsheiko" (Estonia Film 2005, rezh.-d Eve Ester, Igor Ruus)
Towards a typology of the mares sandstone of Mallorca Concept, characterization and stratigraphy
International Nuclear Information System (INIS)
Mas Gornals, C.
2017-01-01
The mares sandstone has traditionally been the most representative and characteristic building stone on the island of Mallorca, used practically exclusively as construction material for centuries, since the abandonment of stone-and-mortar walls, until its progressive disuse with the appearance of the re-enforced concrete, which finally eclipsed its use. Such emblematic buildings for the island, as Bellver Castle, the Cathedral, La Lonja or the old city walls of Palma, bear witness to this. In Mallorca, the mares sandstone is quarried in the open air or in subterranean galleries. Vernacular architecture has always used the most accessible appropriate materials, and in the case of the mares sandstone, its abundance, sufficient softness, which facilitates its extraction, Together with sufficient hardness to confer solidity and durability in constructions, converge. The lack of specific scientific and geological data published about the different types of mares in Mallorca, added to the recent resurgence of technical, applied and landscape interest in this stone, have made a revision of its definition, characterization and classification necessary. [es
Green glass vitrophyre 78526 - An impact of very low-Ti mare basalt composition
Warner, R. D.; Taylor, G. J.; Kiel, K.; Planner, H. H.; Nehru, C. E.; Ma, M.-S.; Schmitt, R. A.
1978-01-01
Rake sample 78526 is an 8.77 g rock consisting primarily of vitrophyric pale green glass with subordinate mineral and lithic relics. Petrographic and compositional evidence leads to the following conclusions: (1) the bulk composition represents that of a mixture formed by impact melting of at least two different textural and compositional varieties of VLT mare basalt that are now present in the rock as lithic relics and a poorly defined low-Ti mare basalt component observed in thin section only in the form of isolated mineral relics; (2) the admixed VLT mare basalts had REE abundances lower than those found in other mare basalts (but probably higher than emerald green glass) and REE patterns showing significant enrichment of the heavy relative to light REE's, suggesting that they were derived by comparatively high degrees of partial melting of a clinopyroxene-rich source region; and (3) the impact melt supercooled to produce the vitrophyre, with rather sharply contrasting textural domains present in the vitrophyre resulting from differences in nucleation kinetics and degrees of supercooling in various portions of the sample.
Effect of β-carotene integration to Italian trotter mares in peripartum
Directory of Open Access Journals (Sweden)
A. Falaschini
2011-03-01
Full Text Available In Italy trotter horses begin racing activity in the summer, two years after their birth year, so that the foals born in the first months of the year are better developed than those born in late spring-summer. As it is known, mares are characterised by an oestrus cyclic activity, which founds its best time in spring. The management of trotter mares tries to anticipate the foaling at first months of the year and therefore the next oestrus cycle, too...
Collas, C; Fleurance, G; Cabaret, J; Martin-Rosset, W; Wimel, L; Cortet, J; Dumont, B
2014-08-01
Agroecology opens up new perspectives for the design of sustainable farming systems by using the stimulation of natural processes to reduce the inputs needed for production. In horse farming systems, the challenge is to maximize the proportion of forages in the diet, and to develop alternatives to synthetic chemical drugs for controlling gastrointestinal nematodes. Lactating saddle mares, with high nutritional requirements, are commonly supplemented with concentrates at pasture, although the influence of energy supplementation on voluntary intake, performance and immune response against parasites has not yet been quantified. In a 4-month study, 16 lactating mares experimentally infected with cyathostome larvae either received a daily supplement of barley (60% of energy requirements for lactation) or were non-supplemented. The mares were rotationally grazed on permanent pastures over three vegetation cycles. All the mares met their energy requirements and maintained their body condition score higher than 3. In both treatments, they produced foals with a satisfying growth rate (cycle 1: 1293 g/day; cycle 2: 1029 g/day; cycle 3: 559 g/day) and conformation (according to measurements of height at withers and cannon bone width at 11 months). Parasite egg excretion by mares increased in both groups during the grazing season (from 150 to 2011 epg), independently of whether they were supplemented or not. This suggests that energy supplementation did not improve mare ability to regulate parasite burden. Under unlimited herbage conditions, grass dry matter intake by supplemented mares remained stable around 22.6 g DM/kg LW per day (i.e. 13.5 kg DM/al per day), whereas non-supplemented mares increased voluntary intake from 22.6 to 28.0 g DM/kg LW per day (13.5 to 17.2 kg DM/al per day) between mid-June and the end of August. Hence total digestible dry matter intake and net energy intake did not significantly differ between supplemented and non-supplemented mares during the
Male, female and management risk factors for non-return to service in Dutch mares.
Buiten, van A.; Westers, P.; Colenbrander, B.
2003-01-01
The "effect" of stallion, mare and management-related factors on the odds of pregnancy per cycle in the horse were identified and quantified from the breeding records of Dutch Warmblood (n=4491), Friesian (n=1467) and Shetland-pony mares (n=3267) mated either naturally or by artificial insemination
Bower, M A; Campana, M G; Whitten, M; Edwards, C J; Jones, H; Barrett, E; Cassidy, R; Nisbet, R E R; Hill, E W; Howe, C J; Binns, M
2011-04-23
The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to 'A Royal Mare'). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no evidence to support exclusive Arab maternal origins as some historical records have suggested, or a significant importation of Oriental mares (the term used in historic records to refer to Middle East and western Asian breeds including Arab, Akhal-Teke, Barb and Caspian). Instead, we show that Thoroughbred foundation mares had a cosmopolitan European heritage with a far greater contribution from British and Irish Native mares than previously recognized.
CHARACTERIZATION OF LACTIC ACID BACTERIA ISOLATED FROM SUMBAWA MARE MILK
Directory of Open Access Journals (Sweden)
Nengah Sujaya
2008-06-01
Full Text Available A study was carried out to isolate and characterize lactic acid bacteria (LAB from the Sumbawa mares milk The Isolation of LAB was conducted in Man Rogosa Sharpe (MRS agar. The isolates were characterized by standard methods, such as Gram staining, cell morphology study and fermentation activities. The ability of the isolates to inhibit some pathogenic bacteria was studied by dual culture assay. Isolates showing the widest spectrum of inhibiting pathogenic bacteria were further identified using API 50 CHL. The results showed that Sumbawa mare milk was dominated by lactobacilli and weisella/leuconostoc. As many as 26 out 36 isolates belong to homofermentative lactobacilli and another 10 isolates belong to both heterofermentative lactobacilli and weissella or leuconostoc. Twenty four isolates inhibited the growth of Escherichia coli 25922, Shigela flexneri, Salmonella typhimurium, and Staphylococcus aureus 29213. Two promising isolates with the widest spectrum of inhibiting pathogenic bacteria, Lactobacillus sp. SKG34 and Lactobacillus sp. SKG49, were identified respectively as Lactobacillus rhamnosus SKG34 and Lactobacillus ramnosus SKG49. These two isolates were specific strains of the sumbawa mare milk and are very potential to be developed as probiotic for human.
Hadley Rille, lava tubes and mare volcanism at the Apollo 15 site
International Nuclear Information System (INIS)
Greeley, R.; Spudis, P.D.
1985-01-01
Hadley Rille appears to be a collapsed lava tube/channel, whose formation history may be more intimately related to the mare units sampled at 15 than was previously thought. More work is needed relating samples and observations from Apollo 15 to the rille and its geologic evolution. As the only sinuous rille visited during the Apollo missions, Hadley Rille represents a data source that is directly applicable to the deciphering of processes involved in lunar mare volcanism
Allen, W R; Wilsher, S; Morris, L; Crowhurst, J S; Hillyer, M H; Neal, H N
2006-09-01
Mares are occasionally encountered that consistently fail to conceive when inseminated, naturally or artificially, with fertile stallion semen in the absence of any identifiable pathology of either the structure or function of their reproductive tract. Temporary blockage of the oviducts by accumulations of naturally occurring oviducal masses may be preventing oviducal transport of the embryo to the uterus. Mares, with known reproductive histories, that had exhibited inexplicable failure of conception were treated by laparoscopically guided administration of PGE2-laced triacetin gel directly onto the surface of their oviducts. Fifteen mares age 10-21 years that had exhibited inexplicable failure of conception during 1-4 years were treated, of which 14 (93%) conceived within the same or subsequent breeding season. The high success rate of this treatment supports the tentative diagnosis of oviducal obstruction in these mares and indicates that blockage of the mare's oviducts may occur in the form of a moveable accumulation of debris rather than from permanent fibrous adhesions resulting from salpingitis. This laparoscopic application of PGE2 to the oviducts constitutes a sound and practical method of restoring fertility in mares suffering oviducal obstruction and further studies involving the procedure are warranted.
Schneeweiss, Wilfried; Krump, Lea; Metcalfe, Lucy; Ryan, Eoin; Beltman, Marijke; Jahns, Hanne; David, Florent
2015-02-01
To report successful minimally invasive treatment of a uterine leiomyoma in a cow and a mare. Clinical report. Limousine cow (n = 1), Thoroughbred mare (n = 1). A 10-year-old cow and an 18-year-old mare were presented for difficulties in breeding and infertility, respectively. Examination of the reproductive tract revealed the presence of a large mass attached to the uterine wall via a wide and short peduncle in both cases. The mass expanded into the uterine lumen in the mare and into the abdomen in the cow. Both masses were removed using a minimally invasive endoscopic approach and a vessel-sealing and dividing device. Minimally invasive surgical resection of a subserosal and a submucosal leiomyoma with maximal sparing of uterine tissue resulted in a short convalescence period and apparent return to breeding function in a cow and a mare. Use of a vessel-sealing and dividing device provided excellent hemostasis and decreased tissue handling. Leiomyoma with short, wide, and thick peduncles were treated successfully in a cow and a mare with minimally invasive endoscopic approaches aiming at maximal uterine tissue preservation. © Copyright 2014 by The American College of Veterinary Surgeons.
Directory of Open Access Journals (Sweden)
Germán Ramírez
2006-06-01
Full Text Available Today, there still exists a controversial issue, as to the high incidence of early embryonic death in mares, mated on the first post partum oestrus. The purpose of this study was first, to determine the post partum period of uterine involution in fine pace Colombian mares using endometrial cytology and ultra sonograph. Secondly, to determine the relation between the neutrophil percentages found in cytology and the echogenicity of accumulated intrauterine fluid during the first 30 post partum days. Twenty (n=20 mares were examined beginning on the 6th post partum day and on alternate days, up to the 30th day. All subjects were grazing Kikuyo grass (Pennisetum clandestinum at la Sabana de Bogotá, 2.600 meters over sea level, 4 º north latitude and with an average temperature of 13 º C. From the 3rd postpartum day, all 20 mares were exposed to 2 healthy stallions, to establish their heat behaviour. Ten of them, following complete randomization, were inseminated on the first postpartum heat, while the others were inseminated on the second post partum heat. Genital examination was carried out by a technician, who did not know the reproductive history of any of the experimental mares. Examinations included rectal palpation, ultra sonograph (Pie Medical 480, linear array, 5 MHz, vaginal swabs and endometrial cytology. Uterine dimension was recorded by rectal palpation and ultra sonograph, it was included the uterine horn dimensions (tip, middle, and corporo-cornual junction of previously gravid and non gravid uterus. Intrauterine fluid detection was performed by the use of an echogenicity scale. Ovaric structures were recorded (preovulatory follicles and ovulation. Pregnancy diagnosis was performed on day 15 post ovulation and then confirmed on day 40. Endometrial cytology samples were taken from uterus after the perineal area was disinfected using non covered isopos with a Pollanski speculum. Smears specimens were fixed with metil alcohol for 15
Rapacz-Leonard, A; Raś, A; Całka, J; Janowski, T E
2015-09-01
Fetal membrane retention can be a life-threatening condition and its incidence exceeds 50% in heavy draught mares. Although fetal membrane retention is commonly treated with repeated injections of oxytocin, based on the suggestion that it is caused mainly by secondary atony of the uterus, this treatment sometimes fails. This led us to ask if expression of oxytocin receptors differs in mares that retain fetal membranes due to secondary uterine atony. To determine whether expression of oxytocin receptors in equine placental tissues differs when heavy draught mares expel fetal membranes or retain them because of secondary uterine atony. Controlled study using archived tissues. Placental biopsies (containing the endometrium and allantochorion) were taken from 8 heavy draught mares during parturition. Four mares expelled fetal membranes shortly after foaling (control mares) and 4 mares retained them (expulsion time was >3 h from delivery). The 4 mares that retained fetal membranes had secondary atony of the uterus. The amount of oxytocin receptors was estimated by measuring the intensity of western blot bands. The presence and location of oxytocin receptors were determined by immunocytochemistry. Oxytocin receptor expression was nearly 50 times less intense in mares with placenta retention due to secondary atony of the uterus and immunocytochemical staining was barely visible. In the control mares, oxytocin receptors were found in both epithelial and endothelial cells of the placenta and staining was most intense where the endometrium contacts the allantochorion. Inadequate expression of oxytocin receptors may be a cause of uterine atony leading to fetal membrane retention. © 2015 EVJ Ltd.
DEFF Research Database (Denmark)
Søndergaard, Eva; Jago, J.
2010-01-01
at a mean age of 14 days. The approach and leave behaviour of mare-foal pairs were observed at pasture during week 5 to evaluate their relationship. Mares of H foals were less active in keeping the pair together than mares of C foals (GLM: F1,33 = 6.81; P
Toonart Rääski ja Aivar Riisalu firma ostab Rocca al Mare Suurhalli / Kristina Traks
Traks, Kristina, 1976-
2003-01-01
Ilmunud ka: Delovõje Vedomosti 22. okt. lk. 7. Rocca al Mare Suurhalli aktsionärid otsustasid müüa suurhalli hotelliärimehe Toonart Rääski ja meelelahutusettevõtja Aivar Riisaluga seotud firmale Neckman Group. Diagramm: Lemminkäinen Eesti, Neckman Groupi, Eesti riigi ja Tallinna linna osalused Rocca al Mare Suurhallis
Bower, M. A.; Campana, M. G.; Whitten, M.; Edwards, C. J.; Jones, H.; Barrett, E.; Cassidy, R.; Nisbet, R. E. R.; Hill, E. W.; Howe, C. J.; Binns, M.
2011-01-01
The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to ‘A Royal Mare’). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no evidence to support exclusive Arab maternal origins as some historical records have suggested, or a significant importation of Oriental mares (the term used in historic records to refer to Middle East and western Asian breeds including Arab, Akhal-Teke, Barb and Caspian). Instead, we show that Thoroughbred foundation mares had a cosmopolitan European heritage with a far greater contribution from British and Irish Native mares than previously recognized. PMID:20926431
LANDSLIDES INCIDENCE IN THE PIEDMONT OF BAIA MARE URBAN AREA (CASE STUDIES
Directory of Open Access Journals (Sweden)
S. ZAHARIA
2012-12-01
Full Text Available The landslides incidence in the piedmont of baia mare urbana area cae studies. The General Urban Plan (GUP of Baia Mare municipality requires the study of expected susceptibility for landslides in order to build infrastructure within sustainable development conditions. The complexity and diversity of local geographic area factors, strongly affected by the human pressure, favours the triggering and extension of slope processes in the municipality’s piedmont area. To prevent some major imbalances it is imperative to implement some adequate measures based on in-depth studies.
A construção da cidade de Maringá – 1947 a 1982
Directory of Open Access Journals (Sweden)
Fabiola Castelo de Souza Cordovil
2011-06-01
Full Text Available
Apresentamos algumas linhas de análise da tese de doutorado intitulada “A Aventura Planejada: engenharia e urbanismo na construção de Maringá – 1947 a 1982” que se dividiu em duas partes. A primeira denomina-se “A criação de Maringá: projeto e história” e constitui-se por dois capítulos. A segunda parte intitula-se “Construir e administrar: técnica e política na construção da cidade” e compõe-se de sete capítulos, sendo um para cada gestão estudada, de 1953 a 1982. Na primeira parte estudamos o contexto regional no qual se formou Maringá e analisamos o seu plano inicial. A segunda parte refere-se especificamente às realizações das administrações municipais. Divide-se em sete capítulos, abarcando as primeiras sete gestões. Em três décadas e meia reconstituímos o processo de construção da cidade e a constituição da cultura técnico-profissional municipal.
Abstract
This text presents an analysis of the Ph. D. dissertation entitled “A Aventura Planejada: engenharia e urbanismo na construção de Maringá – 1947 a 1982” — “The Planned Adventure: Engineering and Urban Planning in the Building of Maringá.” The dissertation is divided into two parts. The first is called "A criação de Maringá: projeto e história"—“The Creation of Maringá,” and it consists of two chapters. The second part is entitled "Construir e administrar: técnica e política na construção da cidade” — “To Build and to Administer: Technique and Politics in the Building of the City,” and consists of seven chapters, one for each administration studied, from 1953 to 1982. In the first part we study the regional context in which
Kerber, L.; Nesnas, I.; Keszthelyi, L.; Head, J. W.; Denevi, B.; Hayne, P. O.; Mitchell, K.; Ashley, J. W.; Whitten, J. L.; Stickle, A. M.; Parness, A.; McGarey, P.; Paton, M.; Donaldson-Hanna, K.; Anderson, R. C.; Needham, D.; Isaacson, P.; Jozwiak, L.; Bleacher, J.; Parcheta, C.
2018-04-01
Moon Diver is a Discovery-class mission concept designed to explore a lunar mare pit. It would be the first mission to examine an in-place bedrock stratigraphy on the Moon, and the first to venture into the subsurface of another planetary body.
Directory of Open Access Journals (Sweden)
Luiza Helena Costa Dutra Sousa
2009-12-01
Full Text Available Neste trabalho realizou-se o mapeamento acústico para salas de aulas, laboratórios e biblioteca pertencentes à Universidade Estadual de Maringá, bem como para a região central da cidade de Maringá, Estado do Paraná. Na primeira etapa do trabalho, realizou-se estudo e revisão bibliográfica sobre os parâmetros de interesse quando se deseja qualificar uma sala ou ambiente quanto ao seu nível de ruído, bem como o levantamento dos principais pontos a serem estudados. A segunda etapa compreendeu as medições in locu desses parâmetros, executadas conforme normas ABNT, ISO e recomendações da literatura. Por último, analisaram-se, estatisticamente, os dados para que pudessem ser comparados com os valores estipulados por leis vigentes. Após análise dos dados obtidos, pode-se perceber que a maioria dos pontos apresentou-se acima dos valores permitidos por lei, principalmente em relação à cidade de Maringá, e alguns trechos apresentaram-se com níveis de ruído bastante elevados. Com relação à Universidade Estadual de Maringá, grande parte dos pontos apresentou-se acima do permitido, mas em alguns casos apresentaram excelente qualidade.
Hiesinger, H.; Jaumann, R.; Neukum, G.
1993-01-01
Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.
Ferreira-Dias, G; Botelho, M; Zagrajczuk, A; Rebordão, M R; Galvão, A M; Bravo, P Pinto; Piotrowska-Tomala, K; Szóstek, A Z; Wiczkowski, W; Piskula, M; Fradinho, M J; Skarzynski, D J
2013-10-01
Phytoestrogens exist in plants that are present in forages fed to horses. They may compete with 17-β estradiol and influence the estrous cycle. Therefore, the objective was to determine whether coumestrol from clover-mixed pastures is present in mare's plasma after their ingestion (experiment I), and when this phytoestrogen was present in mare's plasma after ingestion (experiment II). The effect of a long-term ingestion of phytoestrogens on estrous cycle disruption was assessed (experiment III; clinical case). Experiment I was carried out in nonpregnant anestrous and cyclic Lusitano mares (n = 14) kept on clover and grass-mixed pastures, and supplemented with concentrate and hay or cereal straw. Blood and feedstuff were obtained from November to March. In experiment II, stabled cyclic Lusitano mares (n = 6) were fed for 14 days with increasing amounts of alfalfa pellets (250 g to 1 kg/day). Sequential blood samples were obtained for 8 hours after feed intake on Day 0 (control) and on Days 13 and 14 (1 kg/day alfalfa pellets). Experiment III mares were fed with a mixture of alfalfa and clover haylage for 5 months (group 1; n = 4) or for 9 months (group 2; n = 12). Estrous cycle was determined on the basis of plasma estradiol (E2), progesterone (P4), and ultrasound (experiment III). Concentrations of phytoestrogen coumestrol and its metabolite methoxycoumestrol were determined by high-performance liquid chromatography coupled with mass spectrometry. Phytoestrogens decreased in pasture from November until March (P haylage) than in group 1, after haylage withdrawal (P < 0.001). These data show that in the mare, coumestrol and its metabolite increase in blood after ingestion of estrogenic plants and can influence reproduction in mares as potent endocrine disruptors. Copyright © 2013 Elsevier Inc. All rights reserved.
Campbell, Bruce A.; Hawke, B. Ray; Morgan, Gareth A.; Carter, Lynn M.; Campbell, Donald B.; Nolan, Michael
2014-01-01
Radar images at 70 cm wavelength show 4-5 dB variations in backscatter strength within regions of relatively uniform spectral reflectance properties in central and northern Mare Serenitatis, delineating features suggesting lava flow margins, channels, and superposition relationships. These backscatter differences are much less pronounced at 12.6 cm wavelength, consistent with a large component of the 70 cm echo arising from the rough or blocky transition zone between the mare regolith and the intact bedrock. Such deep probing is possible because the ilmenite content, which modulates microwave losses, of central Mare Serenitatis is generally low (2-3% by weight). Modeling of the radar returns from a buried interface shows that an average regolith thickness of 10m could lead to the observed shifts in 70 cm echo power with a change in TiO2 content from 2% to 3%. This thickness is consistent with estimates of regolith depth (10-15m) based on the smallest diameter for which fresh craters have obvious blocky ejecta. The 70 cm backscatter differences provide a view of mare flow-unit boundaries, channels, and lobes unseen by other remote sensing methods. A localized pyroclastic deposit associated with Rima Calippus is identified based on its low radar echo strength. Radar mapping also improves delineation of units for crater age dating and highlights a 250 km long, east-west trending feature in northern Mare Serenitatis that we suggest is a large graben flooded by late-stage mare flows.
Geologic structure of the eastern mare basins. [lunar basalts
Dehon, R. A.; Waskom, J. D.
1976-01-01
The thickness of mare basalts in the eastern maria are estimated and isopachs of the basalts are constructed. Sub-basalt basin floor topography is determined, and correlations of topographic variations of the surface with variations in basalt thickness or basin floor topography are investigated.
2010-07-01
... range, Naval Inshore Operations Training Center, Mare Island, Vallejo. 334.1170 Section 334.1170... Operations Training Center, Mare Island, Vallejo. (a) The Danger Zone. A sector in San Pablo Bay delineated..., Vallejo, California, will conduct gunnery practice in the area during the period April 1 through September...
Satué, K; Felipe, M; Mota, J; Muñoz, A
2011-01-01
The length of gestation in Carthusian broodmares was calculated on the basis of 339 spontaneous full-term deliveries taking place in the 8-year period 1998-2005 from 158 broodmares and 29 stallions in a major farm of Spanish horses of Carthusian strain in southern Spain. Ultrasonography was used to determine follicular dehiscence, 1st day of pregnancy and to confirm conception in mares. Mean GL was 332.4 +/- 12.1 days, and a normal interval of 297-358 days was established for this breed. GL records were grouped on the basis of foal sex (colts or fillies), mating month (between November and January; February and April; May and July), age of the mare (4 to 7 years; 8 to 12 years; 13 to 17 years), breeding year, stallion and parity (primiparous vs. multiparous). GLs were 12.9 days shorter in mares mated between May and July than those mated between November and January and 15.3 days in mares mated between February and April (p < 0.001). Mares aged between 8-12 years had 5.3 days shorter GLs than those aged between 13-17 years (p < 0.05). Pregnancy was significantly 5.7 days longer when the mare gave birth to colts than fillies (p < 0.05). GL was 14.5 days longer in primiparous than in multiparous mares ( p < 0.001). No statistical differences in GL were found between the studied years. This study shows the influence of certain stallion on GL.
Considerations on the extreme flood produced in Ral Mare Basin (Retezat Mountains, Romania)
International Nuclear Information System (INIS)
Barbuc, Mihai
2004-01-01
The aim of this paper is to illustrate the major impact of an extreme flood on the landscape, on the upper basin of Raul Mare, from Retezat Mountains, Romania, and what means 'hazardous phenomenon'. Romania is one of the European countries most severely affected by natural hazards, which have a big social and economic impact. Between them, floods are the very frequent and have one of the most important effects on settlements, agriculture and communications. Raul mare has three main sources: Lapusnicul Mare, Lapusnicul Mic and Raul Ses. Its springs from glacier lakes, at high altitude, over 2000 m, and have torrential and narrow valleys. In present, their conflence, at Gura Apelor, is covered by an anthropic lake, formed behind of a great dam, 173 m high. This dam had a major role to attenuate and to fail to control the extreme flood from July 1990 and, at the same time, to reduce significantly, the damages in Hateg depression, a low area with many settlements and economic objectives. Behind of the Gura Apelor kake, the Lapusnicul Mare and Mic valleys, the flush flood covered the whole channel, the effects on the landscape-devastating, and the flood probability, between 0,1 -0,1 %. The maps, graphics and pictures presented in this paper will emphasize the situation before and after the event. Furthermore, some standard forms used to be filled in by authorities for immediate and unitary recording of extreme phenomena are presented.(Author)
Immunoassay of sexual steroids for fertility control in cows, sows and mares. Part 1
International Nuclear Information System (INIS)
Han Sun Choi
1987-01-01
The immunological determination of oestrogens in faeces as a method of pregnancy diagnosis in cows, sows and mares, and the stability of oestrogens in faeces was tested. During 8 days storage at -20 0 to +37 0 C the concentration of oestrogen in faeces was not significantly influenced. During 2 oestrous cycles blood was taken daily of 8 cows and the concentration of progesterone (P4), dehydroepiandrosterone (DHA), androstenedione (AD), epitestosterone (Epi) and testosterone (T) in plasma was determined by radioimmunoassay (RIA). The average concentration of DHA in the blood of cows was 650±71 pg/ml, that of AD 77±8 pg/ml to 122±29 pg/ml (x-bar ± SD). The concentration of Epi and T was from 160 to 243 pg/ml and from 46 to 96 pg/ml plasma. For the pregnancy diagnosis in sows blood and faeces were collected of 6 non-pregnant and 30 pregnant animals day 16 to 30 after mating. In faeces the concentration of oestrogens was determined by means of RIA, in blood that of oestrone sulphate and P4 by EIA on micro titre plates. During the whole period of examination the concentration of P4 remained fairly constant. From day 17 to 23 after mating the concentration in non-pregnant was significantly lower than in pregnant sows. In the blood of non-pregnant sows the oestrone sulphate concentration was 1,3±1,2 ng/ml (x-bar ± SD). Day 24 to 30: >x-bar ± 2SD in pregnant animals. Day 25 and 29 of pregnancy the concentration of oestrogens in faeces was: >x-bar ± 2SD = 20,6 ng/g faeces. Pregnancy diagnosis: 21 non-pregnant cows and heifers, 6 bulls and 83 pregnant cows were examined (10th to 35th week of pregnancy). Faeces samples from 21 non-pregnant mares, 6 stallions and 57 pregnant mares (10th to 35th week) and 18 samples from 3 mares at parturition. 18th week of pregnancy the concentration of oestrogens in faeces of cows and mares was: (>x-bar ± 3SD) in non-pregnant animals; (cows: 21,6 ng/g, mares: 14,3 ng/g ) after parturition. 17 refs. (Author)
Immunoassay of sexual steroids for fertility control in cows, sows and mares. Part 2
International Nuclear Information System (INIS)
Han Sun Choi
1987-01-01
The immunological determination of oestrogens in faeces as a method of pregnancy diagnosis in cows, sows and mares, and the stability of oestrogens in faeces was tested. During 8 days storage at -20 0 to +37 0 C the concentration of oestrogen in faeces was not significantly influenced. During 2 oestrous cycles blood was taken daily of 8 cows and the concentration of progesterone (P4), dehydroepiandrosterone (DHA), androstenedione (AD), epitestosterone (Epi) and testosterone (T) in plasma was determined by radioimmunoassay (RIA). The average concentration of DHA in the blood of cows was 650±71 pg/ml, that of AD 77±8 pg/ml to 122±29 pg/ml (x-bar ± SD). The concentration of Epi and T was from 160 to 243 pg/ml and from 46 to 96 pg/ml plasma. For the pregnancy diagnosis in sows blood and faeces were collected of 6 non-pregnant and 30 pregnant animals day 16 to 30 after mating. In faeces the concentration of oestrogens was determined by means of RIA, in blood that of oestrone sulphate and P4 by EIA on micro titre plates. During the whole period of examination the concentration of P4 remained fairly constant. From day 17 to 23 after mating the concentration in non-pregnant was significantly lower than in pregnant sows. In the blood of non-pregnant sows the oestrone sulphate concentration was 1,3±1,2 ng/ml (x-bar ± SD). Day 24 to 30: >x-bar ± 2SD in pregnant animals. Day 25 and 29 of pregnancy the concentration of oestrogens in faeces was: >x-bar ± 2SD = 20,6 ng/g faeces. Pregnancy diagnosis: 21 non-pregnant cows and heifers, 6 bulls and 83 pregnant cows were examined (10th to 35th week of pregnancy). Faeces samples from 21 non-pregnant mares, 6 stallions and 57 pregnant mares (10th to 35th week) and 18 samples from 3 mares at parturition. 18th week of pregnancy the concentration of oestrogens in faeces of cows and mares was: (>x-bar ± 3SD) in non-pregnant animals; (cows: 21,6 ng/g, mares: 14,3 ng/g ) after parturition. 17 refs. (Author)
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1998-07-01
Full Text Available Sixty-four Thoroughbred and Anglo-Arab mares aged 6-12 years were randomly allocated to 4 dietary groups and fed diets that differed in the total protein content and quality (essential amino-acids. Forty mares were non-lactating and 24 lactating. Eight mares were withdrawn from the investigation owing to injuries or gynaecological pathology. An overall conception rate of 94.6%and a foaling rate of 80%was achieved. Five of 14 (35.7 % mares (Group 1 fed a low-quality protein diet suffered from early embryonic loss before 90 days of pregnancy compared to 3 of 41 (7.3 % mares in the remaining groups that received the higher-quality protein in their diets. Serum progestagen concentrations of mares in Group 1 that suffered foetal loss were indicative of luteal function insufficiency during the 1st 40 days post-ovulation. Non-lactating mares in all 4 groups gained on average approximately 30 kg in mass during the 90 days before the breeding period. Lactating mares in Group 1 (low-quality protein lost on average 25 kg in mass during lactation, with no weight loss observed among the lactating mares in the other 3 groups. No difference in the diameter of the embryonic vesicle was found between dietary groups until Day 35 of pregnancy.
Araujo, Reno R; Ginther, O J
2009-01-01
To assess the vascular effects of detomidine and xylazine in pony mares and heifers, respectively, as determined in a major artery and by extent of vascular perfusion of reproductive organs. 10 pony mares and 10 Holstein heifers. Pony mares were assigned to receive physiologic saline (0.9% NaCl) solution (n = 5) or detomidine (3.0 mg/mare, IV; 5). Heifers were assigned to receive saline solution (5) or xylazine (14 mg/heifer, IM; 5). Color Doppler ultrasonographic examinations were performed immediately before and 10 minutes after administration of saline solution or sedative. In spectral Doppler mode, a spectral graph of blood flow velocities during a cardiac cycle was obtained at the internal iliac artery and at the ovarian pedicle. In color-flow mode, color signals of blood flow in vessels of the corpus luteum and endometrium were assessed. Systemic effects of sedation in the 2 species were evident as a decrease in heart rate; increase in duration of systole, diastole, or both; decrease in volume of blood flow; and decrease in velocity of blood flow within the internal iliac artery. However, an effect of sedatives on local vascular perfusion in the ovaries and endometrium was not detected. Sedation with detomidine in pony mares and xylazine in heifers did not affect vascular perfusion in reproductive organs. These sedatives can be used in experimental and clinical color Doppler evaluations of vascular perfusion of the corpus luteum and endometrium.
Whole-genome sequencing and genetic variant analysis of a Quarter Horse mare.
Doan, Ryan; Cohen, Noah D; Sawyer, Jason; Ghaffari, Noushin; Johnson, Charlie D; Dindot, Scott V
2012-01-01
BACKGROUND: The catalog of genetic variants in the horse genome originates from a few select animals, the majority originating from the Thoroughbred mare used for the equine genome sequencing project. The purpose of this study was to identify genetic variants, including single nucleotide polymorphisms (SNPs), insertion/deletion polymorphisms (INDELs), and copy number variants (CNVs) in the genome of an individual Quarter Horse mare sequenced by next-generation sequencing. RESULTS: Using massively parallel paired-end sequencing, we generated 59.6 Gb of DNA sequence from a Quarter Horse mare resulting in an average of 24.7X sequence coverage. Reads were mapped to approximately 97% of the reference Thoroughbred genome. Unmapped reads were de novo assembled resulting in 19.1 Mb of new genomic sequence in the horse. Using a stringent filtering method, we identified 3.1 million SNPs, 193 thousand INDELs, and 282 CNVs. Genetic variants were annotated to determine their impact on gene structure and function. Additionally, we genotyped this Quarter Horse for mutations of known diseases and for variants associated with particular traits. Functional clustering analysis of genetic variants revealed that most of the genetic variation in the horse's genome was enriched in sensory perception, signal transduction, and immunity and defense pathways. CONCLUSIONS: This is the first sequencing of a horse genome by next-generation sequencing and the first genomic sequence of an individual Quarter Horse mare. We have increased the catalog of genetic variants for use in equine genomics by the addition of novel SNPs, INDELs, and CNVs. The genetic variants described here will be a useful resource for future studies of genetic variation regulating performance traits and diseases in equids.
Whole-genome sequencing and genetic variant analysis of a Quarter Horse mare.
Doan, Ryan
2012-02-17
BACKGROUND: The catalog of genetic variants in the horse genome originates from a few select animals, the majority originating from the Thoroughbred mare used for the equine genome sequencing project. The purpose of this study was to identify genetic variants, including single nucleotide polymorphisms (SNPs), insertion/deletion polymorphisms (INDELs), and copy number variants (CNVs) in the genome of an individual Quarter Horse mare sequenced by next-generation sequencing. RESULTS: Using massively parallel paired-end sequencing, we generated 59.6 Gb of DNA sequence from a Quarter Horse mare resulting in an average of 24.7X sequence coverage. Reads were mapped to approximately 97% of the reference Thoroughbred genome. Unmapped reads were de novo assembled resulting in 19.1 Mb of new genomic sequence in the horse. Using a stringent filtering method, we identified 3.1 million SNPs, 193 thousand INDELs, and 282 CNVs. Genetic variants were annotated to determine their impact on gene structure and function. Additionally, we genotyped this Quarter Horse for mutations of known diseases and for variants associated with particular traits. Functional clustering analysis of genetic variants revealed that most of the genetic variation in the horse\\'s genome was enriched in sensory perception, signal transduction, and immunity and defense pathways. CONCLUSIONS: This is the first sequencing of a horse genome by next-generation sequencing and the first genomic sequence of an individual Quarter Horse mare. We have increased the catalog of genetic variants for use in equine genomics by the addition of novel SNPs, INDELs, and CNVs. The genetic variants described here will be a useful resource for future studies of genetic variation regulating performance traits and diseases in equids.
Parental magmas of Mare Fecunditatis - Evidence from pristine glasses
International Nuclear Information System (INIS)
Jin, Y.; Taylor, L.A.
1990-01-01
Results are presented on the petrography and electron microprobe analyses of 14 discrete glass beads from the Luna 16 core sample (21036,15) from Mare Fecunditatis regolith, that were previously characterized as representing pristine glasses. Compared to Apollo pristine glasses analyzed by Delano (1986), the Luna 16 pristine glasses have higher CaO and Al2O3 contents but lower MgO and Ni. On the basis of their contents of MgO, FeO, Al2O3, and CaO, these pristine glasses could be divided into two groups, A and B. It is suggested that at least two parental magmas are needed to explain the chemical variations among these glasses. The Group B glasses appear to represent primitive parental magma that evolved by olivine fractionation to the compositions of the Luna 16 aluminous mare basalts, whereas the Group A volcanic glasses may represent an unusual new basalt magma type that contains a high plagioclase component. 14 refs
Directory of Open Access Journals (Sweden)
Leonardo Romero
2013-06-01
Full Text Available El 25 de junio de 2004 falleció el Dr. Hielke Haak, un destacado colega que fue muy considerado no sólo por su trayectoria académica sino además por su calidad personal. Hielke Miguel Haak Mares nació el 21 de mayo de 1948 y luego de seguir sus estudios en nuestra Alma Mater, en 1974 obtuvo el Grado Acadé- mico de Bachiller en Biología, luego en 1975 obtuvo el Título Profesional de Biólogo y en 1976 el Grado Académico de Magíster en Bioquímica, siendo becario de la Fundación Kellogg. Posteriormente en 1989 se graduó de Doctor en Ciencias Biológicas.
Directory of Open Access Journals (Sweden)
Lauš S.
2012-01-01
Full Text Available The comparison of some serum protein concentrations was performed on 12 Yugoslav Trotter mares and their newborn foals. The mares included in the evaluation were divided into two groups of 6 each. The mares in the first group were vaccinated against equine herpes virus 1 and 4, in the 5th, 7th and 9th month of pregnancy, while mares in the second group were not vaccinated at all. Pregnant mares were clinically observed during the last stage of pregnancy and blood for biochemical evaluations was sampled immediately after foaling. Foals were clinically observed for seven days after birth and blood samples were collected immediately after foaling (before nursing, and 24, 48, 72 and 168 hours after birth. Foals included in the evaluation were divided into two groups according to the group allocation of the respective mares. All mares gave birth to normal foals in expected terms. Biochemical examination revealed slightly lower total gammaglobulin and IgG values in tested mares compared to the values obtained in other horse breeds. The antibody titres against equine herpes virus-1 reached the level that provides sufficient protection in vaccinated mares. Gammaglobulin and traces of IgG were present in the blood serum of foals tested immediately after birth and before nursing. A significant increase of IgG and gammaglobulin concentration was revealed in all foals after the first 24 hours of life. The observed first day increase of concentration was followed by stagnation of gammaglobulin and IgG levels in all foals. Total protein values showed a significant increase 24 hours after the first intake of colostrum in all foals. Immunoglobulin G concentration established by semiquantitative test was considered low positive in 16.67% and in 33.34% of foals from vaccinated and unvaccinated mares, respectively. Turbidimetric analyses of the same samples revealed sufficient Ig transfer, i.e. Ig concentration over 8 g/L. Comparison of the results obtained by the
Rioja, Eva; Cernicchiaro, Natalia; Costa, Maria Carolina; Valverde, Alexander
2012-01-01
This study investigated associations between perioperative factors and probability of death and length of hospitalization of mares with dystocia that survived following general anesthesia. Demographics and perioperative characteristics from 65 mares were reviewed retrospectively and used in a risk factor analysis. Mortality rate was 21.5% during the first 24 h post-anesthesia. The mean ± standard deviation number of days of hospitalization of surviving mares was 6.3 ± 5.4 d. Several factors were found in the univariable analysis to be significantly associated (P dystocia, intraoperative hypotension, and drugs used during recovery. Type of delivery and day of the week the surgery was performed were significantly associated with length of hospitalization in the multivariable mixed effects model. The study identified some risk factors that may allow clinicians to better estimate the probability of mortality and morbidity in these mares. PMID:23115362
Melendrez, David E.; Johnson, Jeffrey R.; Larson, Stephen M.; Singer, Robert B.
1994-01-01
High spatial resolution maps illustrating variations in spectral reflectance 400/560 nm ratio values have been generated for the following mare regions: (1) the border between southern Mare Serenitatis and northern Mare Tranquillitatis (including the MS-2 standard area and Apollo 17 landing site), (2) central Mare Tranquillitatis, (3) Oceanus Procellarum near Seleucus, and (4) southern Oceanus Procellarum and Flamsteed. We have also obtained 320-1000 nm reflectance spectra of several sites relative to MS-2 to facilitate scaling of the images and provide additional information on surface composition. Inferred TiO2 abundances for these mare regions have been determined using an empirical calibration which relates the weight percent TiO2 in mature mare regolith to the observed 400/560 nm ratio. Mare areas with high TiO2 abundances are probably rich in ilmenite (FeTiO3) a potential lunar resource. The highest potential TiO2 concentrations we have identified in the nearside maria occur in central Mare Tranquillitatis. Inferred TiO2 contents for these areas are greater than 9 wt% and are spatially consistent with the highest-TiO2 regions mapped previously at lower spatial resolution. We note that the morphology of surface units with high 400/560 nm ratio values increases in complexity at higher spatial resolutions. Comparisons have been made with previously published geologic maps, Lunar Orbiter IV, and ground-based images, and some possible morphologic correlatins have been found between our mapped 400/560 nm ratio values and volcanic landforms such as lava flows, mare domes, and collapse pits.
Positiivsust saab õppida / Mare Pork ; intervjueerinud Signe Rummo ; kommenteerinud Toivo Aavik
Pork, Mare, 1950-
2014-01-01
Intervjuu Tallinna Ülikooli psühholoogiaprofessor Mare Porkiga positiivsest psühholoogiast ja raamatust Boniwell, Ilona. Positiivne psühholoogia : tõhusa toimimise põhitõed. Tallinn : Äripäev, 2014.
Influence of atipamezole on effects of midsacral subarachnoidally administered detomidine in mares.
Skarda, R T; Muir, W W
1998-04-01
To examine effects of atipamezole on detomidine midsacral subarachnoidally-induced analgesia, cardiovascular and respiratory activity, head ptosis, and position of pelvic limbs in healthy mares. 10 healthy mares. Using a randomized, blinded, crossover study design, mares received detomidine (0.03 mg/kg of body weight, diluted in 3 ml of CSF) midsacral subarachnoidally, followed by atipamezole (0.1 mg/kg [test]) or sterile saline (0.9% NaCl) solution (control), i.v. 61 minutes later and saline solution (3 ml, midsacral subarachnoidally) on a separate occasion, at least 2 weeks later. Analgesia was determined by lack of sensory perception to electrical stimulation at the perineal dermatome and no response to needle-prick stimulation extending from the coccygeal to T15 dermatomes. Arterial acid-base (pH, standard bicarbonate, and base excess values), gas tensions (PO2, PCO2), PCV, total solids concentration, heart and respiratory rates, rectal temperature, and arterial blood pressure were determined, and mares were observed for sweating and urination. Mean scores of perineal analgesia, head ptosis, position of pelvic limbs, and cardiovascular and respiratory data were compared for the 3-hour test period. Subarachnoidally administered detomidine induced perineal analgesia (mean +/- SD onset, 9.0 +/- 4.6 minutes; duration, 130 +/- 26 minutes), marked head ptosis, moderate changes in pelvic limb position, cardiovascular and respiratory depression, sweating in analgesic zones, and diuresis. Intravenously administered atipamezole significantly reduced mean scores of detomidine-induced perineal analgesia, head ptosis, pelvic limb position, sweating and diuresis; partially antagonized detomidine-induced bradycardia; and did not effect detomidine-induced bradypnea. Most effects of midsacral subarachnoidally administered detomidine, except bradycardia and bradypnea, were reversed by atipamezole (0.1 mg/kg, i.v.), indicating that most of the actions of detomidine were mediated
Lava flows in mare imbrium: An evaluation of anomalously low earth-based radar reflectivity
Schaber, G.G.; Thompson, T.W.; Zisk, S.H.
1975-01-01
The lunar maria reflect two to five times less Earth-based radar power than the highlands, the spectrally blue maria surfaces returning the lowest power levels. This effect of weakening signal return has been attributed to increased signal absorption related to the electrical and magnetic characteristics of the mineral ilmenite (FeTiO3). The surface of Mare Imbrium contains some of the most distinct red-blue colorimetric boundaries and depolarized 70 cm wavelength reflectivity variations on the near side of the Moon. The weakest levels of both 3.8 cm and 70 cm reflectivity within Imbrium are confined to regional mare surfaces of the blue spectral type that can be recognized as stratigraphically unique flow surfaces. Frequency distributions of the 70 cm polarized and depolarized radar return power for five mare surfaces within the basin indicate that signal absorption, and probably the ilmenite content, increases generally from the beginning of the Imbrian Period to the end of the Eratosthenian Period with slight reversal between the end of the Imbrian and beginning of the Eratosthenian. TiO2 calibrated radar reflectivity curves can be utilized for lunar maria geochemical mapping in the same manner as the TiO2 calibrated spectral reflectivity curves of Charette et al. (1974). The long wavelength radar data may be a sensitive indicator of mare chemical variations as it is unaffected by the normal surface rock clutter that includes ray materials from large impact craters. ?? 1975 D. Reidel Publishing Company.
A COMPARATIVE ANALYSIS OF MANAGERIAL COMPETENCIES BASED ON EVIDENCE FROM SATU MARE COUNTY, ROMANIA
Directory of Open Access Journals (Sweden)
Olimpia Neagu
2014-12-01
Full Text Available The paper explores the managerial competencies of human resources in the companies from Satu Mare County, by comparing the employers' and employees' views. The comparison is based on data collected and processed within the project HURO/0901/264/2.2.2 implemented in partnership by "Vasile Goldiș" Western University and University of Debrecen and financed by European Union through ERDF under Hungary-Romania 2007-2013 Programme, in 2012, and on data collected and processed in 2013-2014, in a new field research applied to employees from Satu Mare county.
Mare Risk Analysis monitor; Monitor de analisis de riesgos mare
Energy Technology Data Exchange (ETDEWEB)
Fuente Prieto, I.; Alonso, P.; Carretero Fernandino, J. A. [Empresarios Agrupados, A. I.E. Madrid (Spain)
2000-07-01
The Nuclear Safety Council's requirement that Spanish power plants comply with the requirements of the Maintenance Rule associated with plant risk assessment during power operation, arising from the partial unavailability of systems due to the maintenance activities, has led to need for additional tools to facilitate compliance with said requirements. While the impact on risk produced by individual equipment unavailabilities can easily be evaluated, either qualitatively or quantitatively, the process becomes more complicated when un programmed unavailabilities simultaneously occur in various systems, making it necessary to evaluate their functional impact. It is especially complex in the case of support systems that can affect the functionality of multiple systems. In view of the above, a computer application has been developed that is capable of providing the operator with quick answers based on the specific plant model in order to allow fast risk assessment using the information compiled as part of the Probabilistic Safety Analysis. The paper describes the most important characteristics of this application and the basic design requirements of the MARE Risk Monitor. (Author)
Directory of Open Access Journals (Sweden)
M. ALEXE
2011-03-01
Full Text Available The importance of technical infrastructure in territory. Case study: drinking water supply in Dângău Mare, Cluj County. Water represents an important element in life. Accessibility, water quantity and quality show the standard of living of one community. This article presents a case study, the one of water supply in Dângău Mare from Cluj County. The purpose of this analysis is to reveal the benefits of applying some measures regarding water supply in the rural area, as well as the dysfunction abilities which derive from a bad management (eg. lack of sewage system. Dângău Mare lies near the Gilău Mountains and possesses important and rich resources of surface and underground waters varying under qualitative ratio. The hydrological resources of Dângău Mare are made up of river/rivulet networks (Mireş, Blidaru, Agârbiciu, phreatic waters and natural springs. The identification and delimitation of the Dângău Mare territory represents the first stage of this study, followed by the consultation of bibliographic and cartographic sources, field surveys, to obtain the qualitative and quantitative pieces of information. The second stage consists in the analyzation and classification of information, the integrated study of phenomena and elaboration of cartographic models using GIS. At the end of this study we have made the SWOT analysis to emphasize the characteristics of favourability, the anomalies and the opportunities to improve and develop the territory of Dângău Mare from Cluj County.
Rb-Sr and Sm-Nd chronology and genealogy of mare basalts from the Sea of Tranquility
Papanastassiou, D. A.; Depaolo, D. J.; Wasserburg, G. J.
1977-01-01
Rb-Sr and Sm-Nd ages of two Apollo 11 mare basalts, high-K basalt 10072 and low-K basalt 10062, are reported. Rb-Sr, Sm-Nd, and Ar-40-Ar-39 ages are in good agreement and indicate an extensive time interval for filling of the Sea of Tranquility, presumably by thin lava flows, in agreement with similar observations for the Ocean of Storms. Initial Sr and Nd isotopic compositions on Apollo 11 basalts reveal at least two parent sources producing basalts. The Sm-Nd isotopic data demonstrate that low-K and high-Ti basalts from Apollo 11 and 17 derived from distinct reservoirs, while low-Ti Apollo 15 mare basalt sources have Sm/Nd similar to the sources of Apollo 11 basalts. Groupings of mare basalt based on Ti content and on isotopic data do not coincide.
Diel de Amorim, Mariana; Nielsen, Kayla; Cruz, Raissa Karolliny Salgueiro; Card, Claire
2016-07-15
Intrauterine plant oil infusion, including fractionated coconut oil, has been previously found to be a safe, inexpensive, and reversible method of prolonging the luteal phase in mares when administered on Day 10 of the estrous cycle. Our objective was to understand the uteroovarian response to the administration of fractionated coconut oil infusion in the uterus of diestrous mares. We hypothesized that intrauterine coconut oil administration on Day 10 would prolong luteal life span in a dose-dependent fashion and would result in higher serum progesterone levels than untreated mares at the expected time of luteolysis. Light-horse mares (n = 18) were examined using transrectal palpation and ultrasonography to determine if they had a normal interovulatory interval and were then examined daily in estrus until the day of ovulation (Day 0) and then every other day during an estrous cycle. Jugular blood was drawn on Day 11, Day 13, Day 15, and Day 17, centrifuged, and serum stored until assayed for progesterone (P4; Siemens Coat-a-Count Progesterone RIA, Los Angeles, CA, USA). Mares were randomly assigned to treatment and studied over one to two estrous cycles with a rest cycle after each treatment cycle. Groups were: control (n = 5), fractionated coconut oil 1.0 mL (Miglyol 810; Sasol Oil, Witten, Germany) infused in the uterus with an artificial insemination pipette on Day 10 (Group 1; n = 5) and fractionated coconut oil 0.5 mL infused in the uterus with an embryo transfer gun, on Day 10 (Group 2; n = 5). All statistical analyses were performed using analytical software (Stata SE, version 13.1, College Station, TX, USA) at P < 0.05. Data were first evaluated using the Shapiro-Wilk test for normality. Differences between groups in days to luteolysis (DTL) were examined using analysis of variance and Bonferroni, and the effect of day and treatment on P4 levels were examined using the Kruskal-Wallis and Dunn's all pairwise test. There was a significant
Hackney, K. J.; English, K. L.; Redd, E.; DeWitt, J. K.; Ploutz-Snyder, R.; Ploutz-Snyder, L. L.
2010-01-01
PURPOSE: 1) To compare the test-to-test reliability of Muscle Atrophy Research and Exercise System (MARES) with a standard laboratory isokinetic dynamometer (ISOK DYN) and; 2) to determine if measures of peak torque and total work differ between devices. METHODS: Ten subjects (6M, 4F) completed two trials on both MARES and an ISOK DYN in a counterbalanced order. Peak torque values at 60 deg & 180 deg / s were obtained from five maximal repetitions of knee extension (KE) and knee flexion (KF). Total work at 180 deg / s was determined from the area under the torque vs. displacement curve during twenty maximal repetitions of KE and KF. Reliability of measures within devices was interpreted from the intraclass correlation coefficient (ICC) and compared between devices using the ratio of the within-device standard deviations. Indicators of agreement for the two devices were evaluated from: 1) a calculation of concordance (rho) and; 2) the correlation between the mean of measures versus the delta difference between measures (m u vs delta). RESULTS: For all outcome measures ICCs were high for both the ISOK DYN (0.95-0.99) and MARES (0.90-0.99). However, ratios of the within-device standard deviation were 1.3 to 4.3 times higher on MARES. On average, a wide range (3.3 to 1054 Nm) of differences existed between the values obtained. Only KE peak torque measured at 60 deg & 180 deg / s showed similarities between devices (rho = 0.91 & 0.87; Pearson's r for m u vs delta = -0.22 & -0.37, respectively). CONCLUSION: Although MARES was designed for use in microgravity it was quite reliable during ground-based testing. However, MARES was consistently more variable than an ISOK DYN. Future longitudinal studies evaluating a change in isokinetic peak torque or total work should be limited within one device.
33 CFR 117.169 - Mare Island Strait and the Napa River.
2010-07-01
... Strait and the Napa River. (a) The draw of the Mare Island Drawbridge, mile 2.8, at Vallejo shall open on... may contact the City of Vallejo via the same telephone number to schedule drawspan operation. (b) The...
Identification of dipeptidyl peptidase-IV inhibitory peptides from mare whey protein hydrolysates.
Song, J J; Wang, Q; Du, M; Ji, X M; Mao, X Y
2017-09-01
Inhibition of dipeptidyl peptidase-IV (DPP-IV) activity is a promising strategy for treatment of type 2 diabetes. In the current study, DPP-IV inhibitory peptides were identified from mare whey protein hydrolysates obtained by papain. The results showed that all the mare whey protein hydrolysates obtained at various hydrolysis durations possessed more potent DPP-IV inhibitory activity compared with intact whey protein. The 4-h hydrolysates showed the greatest DPP-IV inhibitory activity with half-maximal inhibitory concentration of 0.18 mg/mL. The 2 novel peptides from 4-h hydrolysate fractions separated by successive chromatographic steps were characterized by liquid chromatography-electrospray ionization tandem mass spectrometry. The novel peptides Asn-Leu-Glu-Ile-Ile-Leu-Arg and Thr-Gln-Met-Val-Asp-Glu-Glu-Ile-Met-Glu-Lys-Phe-Arg, which corresponded to β-lactoglobulin 1 f(71-77) and β-lactoglobulin 1 f(143-155), demonstrated DPP-IV inhibitory activity with half-maximal inhibitory concentrations of 86.34 and 69.84 μM, respectively. The DPP-IV inhibitory activity of the 2 peptides was retained or even improved after simulated gastrointestinal digestion in vitro. Our findings indicate that mare whey protein-derived peptides may possess potential as functional food ingredients in the management of type 2 diabetes. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Paweska, J T
1997-06-01
Clinical, virological and serological responses were investigated in five pregnant donkey mares after experimental exposure to the South African asinine-94 strain of equine arteritis virus (EAV), and the duration of maternal immunity to EAV was studied in their foals. In four intranasally inoculated mares, fever with maximum rectal temperatures of 39.1-40.7 degrees C was recorded 2-11 d after challenge. All the inoculated mares developed mild depression, and a serous ocular and nasal discharge; in three mares mild conjuctivitis was observed. The virus was recovered from the nasopharynx and from buffy-coat samples of all the mares 3-10 d, and 2-18 d post inoculation (p.i.), respectively. Seroconversion to EAV was detected on days 8-10 p.i. Peak serum-virus-neutralizing antibody titres of log10 1.8-2.4, and IgG ELISA OD values of 0.85-2.15 were recorded 2-3 weeks p.i. The in-contact (p.c.) control mare developed fever on days 15-19 post exposure, and showed mild clinical signs of equine viral arteritis similar to those observed in the inoculated mares. Seroconversion to EAV was detected in the p.c. mare on day 20 post exposure, and virus was isolated from nasal swabs and blood samples collected at the time of the febrile response and 1-3 d afterwards. None of the mares aborted. After they had given normal birth 45-128 d p.i. or after p.c. exposure, no virus could be isolated from their placentas. The concentration of EAV-neutralizing antibody in colostrum was two to eight times higher than in serum samples collected at the time of parturition. All the foals born to infected mares were clinically normal at the time of birth and throughout the subsequent 1-2 months of observation. No EAV was recovered from the buffy-coat fraction of blood samples collected at birth nor from those collected on days 1, 2 and 7 after birth. Also, no virus-serum-neutralizing or IgG ELISA antibody to EAV was detected in sera collected immediately after birth before the foals started nursing
Directory of Open Access Journals (Sweden)
Tibary A
2015-12-01
Full Text Available Pregnancy loss is an important aspect of equine practice due to the economic and emotional loss that it engenders. Pregnancy loss is often divided in two categories: early pregnancy loss (EPL or embryonic death (ED (first 42 days and fetal losses (after 42 days. Diagnosis of the causes of pregnancy loss is often very challenging. Many of the causes of EPL remain poorly documented but studies on embryo development and embryo-uterine interaction have been able to shed some light on predisposing factors. Fetal losses or abortions are dominated by infectious causes and particularly bacterial placentitis. Detailed reviews of pregnancy loss were recently published by the authors (Tibary et al., 2012; Tibary and Pearson, 2012; Tibary et al., 2014. The objective of this paper is to provide an overview of the epidemiology, etiology, diagnosis and prevention of pregnancy loss in the mare.
Brogan, P T; Henning, H; Stout, T A E; de Ruijter-Villani, M
2016-03-01
Colour-flow Doppler sonography has been described as a means of assessing corpus luteum (CL) function rapidly, because area of luteal blood vessels correlates well with circulating progesterone (P4) concentrations [P4] in oestrous cycling mares. The aim of this study was to assess the relationships between CL size and vascularity, and circulating [P4] during early pregnancy in mares, and to determine whether luteal blood flow was a useful aid for selecting an embryo transfer recipient. Equine embryos (n=48) were recovered 8 days after ovulation and were transferred to available recipient mares as part of a commercial program with the degree of synchrony in timing of recipient ovulation ranging from 1 day before to 4 days after the donor. Immediately prior to embryo transfer (ET), maximum CL cross-section and blood vessel areas were assessed sonographically, and jugular blood was collected to measure plasma [P4]. Sonographic measurements and jugular blood collection were repeated at day 4 after ET for all mares, and again at days 11, 18 and 25 after ET in mares that were pregnant. The number of grey-scale and colour pixels within the CL was subsequently quantified using ImageJ software. The CL blood flow correlated significantly but weakly with plasma [P4] on the day of transfer and on day 4 after ET in all mares, and on days 11 and 25 after ET in pregnant mares (r=0.30-0.36). The CL area and plasma [P4] were also correlated on each day until day 11 after ET (r=0.49-0.60). The CL colour pixel area decreased significantly after day 18, whereas CL area was already decreasing by day 4 after ET. The CL area, area of blood flow, or [P4] was predictive of pregnancy. Findings in the present study suggest that both CL area and blood flow are correlated with circulating [P4] at the time of transfer and in early pregnancy. Evaluation of the CL using B-mode or CF sonography, although practical, provides no improvement in the selection of recipients or prediction of pregnancy
Marenzoni, Maria Luisa; Sforna, Monica; Stefanetti, Valentina; Casagrande Proietti, Patrizia; Brignone, Luca; Del Sero, Andrea; Falcioni, Fabio; Orvieto, Simona; Tamantini, Cristina; Tiburzi, Alessandra; Valentini, Silvia; Coletti, Mauro; Timoney, Peter J; Passamonti, Fabrizio
2014-12-05
In recent years, there has been increasing evidence of the potential pathogenic significance of equine gammaherpesviruses in the horse. In humans, cattle and mice, gammaherpesviruses have already been associated with uterine infection. The aim of the present study was to investigate the presence of gammaherpesviruses in uterine flushings of mares with reproductive problems and to evaluate if there was a possible statistical association with clinical and laboratory findings in these cases. A total of 80 uterine flushings were collected from 61 mares with different reproductive problems and these were tested for equine herpesviruses (EHV) 1-5 by PCR. In the case of each mare in the study, the age, history of infertility, presence of anatomical defects in the reproductive tract, presence of systemic or local disease at time of sampling, phase in the oestrous cycle, post-partum interval, nature of uterine lavage performed (low versus large volume lavage), cytological and bacteriological examination results from the uterine flushing, and PCR herpesvirus results were recorded. Univariate analysis and multivariable logistic regression models were used to identify possible statistical associations and risk factors. Nine out of 61 mares (14.7%) had EHV-5 DNA in their uterine flushings. Co-infections with EHV-1 and EHV-2 were present in two cases. Of all the variables analyzed, only the cytological examination findings were associated with EHV-5 PCR positive results, both on univariate and multivariable analysis, especially in cases with an inflammation score of 3. It is postulated that presence of EHV-5 infection in the non-pregnant uterus may have a role to play in reproductive dysfunction and have a negative consequence on the pregnant uterus. Additional studies involving both healthy mares and mares with reproductive problems need to be performed, however, to elucidate whatever role equine gammaherpesviruses may play in the reproductive tract. This would be very
Changes of biochemical environment and body weight in healthy periparturient Lipizzan mares
Directory of Open Access Journals (Sweden)
Vladimír Hura
2017-01-01
Full Text Available The aims of this study were to determine the concentrations of calcium, magnesium, phosphorus, chlorine, potassium, sodium, urea, total cholesterol, triacylglycerols, non-esterified fatty acids, total protein, creatinine, total bilirubin, aspartate aminotransferase, insulin, insulin growth factor 1, and glucose in the blood serum and to monitor the body weight changes in nine clinically healthy Lipizzan mares at weekly intervals within 2 weeks before and 2 weeks after the parturition. A significant body weight loss (P < 0.01 was found in the mares after the foaling. The peak of insulin growth factor 1 concentration in serum was reached at the day of parturition and similar patterns were revealed for the concentrations of insulin and glucose. After parturition, all these indices were significantly decreased. The concentrations of phosphorus and triacylglycerols were decreased, while the concentrations of potassium and sodium were increased at the day of parturition. Moreover, the concentration of non-esterified fatty acids was increased at the day of parturition (P < 0.05 with a tendency to higher values even on the 7th day postpartum. Other studied indexes remained relatively stable throughout the transition period. We can conclude that periparturient mares face some degree of negative energy balance with concomitant significant homeostatic and homeorhetic changes. For this reason, our results can be used as a basis for reference values and a diagnostic tool to examine the health status in horses during the transition period.
Directory of Open Access Journals (Sweden)
Khalid Mohammed Karam
2017-07-01
Full Text Available This study was conducted on 28 recipient local mares after synchronizing and recovery of embryos of Arabian mares (donor mares and transferring them to recipients on day 7 post ovulation, all mares were raised in the studs of police academy –Cairo Egypt under same circumstances in the breeding season from February till may of 2013. Seventeen recipient mares were pregnant and 9 mares were non pregnant when ultrasound pregnancy check was done on day 21 post ovulation, blood samples were taken on days 11,12 and 13 to detect the steroidal hormonal profile (estrogen and progesterone via Elisa technique of the recipient mares plasma steroid level and its role in early pregnancy and maternal recognition. The results were significantly higher (P≤0.05 between pregnant (n=17 and non-pregnant (n=9 recipient mares in the plasma progesterone concentrations which were 10.99±0.16 vs 9.59±0.11, 12.69±0.16 vs 11.79±0.22 and 14.4±0.15 vs 13.78±0.23 ng/ml on days 11,12 and 13 post ovulation respectively, significant difference(P≤0.05 was observed when comparison between pregnant mare’s plasma progesterone concentrations on days 11,12 and 13 post ovulation. Plasma estrogen concentration were significantly higher (P≤0.05 in non-pregnant and pregnant mares which were15.17±0.18 vs 14.84±0.14, 14.74±0.27 vs13.94±0.12 and 14.14±0.3 vs13.12±0.16 pg/ ml on days 11,12 and respectively, on the other hand when comparison between days11,12 and 13 plasma estrogen levels were significantly different (P≤0.05 in pregnant mares while no significant difference was found in the same days between non pregnant mares, thus might be the main reason for early embryonic death when detected in early pregnancy check via ultrasonography in 21 days post ovulation.
Mason, Maren E; Voris, Nathan D; Ortis, Hunter A; Geeding, Amy A; Kaplan, Ray M
2014-10-15
To compare larvicidal regimens of fenbendazole and moxidectin for reduction and suppression of cyathostomin fecal egg counts (FEC) in a transient herd of embryo transfer-recipient mares. Randomized, complete block, clinical trial. 120 mares from 21 states, residing on 1 farm. An initial fecal sample was collected from each mare; mares with an FEC ≥ 200 eggs/g were assigned to treatment groups. Eighty-two horses received fenbendazole (10.0 mg/kg [4.5 mg/lb], PO, q 24 h for 5 days) or moxidectin (0.4 mg/kg [0.18 mg/lb], PO, once); FEC data were analyzed 14, 45, and 90 days after treatment. Mean FEC reduction was 99.9% for moxidectin-treated mares and 41.9% for fenbendazole-treated mares 14 days after treatment. By 45 days, mean FEC of fenbendazole-treated mares exceeded pretreatment counts; however, FECs of moxidectin-treated mares remained suppressed below pretreatment values for the duration of the 90-day study. Fecal egg counts were significantly different between groups at 14, 45, and 90 days after treatment. Failure of the 5-day regimen of fenbendazole to adequately reduce or suppress FEC suggested inadequate adulticidal and larvicidal effects. In contrast, a single dose of moxidectin effectively reduced and suppressed FEC for an extended period. Given the diverse geographic origins of study mares, these results are likely representative of cyathostomin-infected mares in much of the United States, confirming previous findings indicating that fenbendazole resistance in cyathostomins is widespread and that moxidectin remains an effective treatment for control of these important parasites.
Endoscopic monitoring the estrous phase of Arabian mares with assaying its biopsy
Directory of Open Access Journals (Sweden)
Mohamed Fathi
2017-01-01
Full Text Available Objective: To evaluate the changes occur in the vagina, cervix and endometrium during the pre- ovulatory period in Arabian mares by using endoscope as a diagnostic tool as well as the availability of taking an endoscopic biopsy during this stage.Methods: Ten cyclic and healthy arabian mares were subjected to ultrasound scanning of their ovaries to estimate the diameter of the preovulatory follicles, collection of blood samples for estimating the hormonal levels (Estradiol-17 β and progestrone for confirming the estrous phase, endoscopic monitoring their vagina, cervix and endometrium, the availability of taking biopsical samples and histological examination of the obtained samples.Results: The obtained data revealed that, the mean diameter of the preovulatory follicles was (3.95±0.34 cm, the plasma estradiol and progestrone levels were (85.98±5.26 pg/mL and (0.73±0.23 ng/mL, respectively, endoscopic monitoring the vagina, cervix and endometrium revealed hyperemic vaginal mucous membrane, soft and opened cervical ostium with abundant estrous mucous and folding, hyperemic and edematous appearance of the endometrium, respectively and the histological features of the biopsical endometrial samples revealed that, The lamina propria-sub mucosa was packed with simple or branched tubular glands lined with simple columnar epithelium showing oval or rounded dark nuclei with different degrees of secretory activities of the glands.Conclusions: The endoscope proved to be a reliable tool for confirming the estrous phase in mares and monitoring the gross features of the vagina, the cervix and the endometrium, in addition to the availability of taking biopsical smears.
Korosue, Kenji; Murase, Harutaka; Sato, Fumio; Ishimaru, Mutsuki; Kotoyori, Yasumitsu; Tsujimura, Koji; Nambo, Yasuo
2013-01-15
To test the usefulness of measuring pH and refractometry index, compared with measuring calcium carbonate concentration, of preparturient mammary gland secretions for predicting parturition in mares. Evaluation study. 27 pregnant Thoroughbred mares. Preparturient mammary gland secretion samples were obtained once or twice daily 10 days prior to foaling until parturition. The samples were analyzed for calcium carbonate concentration with a water hardness kit (151 samples), pH with pH test paper (222 samples), and refractometry index with a Brix refractometer (214 samples). The sensitivity, specificity, and positive and negative predictive values for each test were calculated for evaluation of predicting parturition. The PPV within 72 hours and the NPV within 24 hours for calcium carbonate concentration determination (standard value set to 400 μg/g) were 93.8% and 98.3%, respectively. The PPV within 72 hours and the NPV within 24 hours for the pH test (standard value set at 6.4) were 97.9% and 99.4%, respectively. The PPV within 72 hours and the NPV within 24 hours for the Brix test (standard value set to 20%) were 73.2% and 96.5%, respectively. Results suggested that the pH test with the standard value set at a pH of 6.4 would be useful in the management of preparturient mares by predicting when mares are not ready to foal. This was accomplished with equal effectiveness of measuring calcium carbonate concentration with a water hardness kit.
Warren, Paul H.; Lindstrom, Marilyn M.
1993-01-01
Compositions of bulk powders and separated minerals from two meteorites derived from the mare lava plains of the Earth's Moon, Yamato-793169 and Asuka-881757, indicate a remarkable degree of similarity to one another, and clearly favor lunar origin. However, these meteorites are unlike any previously studied lunar rock. In both cases, the bulk-rock TiO2 content is slightly greater than the level separating VLT from low-Ti mare basalt, yet the Sc content is much higher than previously observed except among high-Ti mare basalts. Conceivably, the Sc enrichment in A881757 reflects origin of this rock as a cumulate from a mare magma of 'normal' Sc content, but this seems unlikely. Mineral-separate data suggest that most of the Sc is in pyroxene, and a variety of evidence weighs against the cumulus hypothesis as a major cause for the high Sc. The remarkable similarity between Y793169 and A881757 suggests the possibility that they were derived from a single source crater on the Moon.
Schulman, Martin; Becker, Annet; Ganswindt, Stefanie; Guthrie, Alan; Stout, Tom; Ganswindt, Andre
2014-01-17
Validation of a method for the minimally-invasive measurement of physiological stress will help understanding of risk factors that may contribute to stress-associated events including recrudescence of Equid herpesvirus (EHV), which is anecdotally associated with sales consignment of pregnant Thoroughbred mares. In this study we compared two similar groups of late-gestation Thoroughbred broodmares on the same farm: a consigned Sales group (N = 8) and a non-consigned Control group (N = 6). The Sales mares were separated from their paddock companions and grouped prior to their preparation for, transport to, and return from the sales venue. Both groups were monitored by sampling at regular intervals from 5 days prior to until 14 days after the sales date (D0) to measure physiological stress in terms of changes in faecal glucocorticoid metabolite (FGM) concentrations, and for event-related viral recrudescence via daily body temperature measurements and periodic nasal swabs for PCR analysis for EHV-1 and -4 DNA. In both groups, FGM levels increased post-sales before returning to pre-sales levels. Specifically, FGM concentrations in the Sales mares were significantly higher on D + 3 and D + 10 than on D-4 and D-3 (F = 12.03, P Sales) mare showed PCR evidence of EHV-1 shedding. Using FGM to measure physiological stress was supported by the increases observed in all mares after Sales consignment, including those not consigned to the sale. Monitoring FGM levels therefore represents an appropriate, minimally-invasive method for future studies to assess the contribution of physiological stress to EHV recrudescence in horses transported to sales or equestrian events.
Virgin, Joanna; Hendrickson, Dean; Wallis, Ty; Rao, Sangeeta
2010-08-01
To compare the presence or absence of pain, pain-related behavioral responses, and hormonal responses to noxious stimuli during standing laparoscopic ovariectomy in mares sedated with continuous intravenous (IV) detomidine infusion and caudal epidural detomidine. A double blind prospective study. Mares (n=12) Mares were divided into 2 treatment groups; 6 were sedated using continuous IV detomidine infusion and 6 were sedated with caudal epidural detomidine. All mares received IV xylazine (0.33 mg/kg) and butorphanol tartrate (5 mg) premedication before detomidine administration. Venous blood samples were taken to assess serum cortisol levels in each mare at 4 time points: a baseline cortisol measurement after the mares' arrival to the clinic, 10 minutes before surgery, at the removal of the 2nd ovary, and 10 minutes postsurgery. Two surgeons performed bilateral ovariectomy and at 8 time points involving surgical manipulations, noted the presence or absence of pain (yes/no) and scored the patient's response on a 10 cm visual analogue scale (VAS) for pain assessment with 0 indicating no pain responses and 10 cm indicating pain so severe that the mare required additional sedation or analgesia to complete the procedure. Each mare was also assigned a VAS score by each surgeon for the overall satisfaction of analgesia during the entire procedure. Serum cortisol levels between the 2 detomidine administration groups differed significantly at the baseline (precortisol) measurement but not at the 3 remaining time points. Seven of the procedures within the surgeries did not differ significantly in VAS scores between the 2 groups. The initial grasp of the left ovary (the 1st ovary) in the continuous infusion group had a significantly higher (P=.05) median VAS score compared with the caudal epidural group. Mares sedated with a continuous IV infusion of detomidine have similar hormonal and behavioral responses to painful stimuli during standing laparoscopic ovariectomy as mares
Whitten, J.; Head, J.W.; Staid, M.; Pieters, C.M.; Mustard, J.; Clark, R.; Nettles, J.; Klima, R.L.; Taylor, L.
2011-01-01
Moon Mineralogy Mapper (M3) image and spectral reflectance data are combined to analyze mare basalt units in and adjacent to the Orientale multiring impact basin. Models are assessed for the relationships between basin formation and mare basalt emplacement. Mare basalt emplacement on the western nearside limb began prior to the Orientale event as evidenced by the presence of cryptomaria. The earliest post-Orientale-event mare basalt emplacement occurred in the center of the basin (Mare Orientale) and postdated the formation of the Orientale Basin by about 60-100 Ma. Over the next several hundred million years, basalt patches were emplaced first along the base of the Outer Rook ring (Lacus Veris) and then along the base of the Cordillera ring (Lacus Autumni), with some overlap in ages. The latest basalt patches are as young as some of the youngest basalt deposits on the lunar nearside. M3 data show several previously undetected mare patches on the southwestern margins of the basin interior. Regardless, the previously documented increase in mare abundance from the southwest toward the northeast is still prominent. We attribute this to crustal and lithospheric trends moving from the farside to the nearside, with correspondingly shallower density and thermal barriers to basaltic magma ascent and eruption toward the nearside. The wide range of model ages for Orientale mare deposits (3.70-1.66 Ga) mirrors the range of nearside mare ages, indicating that the small amount of mare fill in Orientale is not due to early cessation of mare emplacement but rather to limited volumes of extrusion for each phase during the entire period of nearside mare basalt volcanism. This suggests that nearside and farside source regions may be similar but that other factors, such as thermal and crustal thickness barriers to magma ascent and eruption, may be determining the abundance of surface deposits on the limbs and farside. The sequence, timing, and elevation of mare basalt deposits
International Nuclear Information System (INIS)
Fuente Prieto, I.; Alonso, P.; Carretero Fernandino, J. A.
2000-01-01
The Nuclear Safety Council's requirement that Spanish power plants comply with the requirements of the Maintenance Rule associated with plant risk assessment during power operation, arising from the partial unavailability of systems due to the maintenance activities, has led to need for additional tools to facilitate compliance with said requirements. While the impact on risk produced by individual equipment unavailabilities can easily be evaluated, either qualitatively or quantitatively, the process becomes more complicated when un programmed unavailabilities simultaneously occur in various systems, making it necessary to evaluate their functional impact. It is especially complex in the case of support systems that can affect the functionality of multiple systems. In view of the above, a computer application has been developed that is capable of providing the operator with quick answers based on the specific plant model in order to allow fast risk assessment using the information compiled as part of the Probabilistic Safety Analysis. The paper describes the most important characteristics of this application and the basic design requirements of the MARE Risk Monitor. (Author)
Ei sinistele esmaspäevadele!!! / Piret Jamnes, Marju Unt, Mare Teichmann, Eva Palu
2010-01-01
Personaliotsingufirma Fontes partner ja konsultant Piret Jamnes, Estonian Euromanagement Institute'i direktor Marju Unt, kommunikatsioonibüroo JLS PR-konsultant Eva Palu ja TTÜ psühholoogiaprofessor Mare Teichmann ideedest, mis aitavad tööst rohkem rõõmu tunda
Directory of Open Access Journals (Sweden)
S. ZAHARIA
2012-12-01
Full Text Available The atmospheric precipitation, an essential meteorological element for defining the climatic potential of a region, presents through its general and local particularities a defining influence for the evolution of the other climatic parameters, conditioning the structure of the overall geographic landscape. Their quantitative parameters sets up the regional natural setting and differentiation of water resources, soil, vegetation and fauna, in the same time influencing the majority of human activities’ aspects, through the generated impact over the agriculture, transportation, construction, for tourism etc. Especially, through the evolution of the related climatic parameters (production type, quantity, duration, frequency, intensity and their spatial and temporal fluctuations, the pluviometric extremes set out the maxim manifestation of the energy gap of the hydroclimatic hazards/risks which induce unfavourable or even damaging conditions for the human activities’ progress. Hence, the production of atmospheric precipitation surpluses conditions the triggering, or reactivation of some intense erosion processes, landslides, and last but not least, floods. Just as dangerous are the adverse amounts of precipitation or their absence on longer periods, determining the appearance of droughts, aridity phenomena, which if associated with the sharp anthropic pressure over the environment, favours the expansion of desertification, with the whole process of the arising negative effects. In this context, this paper aims to perform the diagnosis of atmospheric precipitation condition in Baia Mare urban area, through its quantitative component, in multiannual condition (1971-2007, underlining through the results of the analyzed climatic data and their interpretation, the main characteristics that define it. The data bank from Baia Mare station from the National Meteorological Administration network, representative for the chosen study area, was used. Baia
Bower, M. A.; Campana, M. G.; Whitten, M.; Edwards, C. J.; Jones, H.; Barrett, E.; Cassidy, R.; Nisbet, R. E. R.; Hill, E. W.; Howe, C. J.; Binns, M.
2010-01-01
The paternal origins of Thoroughbred racehorses trace back to a handful of Middle Eastern stallions, imported to the British Isles during the seventeenth century. Yet, few details of the foundation mares were recorded, in many cases not even their names (several different maternal lineages trace back to ‘A Royal Mare’). This has fuelled intense speculation over their origins. We examined mitochondrial DNA from 1929 horses to determine the origin of Thoroughbred foundation mares. There is no e...
Carranza, Juan; Yoong, Washington A; Mateos, Concha; Caño Vergara, Belén; Gómez, Chian L; Macías, Verónica
2017-12-01
Horse reproduction tends to be seasonal. The main adjusting factor in their original temperate ranges is photoperiod variation, although it is absent in equatorial areas where horses were introduced by European colonizers. Hence, dates of reproduction in these areas may be influenced by factors affecting mares' conditions and the success of foaling. Here we study reproductive timing in Creole horses in Ecuador reared in an extensive production system. We found that foaling peaked in August. Mares' conditions showed one peak in June-July, before the start of the breeding season, and another in December, and it was highly variable along the year. Mares' conditions increased after a period of vegetation growth and thus appeared negatively associated with the increment of grass greenness (normalized difference vegetation index data). Seasonal flooding of some pasturelands during March and April appeared to seriously impair mares' conditions and probably influenced the timing of foaling toward the dry season. Our results evidenced that horse breeding in these equatorial areas tended to be seasonal and point to some key factors that influence phenology by affecting body condition of mares, which may have implications for horse biology and management. © 2017 Japanese Society of Animal Science.
The mare as a model for luteinized unruptured follicle syndrome : intrafollicular endocrine milieu
Bashir, S T; Gastal, M O; Tazawa, S P; Tarso, S G S; Hales, D B; Cuervo-Arango, J; Baerwald, A R; Gastal, E L
2016-01-01
Luteinized unruptured follicle (LUF) syndrome is a recurrent anovulatory dysfunction that affects up to 23% of women with normal menstrual cycles and up to 73% with endometriosis. Mechanisms underlying the development of LUF syndrome in mares were studied to provide a potential model for human
Verdes Mares: The Ideology of the Siren
Directory of Open Access Journals (Sweden)
Bruno Marinoni Marinoni
2009-02-01
Full Text Available The television channel number 10 of Fortaleza (current TV Verdes Mares, during the 1960 decade, passed through the ideological filter of the Military Dictatorship, when the channel was taken from its owner and given to the businessman Edson Queiroz. The filter had consequences in the next decade with the channel affiliation to the biggest network broadcasting of the country, the Rede Globo, which was also protected by the Military Regime. Based on those two facts, it is intended to discuss some aspects of the exploration models of communication that occurs in the country since the specified period, emphasizing the ideology transmitted by the TV channel which has the biggest audience ratings in Ceará.
Directory of Open Access Journals (Sweden)
Carmona, José Ambrosio
2003-12-01
Full Text Available A phylogeny of the species in the genera Chondrostoma and Squalius was constructed based on the complete mitochondrial cytochrome b gene (1140pb. The molecular phylogeny was used to test the effect of the Mediterranean Lago Mare dispersal theory on the processes of divergence and speciation of European freshwater fishes. Phylogenetic relationships among Squalius samples and the molecular clock revealed that the ancestor of the current Iberian Squalius species inhabited a wide geographic area in the central and southwestern part of the former Iberian Peninsula during the Miocene before the Lago Mare phase. Similarly, the four main Iberian lineages of the genus Chondrostoma originated in the Middle-Upper Miocene. Hence, the Lago Mare phase of the Mediterranean Sea seems to have been a too recent paleogeographic event to have had any major impact on the dispersion of Squalius and Chondrostoma species. However, the reduction of the water-bodies during the Tortonian and Messinian may have intensified the isolation of populations. The Operational Biogeographic Units recovered from the Squalius and Chondrostoma phylogenies also reject the Lago Mare dispersal theory and support the idea that the differentiation processes were due to both the formation of the current hydrographical basin during the Plio-Pleistocene as well as to an earlier endorrheism event that occurred prior to hydrographical configuration.Realizamos una filogenia de los géneros Chondrostoma y Squalius mediante el estudio de la secuencia completa del gen mitocondrial citocromo b (1140pb. La filogenia molecular fue usada para comprobar el efecto que la teoría de dispersión del Mediterráneo Lago Mare ha tenido sobre los procesos de divergencia y especiación en los peces de agua dulce europeos. Las relaciones filogenéticas entre las muestras de Squalius y la aplicación del reloj molecular pusieron de manifiesto que el ancestro de las actuales especies ibéricas de Squalius habitaba
dataMares - An online platform for the fast, effective dissemination of science
Johnson, A. F.; Aburto-Oropeza, O.; Moreno-Báez, M.; Giron-Nava, A.; Lopez-Sagástegui, R.; Lopez-Sagástegui, C.
2016-02-01
One of the current challenges in public policy development, especially related to natural resource management and conservation, is that there are very few tools that help easily identify and incorporate relevant scientific findings and data into public policy. This can also lead to a repetition of research efforts and the collect of information that in some cases might already exist. The key to addressing this challenge is to develop collaborative research tools, which can be used by different sectors of society including key stakeholder groups, managers, policy makers and the public. Here we present an "open science" platform capable of handling large data and disseminating results to a wide audience quickly. dataMares uses business intelligence software to allow the dynamic presentation of data quickly to a range of users online. dataMares provides Robust and up-to-date scientific information for decision-makers, resource managers, conservation practitioners, fishers, community members, and regional and national level decision-makers in a nutshell. It can also be used in the training of young scientists and allows quick and open connections with the journalism industry.
Lunar mare volcanism - Stratigraphy, eruption conditions, and the evolution of secondary crusts
Head, James W., III; Wilson, Lionel
1992-01-01
Recent developments in the geological analysis of lunar mare volcanism are reviewed. Analysis of returned samples and photogeological and remote sensing studies shows that mare volcanism began prior to the end of heavy bombardment (the period of cryptomare formation), in pre-Nectarian times, and continued until the Copernical Period, the total duration approaching 3.5-4 Ga. Stratigraphic analysis shows that the flux was not constant, but peaked in early lunar history, during the Imbrian Period. Average volcanic output rate during this period was about 0.01 cu cm/a. Volcanic landforms indicate that many eruptions were of high volume and long duration. Some eruptions associated with sinuous rills may have lasted a year and emplaced 1000 cu km of lava, representing the equivalent in one year of about 70,000 yr at the average flux. The occurrence of farside maria within craters whose diameter is generally near to or less than the thickness of the crust may be accounted for by the difference between local and regional compensation.
Infezioni gastroenteriche e fonti di rischio da balneazione nel mare Adriatico
Directory of Open Access Journals (Sweden)
N. Schinaia
2003-05-01
Full Text Available
Obiettivi: gli obiettivi generali della ricerca sono stati: stimare un eccesso di rischio di insorgenza di gastroenterite a seguito di attività di balneazione o consumo di prodotti ittici nel mare Adriatico; misurare nuovi parametri microbiologici di inquinamento marino.
Metodi: sono stati condotti i seguenti studi: 1 caso controllo; 2 uno studio di prevalenza (beach survey per descrivere la frequenza di alcune patologie (dell’orecchio, delle vie aeree superiori, della cute rispetto alla balneazione o meno; 3 identificazione di nuovi patogeni nelle acque di balneazione (quali virus o Cryptosporidium parvum.
Risultati: l’analisi dei fattori di rischio nello studio caso controllo non ha evidenziato un aumento di gastroenterite associata a balneazione. Gli episodi gastroenterici osservati nei casi erano prevalentemente sostenuti da Salmonella sp. e la modalità di infezione era legata ad alcuni alimenti quali la maionese. Il risultato principale dello studio di beach survey è stato che la balneazione nel mare Adriatico non è associata ad un aumento significativo di patologie serie, quali gastroenterite acuta.
Tuttavia, è stato possibile evidenziare un aumento di rischio statisticamente significativo per forme morbose lievi, quali congiuntivite e dermatite aspecifica, fra chi ha fatto il bagno in mare e chi no. Tale aumentato rischio è stato soprattutto osservato nei bambini e ragazzi al di sotto di 15 anni. I risultati di microbiologia sperimentale dimostrano il ruolo svolto dalle acque marine quale pabulum idoneo alla sopravvivenza delle oocisti di C. parvum. Sono stati validati protocolli di diagnostica molecolare per l’identificazione di enterovirus, rotavirus e reovirus nelle acque di balneazione.
Conclusioni: l’epidemiologia può contribuire a studiare i rapporti fra balneazione e salute all’interno di una visione generale di salute
Skarda, R T; Muir, W W
1999-10-01
To determine effects of i.v. administered yohimbine on perineal analgesia, cardiovascular and respiratory activity, and head and pelvic limb position in healthy mares following epidural administration of detomidine hydrochloride solution. 8 healthy mares. Each mare received detomidine hydrochloride (0.06 mg/kg of body weight), administered in the caudal epidural space, followed 61 minutes later by yohimbine (0.05 mg/kg; test) or sterile saline (0.9% NaCl) solution (control), administered i.v., in a randomized, crossover study design with > or = 2 weeks between treatments. Analgesia was determined by lack of sensory perception to electrical stimulation of perineal dermatomes and needle-prick stimulation of coccygeal to 15th thoracic dermatomes. Arterial pH, PaCO2, PaO2, heart and respiratory rates, rectal temperature, arterial blood pressure, and cardiac output were determined, and mares were observed for sweating and urination. Mean scores obtained for test and control groups were compared. Intravenously administered yohimbine significantly reduced mean scores of detomidine-induced perineal analgesia, head ptosis, changes in pelvic limb position, and sweating and diuresis; antagonized detomidine-induced decreases in heart rate and cardiac output; but did not affect detomidine-induced decrease in respiratory rate. Most effects of epidurally administered detomidine, except bradypnea, were antagonized by yohimbine, suggesting that detomidine may influence respiratory rate by mechanisms other than stimulation of alpha2-adrenoceptors, or that yohimbine induces respiratory depressant effects. Yohimbine may be an effective alpha2-adrenoceptor antagonist for all but respiratory depression following epidural administration of detomidine to mares.
VICTOR SOROCOVSCHI; DANIEL RADULY; CSABA HORVATH
2015-01-01
Seasonal discharge regime of the rivers in the Transylvanian Subcarpathians and the adjacent mountainous space between Târnava Mare and Niraj. The studied region is situated in the North-East of the Transylvanian Depression and includes two distinct units: the Transylvanian Subcarpathians and the Moldavo-Transylvanian Carpathians, comprised between the valleys of Târnava Mare and Niraj. The study is based upon the processing and interpretation of data coming from 13 hydrometric stations. In o...
Nguyen, Leonard T.; Vogel, Hans J.
2016-01-01
Staphylokinase (Sak) is a plasminogen activator protein that is secreted by many Staphylococcus aureus strains. Sak also offers protection by binding and inhibiting specific antimicrobial peptides (AMPs). Here, we evaluate Sak as a more general interaction partner for AMPs. Studies with melittin, mCRAMP, tritrpticin and bovine lactoferricin indicate that the truncation of the first ten residues of Sak (SakΔN10), which occurs in vivo and uncovers important residues in a bulge region, improves its affinity for AMPs. Melittin and mCRAMP have a lower affinity for SakΔN10, and in docking studies, they bind to the N-terminal segment and bulge region of SakΔN10. By comparison, lactoferricin and tritrpticin form moderately high affinity 1:1 complexes with SakΔN10 and their cationic residues form several electrostatic interactions with the protein’s α-helix. Overall, our work identifies two distinct AMP binding surfaces on SakΔN10 whose occupation would lead to either inhibition or promotion of its plasminogen activating properties. PMID:27554435
Crowe, C A M; Ravenhill, P J; Hepburn, R J; Shepherd, C H
2008-09-01
Historically, artificial insemination (AI) using frozen semen has been perceived to have poorer success rates and be more labour intensive than using chilled semen. A retrospective study was therefore conducted to compare the conception rate achieved by AI between chilled and frozen semen, using fixed time insemination protocols over 2 breeding seasons. Artificial insemination using chilled semen produces a higher conception rate than that achieved with frozen semen. Mares (n = 251) were inseminated with either chilled (n = 112) or frozen (n = 139) semen in the 2006 and 2007 northern hemisphere breeding season. Per rectum ultrasonography of the mare's reproductive tract determined the timing of insemination, and deslorelin acetate was used to induce ovulation. Chilled semen insemination was performed using a single preovulatory dose delivered into the uterine body. Frozen semen was administered as 2 doses (pre- and post ovulation) using a deep uterine insemination technique. Pregnancy was detected ultrasonographically at 15 days post insemination. Conception rates were compared using a Chi-squared test. Insemination with frozen semen produced a significantly (P = 0.022) higher seasonal conception rate (82.0%) than that achieved with chilled semen (69.6%). Insemination with frozen semen can achieve conception rates equal to those with chilled semen, enabling the mare owner a greater selection of stallions.
Cartografía del desencanto en la novela Los mares del Sur
Directory of Open Access Journals (Sweden)
Héctor Reyes
2012-01-01
Full Text Available RESUMEN: En este trabajo pretendemos aproximarnos a la obra de Montalbán, en específico a la novela Los mares de Sur, desde la literatura del viaje. Para esto trazamos el recorrido real e imaginario de Carlos Stuart Pedrell y Pepe Carvalho dentro de un marco espacial determinado por el propio escritor, es decir Barcelona, y durante un periodo específico, la transición democrática,todo ello encaminado a mostrar lo que para un gran número de críticos literarios simboliza la narrativa de Manuel Vázquez Montalbán: “la crónica del desencanto”. ABSTRACT: In this study we attempt to approach Montalban’s oeuvre, specifically the novel Los mares de Sur, from the perspective of travel literature. For this purpose we trace the real and imaginary itinerary of Carlos Stuart Pedrell and Pepe Carvalho within a spatial framework provided by the writer himself, that is Barcelona, and during a specific period, the democratic transition, all aimed at revealing what for a large number of literary critics symbolizes Manuel Vázquez Montalbán’s narrative: “the chronicle of disenchantment”.
Directory of Open Access Journals (Sweden)
F.E. Van Niekerk
1998-07-01
Full Text Available Pregnant Anglo-Arab and Thoroughbred mares (n = 24 were divided randomly according to age and breed into 4 groups of 6 mares each from approximately 6 weeks before their expected foaling date. Diets received by the 4 groups varied in essential amino-acid and total protein contents. Serum progestagen, FSH and LH concentrations were determined from the day of parturition until foal heat and during the 1st oestrous cycle following foal heat. Serum progestagen, FSH and LH concentrations did not differ between the treatment groups. Progestagen concentrations were high (c = 7.0: 5.2-16.4 ng/mℓ at parturition but decreased rapidly within 48 h. As progestagen concentrations decreased LH concentrations increased from Days 3-6 post partum to reach maximum values at, or the day after ovulation. FSH concentrations declined 3-4 d after parturition and increased 2-3 d before ovulation at foal heat. The duration of elevated progestagen concentrations during the luteal phase of the subsequent oestrous cycle affected the interovulatory period. A 12-14 d FSH cyclical releasing pattern occurred. Season/photoperiod affected the resumption of normal oestrous cyclicity during the post partum period. The duration of the 1st oestrous cycle after foal heat in mares fed a low-quality protein diet showed a greater range (13-30 d compared to mares fed a high-quality protein diet (18-26 d.
Ways of Optimising Regional Planning: Settlement Typology. Case Study: Baia Mare Depression
ADRIAN GAVRA; SORIN FILIP
2006-01-01
In a relatively uniform natural environment, the settlements in the Baia Mare Depression have very diverse forms. According to an oriented complex typology, we have identified the features and the problems characteristic of these settlements, according to the following criteria: the infrastructure already, demographic features, education, health, and tourism. By synthesising these criteria, we identified the following settlement types: polarising urban centres, under-pressure urban settlement...
RECURRENT, IDIOPATHIC URTICARIA IN A TONGA PONY MARE
Directory of Open Access Journals (Sweden)
T. Ahmad, G. Muhammad and M. H. Hussain
2003-01-01
Full Text Available A 15-Yearold tonga (a light wheeled horse cart pony mare was presented for the treatment of a condition characterized by generalized urticarial wheals, anemic mucous membranes, concentrated urine, inappetance and unilateral chemosis. Haematological alterations included a marked leucocytosis (WBC = 14x103/ul with monocytosis (2.5x109/L and moderate anemia (RBC count = 4.lx1012/L; PCV = 18; hemoglobin = 8.2 gm/dl. There was no history of exposure to agents known tQtrigger urticaria. Parental administration of a corticosteroid preparation (prednisolone plus dexamethasone and antihistamine (pheniramine maleate in 4 rounds of treatment over a 16 days period was associated with rebounding of signs of urticaria after cessation of each round oftherapyo
Cultura Política e Polos Regionais: comparando Campos dos Goytacazes (RJ com Maringá ampliada (PR
Directory of Open Access Journals (Sweden)
Sergio de Azevedo
2015-01-01
Full Text Available The article analyzes in comparative perspective the similarities and differences between the political culture of the population resident in Campos dos Goytacazes (RJ and Maringá, Paysandú and Sarandi, set of municipalities that we call Maringá magnified. On the comparative analysis between the Regional Poles two major theoretical questions that unify the proposal of this work are prioritized. The first corresponds to the classical concerns relating to the operation of democracy and citizens’ participation in the public life. The second refers to the impacts that the processes of change, differentiation and trajectory of life impacted in different groups, personal values that present, in different ways, an arc that goes from traditional conservatism to the legitimization of new habits and posture.
Selecting and Ranking Cost Research Projects
1993-09-01
Model (STACM) Enhancements Automated Cost Estimating Integrated Tools ( ACEIT ) Libraries BM/C 3 GEP Engineering and Cost BM/C 3 EP Engineering and Cost...50K NOM VHI 0.02635481 STACM ENHANCEMENTS NOM អK NOM VHI 0.02468682 ACEIT LIBRARIES VHI 50-IOOK HI VHI 0.06357704 GEP ENGRG. & COST VHI 100-150K VHl...0.02505922 SCATS LOW អK NOM VIII 0.02468682 PICES SUPPORT NOM 50-100K NOM VlIl 0.02455186 ACEIT SUPPORT VIII 50-100K VHI VHI 0.08208244 GUARDIAN
Directory of Open Access Journals (Sweden)
Osman Erganis
2014-01-01
Full Text Available This study aimed to determine the effectiveness of a pregnant mare immunization of a Rhodococcus equi (R. equi vaccine candidate containing a water-based nanoparticle mineral oil adjuvanted (Montanide IMS 3012 inactive bacterin and virulence-associated protein A (VapA, as well as the administration of anti-R. equi hyperimmune (HI plasma against R. equi challenge in the mares’ foals. The efficacy of passive immunizations (colostral passive immunity by mare vaccination and artificial passive immunity by HI plasma administration was evaluated based on clinical signs, complete blood count, blood gas analysis, serological response (ELISA, interleukin-4 (IL-4 and interferon gamma (IFN-γ, total cell count of the bronchoalveolar lavage fluids (BALF samples, reisolation rate of R. equi from BALF samples (CFU/mL, lung samples (CFU/gr, and lesion scores of the organs and tissue according to pathological findings after necropsy in the foals. The vaccination of pregnant mares and HI plasma administration in the foals reduced the severity of R. equi pneumonia and lesion scores of the organs and tissue by 3.54-fold compared to the control foals. This study thus indicates that immunization of pregnant mares with R. equi vaccine candidate and administration of HI plasma in mares’ foals effectively protect foals against R. equi challenge.
Carson, John M., III; Johnson, Andrew E.; Anderson, F. Scott; Condon, Gerald L.; Nguyen, Louis H.; Olansen, Jon B.; Devolites, Jennifer L.; Harris, William J.; Hines, Glenn D.; Lee, David E.;
2016-01-01
The Lunar MARE (Moon Age and Regolith Explorer) Discovery Mission concept targets delivery of a science payload to the lunar surface for sample collection and dating. The mission science is within a 100-meter radius region of smooth lunar maria terrain near Aristarchus crater. The location has several small, sharp craters and rocks that present landing hazards to the spacecraft. For successful delivery of the science payload to the surface, the vehicle Guidance, Navigation and Control (GN&C) subsystem requires safe and precise landing capability, so design infuses the NASA Autonomous precision Landing and Hazard Avoidance Technology (ALHAT) and a gimbaled, throttleable LOX/LCH4 main engine. The ALHAT system implemented for Lunar MARE is a specialization of prototype technologies in work within NASA for the past two decades, including a passive optical Terrain Relative Navigation (TRN) sensor, a Navigation Doppler Lidar (NDL) velocity and range sensor, and a Lidar-based Hazard Detection (HD) sensor. The landing descent profile is from a retrograde orbit over lighted terrain with landing near lunar dawn. The GN&C subsystem with ALHAT capabilities will deliver the science payload to the lunar surface within a 20-meter landing ellipse of the target location and at a site having greater than 99% safety probability, which minimizes risk to safe landing and delivery of the MARE science payload to the intended terrain region.
Baltimaade klaasikunstil on arenguruumi, vajaka jääb võimalustest / Mare Saare
Saare, Mare, 1955-
2008-01-01
Rahvusvaheline klaasinäitus "Vitrum Balticum IV" ("Balti klaas IV") Kaunases kuni 7. XII. Esindatud on Eesti (Kai Kiudsoo-Värv, Eeva Käsper, Ivo Lill, Kairi Orgusaar, Mare Saare, Maret Sarapu, Tiina Sarapu), Läti, Leedu ja Soome klaasikunstnikud. 14. XI rahvusvaheline seminar Läänemeremaade klaasikunsti arengukäigust 21. sajandil kunstiakadeemias. Näituse ja seminari kuraator kunstiteadlane Raimonda Kogelyte-Simanatiene
Da questa parte del mare. Gianmaria Testa ed Erri De Luca nel secolo delle migrazioni
Directory of Open Access Journals (Sweden)
Isabella Maria Zoppi
2009-11-01
Full Text Available Gianmaria Testa's album Da questa parte del mare (2006 expresses a fifteen-year-long meditation about the theme of the great migrations which have marked the Twentieth Century. That same theme is considered by Erri De Luca as the only possible, epic narration of the contemporary world. On the one hand, Testa's project finds its starting point from the song-writer's capacity of observing and interpreting common stories as well as from his considerations about the changing of History; on the other hand, it takes origin from the reading of Erri De Luca's novels and lyrics, especially those of Solo andata. Righe che vanno troppo spesso a capo (2005. Within Testa's Da questa parte del mare, their lyrical voices and artistic and human perspectives seem somehow to cross and melt. Through his songs, Testa tells in an original way the new human geography traced by the migrant phenomenon across the Mediterranean and Europe.
DEFF Research Database (Denmark)
Bondo, Tine; Jensen, Søren Krogh
2011-01-01
This study assessed the effect of a vitamin E supplement given to pregnant mares on immunoglobulins (Ig) levels in foals. In addition, the fatty acid (FA) content and composition of the mares’ milk was assessed. Milk α-tocopherol concentrations were compared between pregnant Danish Warmblood mare...
Brook, D
1984-05-01
A guarded, sterile swab is used to obtain samples for uterine culture. With the mare in stocks, the tail bandage and the perineum washed, the culture rod is introduced into the vagina with a gloved hand. After the rod is guided through the cervix, the guard cap is dislodged and the swab is rubbed along the endometrium, after which the rod is extracted. Samples for uterine culture should only be obtained during full estrus. Swabs should be directly plated onto agar within 2 hours of collection. Blood agar is appropriate for initial screening, but use of specialized types of agar expedites identification of microbes. Plates are incubated at 37 C and inspected for growth every 12 hours. The type and number of bacterial colonies should be coupled with the history and clinical signs in deciding on the necessity and type of treatment. Pure, heavy bacterial growth is usually accompanied by clinical signs of infection. Interpretation of the significance of moderate bacterial growth may be aided by cytologic examination of endometrial smears, made by rolling the swab onto a glass slide and staining with Diff - Quik . Large numbers of neutrophils indicate the need for antibiotic therapy. Mixed bacterial growth and variable numbers of neutrophils usually indicate faulty sampling technic. Microaerophilic or anaerobic cultures may aid diagnosis in cases of equivocal aerobic culture results.
Fradinho, M J; Correia, M J; Grácio, V; Bliebernicht, M; Farrim, A; Mateus, L; Martin-Rosset, W; Bessa, R J B; Caldeira, R M; Ferreira-Dias, G
2014-06-01
The aim of this study was to investigate the effects of body condition (BC), BC changes, and plasma leptin concentrations on the reproductive performance of Lusitano broodmares on extensive systems. Data from 119 mares (ranging from 4 to 22 years of age) were collected over a period of four consecutive breeding seasons. Each case was considered as one foaled mare bred in 1 year. Body condition changes at conception (ΔBCScon) showed a strong effect on fertility at the first two postpartum estrous cycles and a significant interaction with body condition score at conception (BCScon) was observed (P rate for the 4-year period was 74.5%. Mean foaling interval and gestation length were, respectively, 368.0 ± 2.8 and 340.3 ± 1.0 days. Gestation length was influenced by the month of foaling (P conditions. Copyright © 2014 Elsevier Inc. All rights reserved.
Compositional studies of Mare Moscoviense: New perspectives from Chandrayaan-1 VIS-NIR data
Bhatt, Megha; Wöhler, Christian; Dhingra, Deepak; Thangjam, Guneshwar; Rommel, Daniela; Mall, Urs; Bhardwaj, Anil; Grumpe, Arne
2018-03-01
Moscoviense is one of the prominent mare-filled basin on the lunar far side holding key insights about volcanic activity on the far side. Here, we present spectral and elemental maps of mare Moscoviense, using the Moon Mineralogy Mapper (M3) and Infrared Spectrometer-2 (SIR-2) data-sets. The different mare units are mapped based on their spectral properties analyzing both quantitatively (band center, band depth) and qualitatively (Integrated Band Depth composite images), and also using their elemental compositions. We find a total of five distinct spectral units from the basin floor based on the spectral properties. Our analysis suggests that the northern part which was mapped as Iltm unit (Imbrian low Ti, low Fe) by earlier researchers is actually a distinct unit, which is different in composition and age, named as Ivltm unit (Imbrian very low Ti and very low Fe). We obtain the absolute model age of 3.2 Ga with uncertainties of +0.2/ -0.5 Ga for the unit Ivltm. The newly identified basalt unit Ivltm is compositionally intermediate to the units Im and Iltm in FeO and TiO2 abundances. We find a total of five distinct spectral units from the basin floor based on the spectral properties. The units Im (Imbrian very low Ti) from southern and northern regions of the basin floor are spectrally distinct in terms of band center position and corresponding band depths but considered a single unit based on the elemental abundance analysis. The units Ivltm and Im are consistent with a high-Al basalt composition. Our detailed analysis of the entire Moscoviense basin indicates that the concentrations of orthopyroxene, olivine, and Mg-rich spinel, named as OOS rock family are widespread and dominant at the western and southern side of the middle ring of the basin with one isolated area found on the northern side of the peak ring.
Directory of Open Access Journals (Sweden)
DRAGOTĂ CARMEN
2013-03-01
Full Text Available The geographical position of the Baia Mare Urban System (intra-hilly depression favours the occurrence of a wide range of extreme climate phenomena which, coupled with the industrial profile of the city (non-ferrous mining and metallurgical industry triggering typical emissions (CO2, SOX, particulate matters and Pb, might pose a significant threat to human health. The article is aiming to assess the occurrence, frequency and amplitude of these extreme climate phenomena based on monthly and daily extreme climatic values from Baia Mare weather station in order to identify the areas more exposed. A GIS-based qualitative-heuristic method was used, each extreme climatic hazard being evaluated on a 1 to 3 scale according to its significance/impact in the study area and assigned with a weight (w and a rank (r, resulting the climate hazard map for the warm semester of the year. The authors further relate the areas exposed to the selected extreme climatic events to socio-economic aspects: demographic and economic in order to delineate the spatial distribution of the environmental vulnerability in the Baia Mare Urban System.
Clinical Trials during Late Pregnancy in Mares: Prevention of Abortion
Directory of Open Access Journals (Sweden)
Kirill PLEMYASHOV
2015-07-01
Full Text Available The paper observed the influence of the integrated treatment of abortion in mares with the supplement Haemobalans® to replace high-turnover vitamins, amino acids and minerals; and probiotics BF-15® which contains Bifidobacterium bifidum. The aims of this study were to prove the application of Haemobalans and BF-15 as adaptogens during late gestation. We examined 60 healthy adult Thoroughbred mares that were divided into four equal groups (n=15 on the 270 - 300th days of gestation. Test animals received the following treatment: 1 intramuscular injection of Haemobalans in 3 days, in a dose of 1 ml per 45 kg of body weight. BF-15 was also given for 10 days: 20 ml of the oral solution with oats two times per day. Reflex-1 group was treated with the same dose of Haemobalans. Reflex-2 group was treated with the same dose of BF-15. Control animals were also examined. Blood samples were taken before the treatment and two weeks after it. First examination showed the basic level of investigated sources, the last one showed the result of the treatment. The difference between the data (which were obtained before and after treatment was compared in each group. In case of significant differences between the data of the test group relative to the other three groups, we talked about the reliability of the outcomes. Tissue of placentae were taken after delivery, fixed with neutral formalin and stained with hematoxylin and eosin. Zones of pathological changes were identified. Database of categorical data was created in placental study. Number of cases for markers of placental insufficiency (PI was determined. In the personal database of one animal the presence of a pathological case was marked (1 and the absence was marked (0. The objective excess of (1 was regarded as PI. The concentrations of glucose, total protein, creatinine, hemoglobin, vitamin B12, ESR, count of lymphocyte and MCHC in the test group were significantly higher: 16.4%; 10.78%; 17.87%; 11
THE NITROGEN REGIME OF THE SASAR RIVER, IN BAIA MARE SECTION, THE PERIOD 2000-2010
Directory of Open Access Journals (Sweden)
ADRIANA MUNTEAN
2011-03-01
Full Text Available The Baia Mare city - the residence of Maramures county, is known as one of the most polluted cities from Romania, following a long history of mining activities and ores processing. The improper treatment of wastewater from flotation and treatment with cyanide ores and their discharge into the river Sasar led, slowly, but surely destroying the ecosystem. In addition to mining activities have contributed of course, and the metallurgical activities in the area. One of constant pollutions is and disposal of sewage waste water (treated poorly or not at all in the mass water of the Sasar river. The nitrogen regime may provide clues as to the possibility of developing various forms of life, being an indicator of the nutrient regime of aquatic life. This study aims at assessing the quality of the nitrogen regime of Sasar river, in the section upstream and downstream of Baia Mare, in the period 2000-2010, with reference to the Order 161/2006 - regarding the classification of surface water quality to determine the ecological status of water bodies .
MOTIVATIONAL PRACTICES USED BY EMPLOYERS FROM THE COUNTIES OF SATU MARE AND BIHOR
Directory of Open Access Journals (Sweden)
Olimpia Neagu
2013-09-01
Full Text Available The paper explores the motivation of human resources in the companies from counties of Satu Mare and Bihor. Data were collected by applying a questionnaire to 114 companies located in the counties of Satu Mare and Bihor, within the project HURO/0901/264/2.2.2 implemented in partnership by "Vasile Goldis" Western University and University of Debrecen and financed by European Union through ERDF under Hungary-Romania 2007- 2013 Programme. Data were processed and analyzed by using the SPSS soft. We found that employers perceived as most efficient the following motivation instruments: a good communication between employees, basic wage, partial delegation of managerial tasks and optimal working conditions. The efficiency of the motivation instruments in the view of employers differs significantly across activity sectors. Thus, using the ANOVA test, we found that the variation of variables related to basic wage, performance rewarding, bonuses, partial delegation of managerial tasks, work competencies, fear of job loss, need for affiliation to a workgroup, the prestige outside the organisation, working a good reputation organisation, social benefits, home distance can be explained in a proportion ranged from 23,5% to 42,9% by the variation of variable associated to the activity sector.
Directory of Open Access Journals (Sweden)
RADU ALEXANDRU MARIAN
2012-11-01
Full Text Available GIS utility for hydrological impact evaluation caused by damages of water supply network in rural areas. Applications in Baia Mare Depression. Occurrence of a failure within the water supply network is an element of risk with important hydrological implications. Although at first glance you might think that a pipe diameter of only 20 cm can generate large effects, however, in case of significant damage or even burst pipe, a good part of high water flow in the pipe (approx. 25 m3/h on average in the Baia Mare associated with a long duration of failure (several hours may be in the drain area, impact on the local community. Regarding rural settlements, surface drainage allow a quantity of water retention tank underground infiltration but in many cases lack of a sewage system effectively contribute to increased negative consequences related to such damage (flooding farms, roads, crops compromise of flooding or drought in the event of damage to the hot water supply pipe and so on. This paper focuses on the role of Geographic Information Systems (GIS to assess the impact of runoff induced by damages in rural areas. The study therefore spatial aspect, through GIS, on the one hand runoff along the flow path with the start point of the network fault location and view previous hydrological conditions of the terrain, and on the other hand the impact of runoff the rural community. Study area Dumbrăviţa settlement located in Baia Mare Depression. This village is part of water supply system to the south and southeast of Baia Mare.
Directory of Open Access Journals (Sweden)
Darla K. Moser
2017-05-01
Full Text Available This report describes fibrous cyst lining injection and extracorporeal shock wave therapy (ESWT of a medial femoral condyle (MFC subchondral cystic lesion (SCL resulting in catastrophic MFC fracture in an Arabian mare. The mare was presented for evaluation of a severe hind limb lameness of approximately 4 months duration. On presentation, a non-weight bearing lameness of the left hind limb with severe effusion and soft tissue swelling of the stifle region was noted. Radiographic evaluation of the stifle revealed a large SCL of the MFC with associated osteoarthritis. Arthroscopic guided intra-lesional injection of the SCL with corticosteroids and autologous bone marrow concentrate was performed followed by ESWT of the MFC. The mare was discharged walking comfortably 48-hours post-operatively. An acute increase in lameness was noted 14 days post-operatively. Imaging revealed catastrophic fracture of the left MFC. Possible mechanisms leading to failure of the MFC secondary to the described treatment are discussed.
Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Nguyen, Tien Thi Thuy; Wulijideligen,; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku
2016-01-01
Leuconostoc mesenteroides 406 was isolated from the traditional fermented mare milk airag in Tuv Aimag, Mongolia. This strain produces an antilisterial bacteriocin. Here, we report the draft genome sequence of this organism.
Ryan, P L; Christiansen, D L; Hopper, R M; Walters, F K; Moulton, K; Curbelo, J; Greene, J M; Willard, S T
2011-05-01
Uterine and placental infections are the leading cause of abortion, stillbirth, and preterm delivery in the mare. Whereas uterine and placental infections in women have been studied extensively, a comprehensive examination of the pathogenic processes leading to this unsatisfactory pregnancy outcome in the mare has yet to be completed. Most information in the literature relating to late-term pregnancy loss in mares is based on retrospective studies of clinical cases submitted for necropsy. Here we report the development and application of a novel approach, whereby transgenically modified bacteria transformed with lux genes of Xenorhabdus luminescens or Photorhabdus luminescens origin and biophotonic imaging are utilized to better understand pathogen-induced preterm birth in late-term pregnant mares. This technology uses highly sensitive bioluminescence imaging camera systems to localize and monitor pathogen progression during tissue invasion by measuring the bioluminescent signatures emitted by the lux-modified pathogens. This method has an important advantage in that it allows for the potential tracking of pathogens in vivo in real time and over time, which was hitherto impossible. Although the application of this technology in domestic animals is in its infancy, investigators were successful in identifying the fetal lungs, sinuses, nares, urinary, and gastrointestinal systems as primary tissues for pathogen invasion after experimental infection of pregnant mares with lux-modified Escherichia coli. It is important that pathogens were not detected in other vital organs, such as the liver, brain, and cardiac system. Such precision in localizing sites of pathogen invasion provides potential application for this novel approach in the development of more targeted therapeutic interventions for pathogen-related diseases in the equine and other domestic species.
Antibody response in vaccinated pregnant mares to recent G3BP[12] and G14P[12] equine rotaviruses
Directory of Open Access Journals (Sweden)
Nemoto Manabu
2012-11-01
Full Text Available Abstract Background Both the G3P[12] and the G14P[12] type of equine group A rotavirus (RVA have recently become predominant in many countries, including Japan. G3 types are classified further into G3A and G3B. The G3A viruses have been circulating in Europe, Australia, and Argentina, and the G3B viruses have been circulating in Japan. However, only an inactivated vaccine containing a single G3BP[12] strain is commercially available in Japan. To assess the efficacy of the current vaccine against recently circulating equine RVA strains, we examined antibody responses in pregnant mares to recent G3BP[12] and G14P[12] strains by virus neutralization test. Findings After vaccination in five pregnant mares, the geometric mean serum titers of virus-neutralizing antibody to recent G3BP[12] strains increased 5.3- to 7.0-fold and were similar to that against homologous vaccine strain. Moreover, antibody titers to recent G14P[12] strains were also increased 3.0- to 3.5-fold. Conclusions These results suggest that inoculation of mares with the current vaccine should provide foals with virus-neutralizing antibodies against not only the G3BP[12] but also the G14P[12] RVA strain via the colostrum.
Directory of Open Access Journals (Sweden)
Paula Marçal Natali
2008-01-01
Full Text Available Resumo: Este artigo tem o objetivo de apresentar as características e funções dos programas de contra turno social os quais atendem crianças e adolescentes em situação de risco, na cidade de Maringá-PR, que foram implantados no início dos anos 90. Este estudo faz parte de uma pesquisa de mestrado que analisa os Programas de Contra Turno Social na cidade de Maringá-PR, mais especificamente no que se refere à questão do papel do lúdico inserido no currículo destes programas de contra turno social. Esta forma de atendimento foi legitimada pelo Estatuto da Criança e do Adolescente no que diz respeito às políticas de atendimento em regime de apoio sócio-educativo em meio aberto. Nesta pesquisa qualitativa, no primeiro momento apresentaremos um breve panorama das políticas de atendimento à criança e ao adolescente no Brasil, partindo da promulgação do Código de Menores de 1927 e chegando ao Estatuto da Criança e do Adolescente de 1990. Em um segundo momento, relataremos as representações dos órgãos governamentais e da sociedade civil sobre como os programas sociais de contra turno vem sendo realizados na cidade de Maringá através de entrevistas com funcionárias da Secretaria de Assistência Social e Cidadania do município e membros do Conselho Municipal da Criança e do Adolescente. Entendemos que as representações sobre o contra turno social na cidade de Maringá são carregadas de elementos técnicos e burocráticos e muito incipientes em relação aos fundamentos pedagógicos e filosóficos deste atendimento que são elementos primordiais para a efetivação dos direitos à criança e ao adolescente em situação de risco fundamentada na concepção do Estatuto da Criança e do Adolescente de sujeito de direito que busque a participação popular e que tenha um projeto emancipatório.Abstract: This paper aims to present the features and functions of the programmes of supplementary activities offered outside of
Tactile mouse generating velvet hand illusion on human palm
Directory of Open Access Journals (Sweden)
Nadar Rajaei
2016-09-01
Full Text Available To enhance virtual reality (VR generated by tactile displays, we have focused on a novel tactile illusion, called the Velvet Hand Illusion (VHI. In VHI, moving two parallel wires back and forth between the two hands leads humans to perceive a velvet-like surface between their hands. In earlier studies, we revealed that the intensity of VHI could be controlled by a ratio (r/D, where r and D are the wire stroke and wire distance, respectively. According to these findings, we investigate in this study whether a common tactile display is able to produce VHI, and whether the ratio can also control VHI intensity. We prepare a dot-matrix display as a tactile display in which moving one line of the display’s pins is considered as a wire pattern. We investigate the VHI intensity with regard to changing the stroke r and the line distance D using paired comparison. Experimental results show that the VHI intensity is increased or decreased by changing r and D. We conclude that VHI can be created by the tactile display, and the intensity of VHI is controlled by changing the ratio of r/D.
Directory of Open Access Journals (Sweden)
Leonor Marcon da Silveira
2006-01-01
Full Text Available O município de Maringá, atravessado pelas coordenadas de 23º27´S e51º57´W, situa-se no Norte do Estado do Paraná - Brasil. Verifica-se aí acentuada variação do tempo atmosférico, decorrente da alternância de sistemas atmosféricos tropicais e extratropicais. O presente estudo teve por objetivo investigar as variações diárias doselementos climáticos à superfície em Maringá e suas relações com os sistemas atmosféricos geradores dos diferentes tipos de tempo que atuaram durante o outono e o inverno de 1996. Objetivou também averiguar as relações entre a atuação da Frente Polar Atlântica (FPA e a pluviosidade local. Elegeu-se o ano de 1996 por apresentar neutralidade em relação aos fenômenos El Niño e La Niña. Esse estudo apoiou-se na concepção dinâmica de clima e na metodologia da análise rítmica. Constatou-se que, durante o período em estudo, todas aschuvas decorreram, direta ou indiretamente, da Frente Polar Atlântica (FPA. Constatou-se também que a pluviosidade esteve mais relacionada com a duração dos sistemas frontais do que com o número de passagens desses sistemas pela região. As temperaturas muito baixas decorreram principalmente das incursões de sistemas polares interiorizados e geralmente ocorreram quando as frentes não promoveram chuva.The municipality of Maringá, 23°27' S and 51°57' W, lies in the north State of Paraná, southern Brazil. Pronounced atmosphere variations are due to alternations in tropical and extra-tropical atmosphere systems. Daily variations of surface climate factors in Maringá and their relationships with atmospheric systems which cause different types of weather during autumn and winter of 1996 have been investigated. The relationship between the activities of the Atlantic Polar Front (APF and local rainfall has also been analyzed. The year 1996 has been chosen because of the absence of the El Niño and LaNiña phenomena. The analysis was based on the dynamic
Directory of Open Access Journals (Sweden)
Rivanildo Dallacort
2010-04-01
Full Text Available The performance of the CROPGRO-Drybeans model for the prediction of soil water balance, as well as growth components and bean crop yield, was assessed using data from two field experiments conducted at the State University of Maringá Irrigation Technical Center, Paraná - Brazil, (latitude 23º27'S, longitude 51º57' and altitude 542 m, during the 2005 and 2006 growing season. The model simulations correlated well with measured soil moisture (r > 0.7 for both experiments. However, there were high discrepancies between measured and simulated soil moisture values on the days after rainfall. In addition, it was found that the model exaggerates the effect of water stress during the flowering phase, which leds to underprediction (19 and 29% of crop yield.O desempenho do modelo CROPGRO-Drybeans para predição do balanço de água no solo, componentes de crescimento e produtividade, foram avaliados por meio de dados de dois experimentos de campo conduzidos no Centro Técnico de Irrigação da Universidade Estadual de Maringá, localizado em Maringá, PR (latitude 23º 25' S, longitude de 51º 57' O, altitude de 542 m, nos os anos agrícolas de 2005 e 2006. Concluiu-se que o modelo simulou estresse hídrico maior que o real na fase de florescimento, subestimando o rendimento em 19 e 29%. Os valores de umidade do solo medidos no campo e simulados pelo CROPGRO, foram bem correlacionados (r > 0,7, porém houve discrepância acentuada nos valores medidos e simulados no dia posterior à ocorrência da precipitação.
Management of Stakeholders in Urban Regeneration Projects. Case Study: Baia-Mare, Transylvania
Directory of Open Access Journals (Sweden)
Corina M. Rădulescu
2016-03-01
Full Text Available The process of regeneration of abandoned areas or deteriorated structures in the cities of Romania has become a strategy of urban-integrated development. Conversions and/or regeneration of facilities in the form of assets, with different destinations, are part of the new trend of urban regeneration and a strategy used to attract investment capital. The disappearance of mining industry sites in Maramures County, Romania, has allowed the expansion and planning of new spaces for public use and/or semipublic, and most cities have opened new development perspectives. The study is based on empirical research conducted on the brownfields of Baia-Mare City. This research investigates how stakeholders of an urban regeneration project can be more actively involved in the decision-making processes with regard to the strategic elements of the renewal project of Cuprom, as a former mining industry area. This research contributes to the development of the investigation of new types of knowledge of stakeholder analysis and improves the available practices for stakeholder salience. Social networks created and consolidated by stakeholders of an urban regeneration project are the object of analysis, evaluation, and monitoring of the equilibrium between project management and grant of resources and capital. This paper studies the salience of stakeholders of the SEPA-CUPROM project from Baia-Mare using the social networking approach. Visualization by graphical methods of social networking analysis is a useful instrument in the decision-making process of brownfield projects as part of sustainable strategies in Romania.
Pre-mare cratering and early solar system history
International Nuclear Information System (INIS)
Wetherill, G.W.
1974-01-01
An evaluation of the application of the high extra-lunar flux in pre-mare times to more general problems of early solar system history is attempted by combining the results of dynamic studies with lunar chronological data. Dynamical studies permit separate evaluation of the possible sources for both the normal flux during the first 600 m.y. years of lunar history as well as the peak which apparently occurred 4.0 b.y. ago. Dynamical studies have been carried out in order to determine the extent to which a heliocentric flux could be confined to the Moon (and Earth). A Monte Carlo method has been used to calculate the relative impact rates of planet-crossing bodies with the moon and the terrestrial planets. It is concluded that the time-variation of the flux on these planets is closely related to that on the moon
Directory of Open Access Journals (Sweden)
Nursulu Julanova
2016-01-01
Full Text Available The objective of this study was to develop a method of preparation and use of vasectomized stallions, and to test them as a factor preventing genital functional disorders in mares during training and hippodrome testing. Thoroughbred mares of English, Arabic and Akhal-Teke breeds owned by horse ranches of the Republic of Kazakhstan were used in the research. Vasectomy techniques were mastered on a slaughtering material, and then field tested on stallions. A series of experiments were set for comparative evaluation of various methods of preparation and use of a vasectomized stallion, resulting in a technique based on removing the front section of sperm ducts in the ventro-caudal portion of the scrotum. The developed method is convenient, safe, and easy to perform in field conditions. The surgery is not time consuming, and there are no postoperative complications. We found a positive effect of the vasectomized stallion on the course of the mares’ oestrous cycles, on their performance during hippodrome testing, and their reproductive function. The method reduced the standing heat period, and the mares quickly recovered their performance. Thus, it decreased the time of the mares’ elimination from the training schedule and had a positive effect on the performance during hippodrome testing. The use of a vasectomized stallion during training significantly predetermined the course of the mares’ reproductive cycle after completion of the hippodrome testing. The results of this study are relevant to the practical needs of sport horse breeding.
Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Nguyen, Tien Thi Thuy; Wulijideligen; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku
2016-03-24
Leuconostoc mesenteroides406 was isolated from the traditional fermented mare milk airag in Tuv Aimag, Mongolia. This strain produces an antilisterial bacteriocin. Here, we report the draft genome sequence of this organism. Copyright © 2016 Morita et al.
Endoscopic diagnosis and management of an unusual nasal foreign body in a mare
Directory of Open Access Journals (Sweden)
Turke M. Shawaf
2017-06-01
Full Text Available Occurrence of intra-nasal foreign bodies is uncommon in horses. This report describes -for the first time- a case of a 4-year-old Arabian-cross mare with unilateral mucopurulent nasal discharge, epistaxis and exercise intolerance due to intra-nasal foreign body. Clinical signs, radiography and endoscopic examination confirmed the presence of a tooth fragment (foreign body embedded in the ventral valve of the left nasal cavity. The foreign body was successfully removed using alligator forceps under endoscopic guidance.
Directory of Open Access Journals (Sweden)
Gérard Nadine
2005-06-01
Full Text Available Abstract A growing body of evidence suggests that the interleukin-1 system is involved in periovulatory events. Previous work from our lab demonstrated that in the mare, interleukin-1beta (IL-1beta increases the ovulatory rate of metaphase II oocytes. The present study was conducted to analyze in vivo the effect of IL-1 on oocyte cytoplasmic maturation, ovulation and pregnancy rate. In the present work, IL-1beta (experiment 1, n = 13; experiment 2, n = 25 and interleukin-1RA (IL-1RA; experiment 1, n = 25 were injected intrafollicularly by using the transvaginal ultrasound-guided injection method. Injections were performed on cyclic mares when the diameter of the growing dominant follicle reached 30–34 mm. In experiment 1, mares were inseminated the day of the treatment and all the other day until ovulation. The time of ovulation was determined and a pregnancy diagnosis was performed 14 days after ovulation of the injected follicle. In experiment 2, the cumulus-oocyte complex from each injected follicle was collected by transvaginal ultrasound-guided aspiration 38 h after the intrafollicular injection. Oocyte nuclear stage and oocyte cytoplasmic maturation were assessed by analyzing chromatin configuration, cortical granules migration and mitochondria distribution under a confocal microscope. The results from experiment 1 confirm that an intrafollicular injection of 1 microgram IL-1beta induces ovulation in the mare whereas IL-1RA has no effect at the dose used in the present study. Furthemore, we demonstrated, that in our experimental conditions, IL-1beta and IL-1RA induced a decrease in embryo development. Experiment 2 leads us to observe that IL-1beta is unable to induce cortical granules migration and remodelling of mitochondria, that commonly occurs during oocyte maturation, whereas it acts on nuclear maturation. This result may explain the decrease in embryo development we observed after IL-1beta intrafollicular injection. In conclusion
Directory of Open Access Journals (Sweden)
Beatrice SZILAGYI
2011-11-01
Full Text Available Tree species Asimina triloba (L. Dunal, is native to North America. In the area of origin is cultivated, both as food species because the edible fruit, and as ornamental species. Ornamental value derives both from decorative flowers, that open in early spring, and because habitus species. The species is demanding from slightly acidic soils (pH 5.5 to 7.0 and well drained. Seedlings are susceptible to heatstroke and need areas of the sun, but since the second year, vegetate well in bright light conditions [27]. Optimum climate is temperate to subtropical one. The species exhibits unique quality traits for a temperate fruit that are similar to other fruit in the Annonaceae family, including cherimoya (Annona cherimola Mill., sugar apple or sweetsop, (A. squamosa L., soursop (A. muricata L., custard apple (A. reticulata L., and atemoya (A. squamosa X A. cherimola, all of which are tropical [2].This study follows the behavior of the species, in particular conditions of the Baia Mare and its surroundings. In this area a fewindividuals were introduced, in order to diversigy the range of species of ornamental plants. In Baia Mare, topoclimate is specifically depression, sheltered by mountains, more atenuated as temperature and winds, than in surrounding areas. As a result ofclimatic conditions, chestnut Castanea sativa, grows in good conditions in Baia Mare. Instead, the area is heavily polluted,especially at ground level. Pollution by heavy metals is a historical being generated by the mining industry.The introduction and use of a new plant species into a new area involves: 1. easy to obtain seed; 2.- maintaining the crown shape habitus and and leaf shape and size, respectively; 3 – determination of optimal physiological parameters. Therefore have been performed, the following experimental determinations: 1. - germination of seed obtained in the particular conditions of the Baia Mare; 2. - some morphomtric characteristics of leaves, in the juveniles
Expression of recombinant staphylokinase in the methylotrophic yeast Hansenula polymorpha
Directory of Open Access Journals (Sweden)
Moussa Manal
2012-12-01
Full Text Available Abstract Background Currently, the two most commonly used fibrinolytic agents in thrombolytic therapy are recombinant tissue plasminogen activator (rt-PA and streptokinase (SK. Whereas SK has the advantage of substantially lower costs when compared to other agents, it is less effective than either rt-PA or related variants, has significant allergenic potential, lacks fibrin selectivity and causes transient hypotensive effects in high dosing schedules. Therefore, development of an alternative fibrinolytic agent having superior efficacy to SK, approaching that of rt-PA, together with a similar or enhanced safety profile and advantageous cost-benefit ratio, would be of substantial importance. Pre-clinical data suggest that the novel fibrinolytic recombinant staphylokinase (rSAK, or related rSAK variants, could be candidates for such development. However, since an efficient expression system for rSAK is still lacking, it has not yet been fully developed or evaluated for clinical purposes. This study’s goal was development of an efficient fermentation process for the production of a modified, non-glycosylated, biologically active rSAK, namely rSAK-2, using the well-established single cell yeast Hansenula polymorpha expression system. Results The development of an efficient large scale (80 L Hansenula polymorpha fermentation process of short duration for rSAK-2 production is described. It evolved from an initial 1mL HTP methodology by successive scale-up over almost 5 orders of magnitude and improvement steps, including the optimization of critical process parameters (e.g. temperature, pH, feeding strategy, medium composition, etc.. Potential glycosylation of rSAK-2 was successfully suppressed through amino acid substitution within its only N-acetyl glycosylation motif. Expression at high yields (≥ 1g rSAK-2/L cell culture broth of biologically active rSAK-2 of expected molecular weight was achieved. Conclusion The optimized production process
Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Bolormaa, Tsognemekh; Burenjargal, Sedkhuu; Nguyen, Co Thi Kim; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku
2016-01-01
Leuconostoc mesenteroides 213M0 was isolated from traditional fermented mare milk airag in Bulgan Aimag, Mongolia. This strain produces a listericidal bacteriocin-like inhibitory substance. Here, we report the draft genome sequence of this organism.
Regional stratigraphy and geologic history of Mare Crisium
Head, J. W., III; Adams, J. B.; Mccord, T. B.; Pieters, C.; Zisk, S.
1978-01-01
Remote sensing and Luna 24 sample data are used to develop a summary of the regional stratigraphy and geologic history of Mare Crisium. Laboratory spectra of Luna 24 samples, telescopic reflectance spectra in the 0.3 to 1.1 micron range and orbital X-ray data have identified three major basalt groups in the region. Group I soil is derived from iron- and magnesium-rich titaniferous basalts and was apparently emplaced over the majority of the basin, however is presently exposed as a shelf in the southwest part. Group II soils, derived from very low titanium ferrobasalts, were emplaced in two stages subsequent to Group I emplacement and now appear as part of the outer shelf and topographic annulus. Subsidence of the basin interior preceded and continued after the emplacement of the third basalt group, a soil derived from a low titanium ferrobasalt. The Luna 24 site is found to be within a patch of Group II material.
Subsurface structures in the northern Mare Imbrium measured by Chang'E-3 and SELENE
Kumamoto, A.; Ishiyama, K.; Feng, J.
2016-12-01
Subsurface structures in the northern Mare Imbrium measured by Chang'E-3 and SELENE have been compared. In Chang'E-3 mission, subsurface radar sounding at (19.51W, 44.12N) was performed by Lunar Penetrating Radar (LPR) onboard the Yutu rover. The LPR was pulse radar operated at two frequencies: 60 MHz and 500 MHz. During its operation period from December 2013 to January 2014, the LPR observed subsurface echoes along the rover's track with total distance of 114 m. From the observation in 60 MHz, the subsurface echoes from buried regolith layers at depths of 35, 50, 140, 240, and 360 m were reported (Xiao et al., 2015). In SELENE mission, global subsurface radar sounding of the moon was performed by Lunar Radar Sounder (LRS) onboard the SELENE (Kaguya) spacecraft from the polar orbit with an altitude of 100 km. The LRS was chirp radar operated in a frequency range from 4-6 MHz. So the range resolution of LRS was 75 m in vacuum. During operation period from December 2007 to September 2008, subsurface echoes from all areas of the Moon was observed with a lateral resolution of 76 m. From the global observation, the subsurface echoes from the buried regolith layers in the neraside maria including Mare Imbrium at depths of several hundred meters were reported (Ono et al., 2009).In the present study, we focus on SELENE/LRS data obtained at (19.50W, 44.12N) which is the nearest to the Chang'E-3 landing site. While clear and large-scale subsurface reflectors, as found in Ono et al. (2009), are not found in it, we can identify some echo components from the depths of 140 ( 2000 ns), 240 ( 4000 ns), and 360 m ( 6000 ns). Further analyses utilizing high-resolution data from Chang'E-3/LPR and large-scale data from SELENE/LRS, we will be able to determine the thickness and large-scale structures of the buried regolith layers found by the both radars, and discuss their formation processes in volcanic history of Mare Imbrium.
Evaluation of circulating miRNAs during late pregnancy in the mare.
Directory of Open Access Journals (Sweden)
Shavahn C Loux
Full Text Available MicroRNAs (miRNAs are small, non-coding RNAs which are produced throughout the body. Individual tissues tend to have a specific expression profile and excrete many of these miRNAs into circulation. These circulating miRNAs may be diagnostically valuable biomarkers for assessing the presence of disease while minimizing invasive testing. In women, numerous circulating miRNAs have been identified which change significantly during pregnancy-related complications (e.g. chorioamnionitis, eclampsia, recurrent pregnancy loss; however, no prior work has been done in this area in the horse. To identify pregnancy-specific miRNAs, we collected serial whole blood samples in pregnant mares at 8, 9, 10 m of gestation and post-partum, as well as from non-pregnant (diestrous mares. In total, we evaluated a panel of 178 miRNAs using qPCR, eventually identifying five miRNAs of interest. One miRNA (miR-374b was differentially regulated through late gestation and four miRNAs (miR-454, miR-133b, miR-486-5p and miR-204b were differentially regulated between the pregnant and non-pregnant samples. We were able to identify putative targets for the differentially regulated miRNAs using two separate target prediction programs, miRDB and Ingenuity Pathway Analysis. The targets for the miRNAs differentially regulated during pregnancy were predicted to be involved in signaling pathways such as the STAT3 pathway and PI3/AKT signaling pathway, as well as more endocrine-based pathways, including the GnRH, prolactin and insulin signaling pathways. In summary, this study provides novel information about the changes occurring in circulating miRNAs during normal pregnancy, as well as attempting to predict the biological effects induced by these miRNAs.
Validity and Reliability Study of Bahasa Malaysia Version of Voice Handicap Index-10.
Ong, Fei Ming; Husna Nik Hassan, Nik Fariza; Azman, Mawaddah; Sani, Abdullah; Mat Baki, Marina
2018-05-21
This study aimed to determine the validity and reliability of Bahasa Malaysia version of Voice Handicap Index-10 (mVHI-10). This cross-sectional study was carried out in the Otorhinolaryngology, Head and Neck Surgery Department of Universiti Kebangsaan Malaysia Medical Centre (UKMMC) from June 2015 to May 2016. The mVHI-10 was produced following a rigorous forward and backward translation. One hundred participants, including 50 healthy volunteers (17 male, 33 female) and 50 patients with voice disorders (26 male, 24 female), were recruited to complete the mVHI-10 before flexible laryngoscopic examinations and acoustic analysis. The mVHI-10 was repeated in 2 weeks via telephone interview or clinic visit. Its reliability and validity were assessed using interclass correlation. The test-retest reliability for total mVHI-10 and each item score was high, with the Cronbach alpha of >0.90. The total mVHI-10 score and domain scores were significantly higher (P Kaiser-Meyer-Olkin measure was 0.92, which depicted excellent construct validity. There was a significant positive correlation between the mVHI-10 score and jitter and shimmer result (P < 0.001). The present study showed good reliability and validity of the mVHI-10 when applied to both healthy volunteers and patients with voice disorders. We recommend the use of the mVHI-10 in daily clinical practice among Bahasa Malaysia-speaking population. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Brogan, P. T.; Henning, H.; Stout, T. A E; de Ruijter-Villani, M.
2016-01-01
Colour-flow Doppler sonography has been described as a means of assessing corpus luteum (CL) function rapidly, because area of luteal blood vessels correlates well with circulating progesterone (P4) concentrations [P4] in oestrous cycling mares. The aim of this study was to assess the relationships
Prof.Ing. Vladimír Mareček, DrSc. se potká se pětašedesátkou
Czech Academy of Sciences Publication Activity Database
Samec, Zdeněk; Štulík, K.
2009-01-01
Roč. 103, č. 10 (2009), s. 867-867 ISSN 0009-2770 Institutional research plan: CEZ:AV0Z40400503 Keywords : Prof. Mareček * electrochemistry Subject RIV: CG - Electrochemistry Impact factor: 0.717, year: 2009
Chauhan, M.
2017-12-01
Mare Humorum, centered at 24°S and 39°W is a mare basin of Nectarian age present at the southwestern end of Oceanus Procellarum towards the nearside of the Moon. It displays several rings, in varying states of exposure and preservation. The area is entirely flooded by mare material that constitutes its major recognizable event. In the present study, investigation of mineralogy of the basaltic flows of Mare Humorum basin have been undertaken to understand its compositional character, especially the pyroxene variability. Primarily, high-resolution data of Hyperspectral Imager (HySI) (Spatial resolution, 80m/pixel) from Chandrayaan-I mission of Indian Space Research Organization (I.S.R.O) have been used. Besides, Moon Mineralogy Mapper M3 data (140 m/pixel) from the same mission, with its full coverage of the area have been used as base of whole study. The spectral properties of pyroxenes have utilized for characterization of mare lithology and to demarcate the various spectral units based on pyroxene-variability. The compositional analysis results, thus obtained, are studied and discussed for understanding the basaltic evolution of the Humorum basin.
Morita, Hidetoshi; Toh, Hidehiro; Oshima, Kenshiro; Nakano, Akiyo; Hano, Chihiro; Yoshida, Saki; Bolormaa, Tsognemekh; Burenjargal, Sedkhuu; Nguyen, Co Thi Kim; Tashiro, Kosuke; Arakawa, Kensuke; Miyamoto, Taku
2016-03-31
Leuconostoc mesenteroides213M0 was isolated from traditional fermented mare milk airag in Bulgan Aimag, Mongolia. This strain produces a listericidal bacteriocin-like inhibitory substance. Here, we report the draft genome sequence of this organism. Copyright © 2016 Morita et al.
MARE2DEM: a 2-D inversion code for controlled-source electromagnetic and magnetotelluric data
Key, Kerry
2016-10-01
This work presents MARE2DEM, a freely available code for 2-D anisotropic inversion of magnetotelluric (MT) data and frequency-domain controlled-source electromagnetic (CSEM) data from onshore and offshore surveys. MARE2DEM parametrizes the inverse model using a grid of arbitrarily shaped polygons, where unstructured triangular or quadrilateral grids are typically used due to their ease of construction. Unstructured grids provide significantly more geometric flexibility and parameter efficiency than the structured rectangular grids commonly used by most other inversion codes. Transmitter and receiver components located on topographic slopes can be tilted parallel to the boundary so that the simulated electromagnetic fields accurately reproduce the real survey geometry. The forward solution is implemented with a goal-oriented adaptive finite-element method that automatically generates and refines unstructured triangular element grids that conform to the inversion parameter grid, ensuring accurate responses as the model conductivity changes. This dual-grid approach is significantly more efficient than the conventional use of a single grid for both the forward and inverse meshes since the more detailed finite-element meshes required for accurate responses do not increase the memory requirements of the inverse problem. Forward solutions are computed in parallel with a highly efficient scaling by partitioning the data into smaller independent modeling tasks consisting of subsets of the input frequencies, transmitters and receivers. Non-linear inversion is carried out with a new Occam inversion approach that requires fewer forward calls. Dense matrix operations are optimized for memory and parallel scalability using the ScaLAPACK parallel library. Free parameters can be bounded using a new non-linear transformation that leaves the transformed parameters nearly the same as the original parameters within the bounds, thereby reducing non-linear smoothing effects. Data
Canisso, Igor F; Ball, Barry A; Scoggin, Kirsten E; Squires, Edward L; Williams, Neil M; Troedsson, Mats H
2015-03-01
The objectives of this study were to: (i) determine alpha-fetoprotein (AFP) concentrations in fetal fluids (FF), and (ii) compare plasma concentrations of AFP in mares with placentitis (n=17) and gestationally age-matched control mares (n=17). Fetal fluid sampling (FFS, n=7/group) was performed at 0, 5 and 12 days post inoculation (DPI) or until abortion. Plasma was harvested daily for 12 days or until abortion. Placentitis was induced via intracervical inoculation of Streptococcus equi ssp. zooepidemicus. Proteins present in the FF were resolved by 1D-SDS-PAGE, and immunoblotting was used to detect the presence of AFP in fetal fluids. Concentrations of AFP in FF and plasma were determined with a chemiluminescence immunoassay. Mixed models for DPI, and for days from abortion (DFA) were used to analyze plasma concentrations of AFP. A protein band ∼68kDa consistent with the AFP size was present in all samples of fetal fluids examined. Immunoblotting for AFP revealed a single protein band (∼68kDa) in all samples. Concentrations of AFP in FF appeared higher than those in maternal plasma. There were effects of time (DPI p<0.0001; DFA p=0.0002) and time-by-group interactions (DPI*Group p<0.06; Group*DFA p<0.001). This study confirmed that AFP is present in the FF of mares during the third trimester of pregnancy. Experimentally induced placentitis was associated with an elevation in maternal plasma concentrations of AFP. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Edilene Lins de Moura
2006-06-01
Full Text Available Este estudo descritivo, com abordagem qualitativa, foi motivado pelo elevado número de casos de transmissão vertical do HIV. Teve como objetivo identificar as expectativas e ações da gestante HIV positivo quanto à gravidez e ao concepto. A amostra constituiu-se de 14 gestantes infectadas, assintomáticas, que conheciam sua soropositividade antes da gravidez e que estavam no 3º trimestre de gestação. Utilizou-se entrevista para a coleta de dados que ocorreu em 2001 e 2002. Empregou-se o Método do Discurso do Sujeito Coletivo para analisar os dados. Verificou-se que, quanto à maternidade, as gestantes tinham expectativas semelhantes, adaptaram-se à gravidez, e acreditavam na soronegatividade do bebê e na efetividade do tratamento. Concluiu-se pela necessidade de implementação de orientação para a saúde direcionada à mulher com enfoque na transmissão vertical do HIV/aids.Este estudio descriptivo, con aproximación cualitativa, fue motivado por el gran número de niños con transmisión vertical del VHI. Tuvo como objetivo identificar las expectativas y acciones de la gestante VHI positivo en cuanto al embarazo y al concepto. La muestra se constituyó de 14 gestantes infectadas, asintomáticas, que conocían su seropositividad antes del embarazo y que estaban en el 3.er trimestre de gestación. Para la recolección de los datos, realizada en el período de 2001 y 2002, se utilizó la entrevista. El Método de Discurso de Sujeto Colectivo fue empleado para analizar los datos. Se verificó que, en cuanto a la maternidad, las gestantes tenían expectativas semejantes. Se adaptaron a la gestación, confiaban en que el bebé seria suero negativo y en la efectividad del tratamiento realizado. Las conclusiones orientan hacia la necesidad de implementación de orientación sobre la salud de la mujer con acercamiento en la transmisión vertical del VHI/SIDA.This descriptive study with a qualitative approach was motivated by the high number
Fotografia religiosa: a leitura de imagens na história da Diocese de Maringá
Selson Garutti
2011-01-01
This study comprises reading photos specifically referring to the episcopate in religious photos of Dom Jaime Luiz Coelho, 1st Bishop of the Diocese of Maringá, in Paraná State, the Catholic bishops¿ period which lasted for 40 years, from 1957 to 1997. Based on acquits consists of multiple images, analyzed four categories of photographs: ecclesiastical architecture, episcopate, activities and ecclesiastical body. Noting the discourse about the Church, the social context and their relations re...
Directory of Open Access Journals (Sweden)
Célia Regina Granhen Tavares
2012-07-01
Full Text Available This study aimed to track the spatial and temporal variations of toxic chemical compounds, such as the metals Al, Cd, Pb, Cu, Cr, Mn, Zn and the pesticide glyphosate, in Maringá stream and in a stretch of Pirapó river. The results pointed out that, in the case of metals, one of the possible sources of these elements is associated to agricultural activities. For glyphosate, were not found concentrations above those established by the Brazilian Water Quality Legislation (CONAMA 357/2005. Concerning this, we emphasized that the impact caused by the agrochemical on water quality should be evaluated considering the adverse effects to the environment caused by its degradation, that produces recalcitrant and surfactant compounds that may be even more toxic for humans and aquatic environment. Esse estudo teve por objetivo monitorar a variação espaço-temporal de compostos químicos tóxicos, como os metais Al, Cd, Pb, Cu, Cr, Mn, Zn e o defensivo agrícola glifosato, nas águas do ribeirão Maringá e de um trecho do rio Pirapó. Os resultados obtidos mostraram que no caso dos metais uma das possíveis fontes destes elementos na bacia está vinculada às atividades agrícolas. Para o defensivo glifosato, neste trabalho não foram encontradas concentrações acima do permitido pela legislação (CONAMA 357/2005. Sobre esse aspecto, ressalta-se que o impacto dos produtos agrícolas sobre a qualidade da água deve ser avaliado do ponto de vista dos efeitos adversos ao ambiente causados por sua degradação, gerando, por sua vez, compostos recalcitrantes e surfactantes e que podem ser muito mais tóxicos à vida aquática e ao homem.
Directory of Open Access Journals (Sweden)
Leonor Marcon da Silveira
2010-01-01
Full Text Available O presente estudo teve por objetivo identificar os sistemas atmosféricos geradores da escassez de chuvas durante os meses de maio de 2003 e maio de 2005, em Maringá, Estado do Paraná, Brasil. Para atingir os objetivos propostos, utilizaram-se dados meteorológicos de superfície referentes às variações diárias dos elementos climáticos, com os quais se elaborou uma tabela para cada um dos meses em estudo, eleitos como amostragem de meses de maio secos. Para identificar os sistemas atmosféricos promotores dos diferentes tipos de tempo, tais tabelas foram analisadas concomitantemente à análise de cartas sinóticas meteorológicas de superfície, também diárias, e de imagens de satélite. Constatou-se que a escassez de chuva em Maringá durante os períodos estudados decorreu da atuação de anticiclones frios, que penetraram na retaguarda dos sistemas frontais, e da atuação do Sistema Tropical Atlântico sobre o continente, o qual geralmente bloqueava as frentes frias próximo à latitude de 30°S, de modo que estas se deslocavam para o Atlântico antes de alcançarem a área em estudo. The atmospheric systems accountable for scanty rainfall during May 2003 and May 2005 in Maringá, Paraná State, Brazil, are identified. Surface meteorological data on daily variables of climatic elements have been employed for the creation of a table for each month under analysis. They were chosen as dry May samplings. Tables were analyzed concomitantly with an investigation on daily surface meteorological synoptic charts and on satellite photos, so that the atmosphericsystems causing different types of climate might be identified. Results show that scanty rainfall in Maringá during the periods under analysis was caused by cold anti-cyclone activities which followed after frontal systems and by the activities of Atlantic TropicalSystem on the South American subcontinent. The latter normally blocks out cold fronts near latitude 30°S which, in turn
MARE-WINT. New Materials and Reliability in Offshore Wind Turbine Technology
DEFF Research Database (Denmark)
This book provides a holistic, interdisciplinary overview of offshore wind energy, and is a must-read for advanced researchers. Topics, from the design and analysis of future turbines, to the decommissioning of wind farms, are covered. The scope of the work ranges from analytical, numerical...... and experimental advancements in structural and fluid mechanics, to novel developments in risk, safety & reliability engineering for offshore wind. The core objective of the current work is to make offshore wind energy more competitive, by improving the reliability, and operations and maintenance (O&M) strategies...... of wind turbines. The research was carried out under the auspices of the EU-funded project, MARE-WINT. The work seeks to bridge the gap between research and a rapidly-evolving industry....
Prevalence of mycoplasmas in the semen and vaginal swabs of Danish stallions and mares
DEFF Research Database (Denmark)
Baczynska, Agata; Fedder, J.; Schougaard, H.
2006-01-01
may occur. Mycoplasmas have been implicated in genital disorders and infertility of many species including humans and horses. However, their role as commensals or pathogens of the genital tract of horses is still not determined. Bacteriological examinations made on the fossa glandis, urethra, penis...... and semen of stallions, showed the presence of different Mycoplasma species. Therefore our study aimed to find the prevalence of Mycoplasma species and a possible association with fertility problems in Danish riding horses. Eighty semen samples from stallions and 19 vaginal swab samples from mares were...
Prevalence of mycoplasmas in the semen and vaginal swabs of Danish stallions and mares
DEFF Research Database (Denmark)
Baczynska, Agata; Fedder, J; Schougaard, H
2007-01-01
may occur. Mycoplasmas have been implicated in genital disorders and infertility of many species including humans and horses. However, their role as commensals or pathogens of the genital tract of horses is still not determined. Bacteriological examinations made on the fossa glandis, urethra, penis...... and semen of stallions, showed the presence of different Mycoplasma species. Therefore our study aimed to find the prevalence of Mycoplasma species and a possible association with fertility problems in Danish riding horses. Eighty semen samples from stallions and 19 vaginal swab samples from mares were...
Directory of Open Access Journals (Sweden)
Fabiane Castilho Teixeira
2011-09-01
Full Text Available O texto analisa como corpo, festa e ludicidade aparecem na pintura em telas da artista plástica Lilia Lobo e como sua arte traduz a memória cultural da cidade de Maringá-PR. Com base no método iconológico, o intuito do estudo é apresentar obras que retratam a cultura nesta cidade, notadamente, aquelas que tematizam as festas. Os dados atentam para a materialização imagética da cultura maringaense, ressaltada em detalhes que expressam um corpo lúdico num campo festivo singular. As investigações apontam para a necessidade de contribuir para a difusão/valorização de artistas que se tornam esquecidos e que produzem importante documento iconográfico da cultura da cidade.The text analyses how body, party and ludic way appear in the oil painting of the artist Lilia Lobo and how her art translate the Maringá city, Paraná state, cultural memory. Using the iconological method, the purpose of this study is to present a work that reports the culture in this city, mainly the ones that have parties as subject. The data focus the imagnetic materialization of the Maringá culture, remarked in details that express a ludic body in a singular party field. The investigations point to the need to contribute with a diffusion/valorization of artists that become forgotten and that produce important iconographical documents of the city culture.
THE PRESSURE OF ANTHROPIC ACTIVITIES ON NATURAL CAPITAL OF SATU MARE COUNTY
Directory of Open Access Journals (Sweden)
VIOLETA BRAN
2017-12-01
Full Text Available The relationship between man and the natural environment, that provides the most valuable resources for existence, has transformed over time into an artificial and destructive manifestation. The encrease of the standard of living of society has been achieved through the drastic reduction of natural resources and the demage of the environment, endangering the welfare of future generations. Activities such as discharges of waste in the rivers, inappropriate use of land, uncontrolled deforestation, fragmentation of habitats due to infrastructure development pose the greatest risks to natural capital. This article aims to analyze by statistical methods, on the basis of the documents studied, the negative effects of anthropogenic activities on the natural capital of Satu Mare County.
Directory of Open Access Journals (Sweden)
Enrico Pierluigi Spugnini
2017-06-01
Full Text Available A twenty-year-old female saddle horse was referred for evaluation of a seven month, non-healing erosive lesion of the right hind hoof with proliferation and bleeding of the underlying soft tissues. This lesion had been twice surgically treated as a canker but rapidly recurred. Histological examination of the second excision revealed a well-differentiated squamous cell carcinoma. At presentation, the horse was mildly depressed, lame and partially non-weight-bearing on the right hind leg, which exhibited a 10 x 10 cm erosive and proliferative lesion remodeling the hoof. After completing staging procedures, the lesion was approached with surgery and intraoperative electrochemotherapy (ECT administration of bleomycin in isolated limb perfusion. A second session of surgery and ECT was performed one month later, followed by three additional monthly sessions of ECT. During periodic recheck, the mare showed continuous improvement. One year after presentation, the mare was in complete remission and her gait markedly improved. ECT was well-tolerated and resulted in improved local control of a tumor in a challenging anatomical district.
Mateu-Sánchez, S; Newcombe, J R; Garcés-Narro, C; Cuervo-Arango, J
2016-01-01
The interval from both spontaneous and prostaglandin (PGF)-induced luteolysis to ovulation is greatly variable in mares. Several reports have shown a positive association between the length of the interval from PGF treatment to ovulation (ITO) and the subsequent pregnancy rate (PR). However, it is
Park, Sung Shin; Kwon, Tack-Kyun; Choi, Seong Hee; Lee, Won Yong; Hong, Young Hye; Jeong, Nyun Gi; Sung, Myung-Whun; Kim, Kwang Hyun
2013-01-01
The aim of this study was to assess the reliability and validity of the Pediatric Voice Handicap Index (pVHI) for cross-cultural adaptation of the Korean version with school age children. The questionnaire was translated into Korean and was completed by 101 Korean parents who have children with or without disordered voice. The Korean version-pVHI scores were obtained with 60 parents of normal children and 41 parents who have children with voice problems. Content validity was verified by five experienced speech-language pathologists with clinical specialization in voice disorders. Internal consistency was calculated through Cronbach's α coefficient and test-retest reliability of the Korean version-pVHI score was determined using Pearson product-moment correlation coefficients. Mann-Whitney U test was used to compare GRBAS with the Korean version-pVHI scores between normal and dysphonia group. The relationship between the parent-reported the Korean version-pVHI total scores and perceptual ratings of voice quality from experts was investigated using Spearman correlation coefficients. The results showed that the Korean version-pVHI provided a high internal consistency (α=0.92) and test-retest reliability of its subscales: total (T) 0.97, functional (F) 0.90, physical (P) 0.95, emotional (E) 0.92. The Korean version-pVHI mean scores in normal group were 1.28 (T), 0.62 (F), 0.35 (P) and 0.32 (E), respectively whereas those of the Korean version-pVHI in children group with dysphonia were 23.13 (T), 8.90 (F), 9.54 (P) and 4.93 (E). Significant differences in the Korean version-pVHI (T, F, P, E) and perceptual evaluation (grade, rough, breathy) between normal and dysphonia group were revealed (PKorean version-pVHI parameters (T) and perceptual measures (G) was exhibited in children with dysphonia. The subjective Korean version-pVHI can be applicable and useful supplementary tool for evaluating parents' perception of their children's voice dysfunction, identifying
Correlation between acoustic parameters and Voice Handicap Index in dysphonic teachers.
Niebudek-Bogusz, E; Woznicka, E; Zamyslowska-Szmytke, E; Sliwinska-Kowalska, M
2010-01-01
The aim of this study was to investigate the relationship between acoustic analysis and biopsychosocial implications of voice problems, evaluated by the Voice Handicap Index (VHI). The study comprised 120 female teachers with voice disorders, evaluated by videolaryngostroboscopy. 60.8% of this group were diagnosed as having functional dysphonia and 39.2% had dysphonia with benign vocal fold masses (nodules and polyps). The controls consisted of 30 euphonic women. The correlations between VHI and acoustic analysis were assessed in both groups using the Pearson correlation coefficient and regression analysis. In teachers, the total VHI score was over 5 times as high as in controls (p teachers, significant positive correlations were found between the total VHI score and the frequency perturbation parameters and amplitude perturbation parameters when both statistical methods were used. These acoustic parameters also significantly correlated with the score on the functional and emotional subscales, but rarely with the physical subscale of the VHI. The study revealed a significant relationship between the objective voice measurements and the VHI. The results confirmed that VHI can be a valuable tool for assessing biopsychosocial implications of occupational dysphonia and should be incorporated in multidimensional voice evaluation. (c) 2010 S. Karger AG, Basel.
Hayes, A. G., Jr.; Lorenz, R. D.; Zebker, H. A.; Donelan, M. A.; Karatekin, O.; Mastrogiuseppe, M., Sr.; Le Gall, A. A.; Hofgartner, J. D.; Encrenaz, P.; Poggiali, V.
2014-12-01
Oceanography is no longer just an Earth Science. Standing bodies of liquid that interact with both atmospheric and surface reservoirs are known to exist on Titan, and are thought to have existed on early Mars. The exchange of heat, moisture, and momentum between lakes/seas and the atmosphere are of fundamental importance to the hydrologic systems of all three bodies. The generation and propagation of wind-waves, and their consequent shoreline erosion, are key factors in air-sea-surface exchange. Titan, in particular, offers a laboratory in which to understand these processes at a more fundamental level. Much of the parameterization for wave models on Earth are empirical, despite laboratory studies that have demonstrated wave growth depends on both gravity and fluid properties. Titan's exotic environment ensures that even rudimentary measurements of wave generation will provide valuable data to anchor physical models. Furthermore, in the presence of wind waves, Cassini can be used as an anemometer to measure wind speeds over hydrocarbon liquids. Herein, we will report on the results of the Aug 21st altimetry observation over Titan's largest sea, Kraken Mare, and interpret them in the context of wave activity and composition (from passive radiometry). On Earth, it is rare to observe a body of water whose surface is not disturbed by some form of wave activity. On Titan, Cassini observations through the end of its Equinox Mission in Dec 2010 showed no indication of waves. These observations are intriguing given the predominance of aeolian features at equatorial latitudes and have been attributed to the light winds predicted during the Titan winter. More recently, however, the previous series of upper limits and non-detections are giving way to indications that the expected freshening of winds in northern summer may be causing sporadic ruffling of the sea surfaces. Specifically, apparent sunglints offset from the geometric specular point has been observed by VIMS in
AY, Recep; YORULMAZ, Sibel
2010-01-01
In this study, multiple resistance, inheritance and cytochrome P450 enzyme activity were determined in Tetranychus urticae Koch (SAK) population after 20 selections for bifenthrin resistance. Selection study and LC50, 60 levels of SAK population of T. urticae were determined by dry film method. LC50 level of the SAK population selected twenty times with bifenthrin was increased from 984.49 to 11914.40 µl l-1 distiled water. Selected population showing 21.84 fold resistances was named ...
Bonnand, Pierre; Parkinson, Ian J.; Anand, Mahesh
2016-02-01
We present the first stable chromium isotopic data from mare basalts in order to investigate the similarity between the Moon and the Earth's mantle. A double spike technique coupled with MC-ICP-MS measurements was used to analyse 19 mare basalts, comprising high-Ti, low-Ti and KREEP-rich varieties. Chromium isotope ratios (δ53Cr) for mare basalts are positively correlated with indices of magmatic differentiation such as Mg# and Cr concentration which suggests that Cr isotopes were fractionated during magmatic differentiation. Modelling of the results provides evidence that spinel and pyroxene are the main phases controlling the Cr isotopic composition during fractional crystallisation. The most evolved samples have the lightest isotopic compositions, complemented by cumulates that are isotopically heavy. Two hypotheses are proposed to explain this fractionation: (i) equilibrium fractionation where heavy isotopes are preferentially incorporated into the spinel lattice and (ii) a difference in isotopic composition between Cr2+ and Cr3+ in the melt. However, both processes require magmatic temperatures below 1200 °C for appreciable Cr3+ to be present at the low oxygen fugacities found in the Moon (IW -1 to -2 log units). There is no isotopic difference between the most primitive high-Ti, low-Ti and KREEP basalts, which suggest that the sources of these basalts were homogeneous in terms of stable Cr isotopes. The least differentiated sample in our sample set is the low-Ti basalt 12016, characterised by a Cr isotopic composition of -0.222 ± 0.025‰, which is within error of the current BSE value (-0.124 ± 0.101‰). The similarity between the mantles of the Moon and Earth is consistent with a terrestrial origin for a major fraction of the lunar Cr. This similarity also suggests that Cr isotopes were not fractionated by core formation on the Moon.
Mustonen, Anni
2011-01-01
Tämän tutkielman tarkoituksena on tutkia mestari Eckhartin (1260 1327) ykseyden mystiikkaa. Tutkimuskysymyksiä on kaksi: (1) Miten Eckhart kuvaa käsitystään unio mysticasta? Tarkastelen kysymystä Eckhart-tutkimuksen piirissä tehdyn jaottelun mukaan, jossa unio ymmärretään joko Pojan syntymänä sielussa (saks. Geburt) ja läpimurtautumisena (saks. Durchbruch) tun-temattomaan jumaluuteen (saks. Gotheit/Gottheit). Toinen tutkimuskysymykseni on jatkumoa edelliselle ja kuuluu: (2) Millainen on Jumal...
Directory of Open Access Journals (Sweden)
Ueslei Teodoro
1998-12-01
Full Text Available Um caso de leishmaniose tegumentar com provável infecção em uma das áreas de matas remanescentes no perímetro urbano de Maringá, Paraná, Brasil, o desconhecimento da fauna e do comportamento de flebotomíneos nestas matas despertaram o interesse desta investigação. Os flebotomíneos foram coletados com armadilhas de Falcão instaladas em matas remanescentes do Parque do Ingá, Bosque Dois e Horto Florestal, de junho a setembro de 1995, no período noturno. Nestas áreas coletaram-se 3.532 flebotomíneos, prevalecendo Lutzomyia (Nyssomyia whitmani (Antunes & Coutinho, 1939 com 3.395 (96,1% exemplares. No Parque do Ingá, onde as coletas também foram feitas em abrigos de animais silvestres, mantidos em zoológico, foram coletados 2.907 flebotomíneos, dos quais 1.723 nestes abrigos. Os resultados mostram melhor adaptação de Lutzomyia whitmani nas matas remanescentes no perímetro urbano de Maringá e sua freqüência nos abrigos dos animais silvestres mantidos em cativeiro.The present study was undertaken after the detection of one case of cutaneous leishmaniasis with presumed infection in one of the three remaining wooded areas in the urban area of the city of Maringá, Southern Brazil; also in view of the lack of knowledge about sand flies and their behavior. From June to September, 1995, sand flies were caught with Falcão traps during the night in the remaining wooded areas (Parque do Ingá, Bosque Dois and Horto Florestal. A total of 2,907 sand flies were caugth in Parque do Ingá; 1,723 of them were aught in forest traps and 1,184 in wild animal shelter traps at the zoo. The results show that Lutzomyia whitmani is better adapted to the three areas under study and that it frequently occurs in wild animal shelters within the urban perimeter of Maringá.
Directory of Open Access Journals (Sweden)
Paula Gomes Rodrigues
2011-10-01
Full Text Available Foi comparado o julgamento do escore de condição corporal (ECC com a espessura de gordura subcutânea (EGS e sua relação com a eficiência reprodutiva de éguas Mangalarga Marchador doadoras de embrião. O experimento foi conduzido com 56 éguas doadoras entre os meses de agosto/08 e abril/09. O ECC foi maior em éguas mais velhas e aumentou com os dias de permanência no experimento. Houve correlação positiva entre peso e tempo de experimento. O peso não foi associado à idade, porém aumentou ao longo do experimento. A EGS na região da cauda e entre a 12ª e 13ª costelas aumentou com a idade e diminuiu com os dias de permanência no experimento. Houve correlação positiva entre EGS e ECC para a cauda e costela. O diâmetro do folículo dominante aumentou ao longo do ciclo estral, e foi menor em éguas com ECC abaixo de 6,5. O diâmetro folicular não foi influenciado pela idade. O diâmetro médio do folículo ovulatório foi 38,43 ± 3,09 mm. A recuperação embrionária não foi afetada pela idade ou ECC, mas foi menor (41% eméguas que ovularam folículos menores que 40 mm quando comparados às que ovularam folículos maiores que 40 mm (59%. A idade da doadora não foi associada à taxa de gestação dos embriões nas receptoras. A gordura corporal afetou a eficiência reprodutiva das éguas, além disso, a ultrassonografia parece ser essencial para a avaliação precisa e correta do escore de condição corporal.Body condition scoring (BCS was compared to an ultrasound subcutaneous fat thickness (SFT determination in relation to the reproductive efficiency of Mangalarga Marchador embryo donor mares. Fifty six barren mares were studied throughout the 2008/2009 breeding season (August through April and the experiment was designed in a completely randomized scheme. BCS was higher in older mares and increased with time in the experiment, and there was a positive interaction between weight and time. Weight was not associated with age
Nagel, C; Ille, N; Erber, R; Aurich, C; Aurich, J
2015-10-01
Invasive procedures in animals are challenging for veterinary students who may perceive a gynaecological examination of mares as stressful. Simulator-based training may reduce stress. In this study, students received equine gynaecology training 4 times either on horses (group H; n = 14) or a teaching simulator (group SIM; n = 13). One day and 14 days thereafter, their diagnostic skills were tested on horses (skills tests 1 and 2). During the skills tests, the students' stress response was analysed by heart rate, heart rate variability (HRV) parameters SDRR (standard deviation of beat-to-beat [RR] interval) and RMSSD (root-mean-square of successive RR differences), and salivary cortisol. In addition, students answered a questionnaire on their perceived stress. Sympathetic activation with increased heart rate (p stress response. Subjective stress perception of students was higher in skills test 1 vs 2 (p stressed than SIM students (p stress parameters. In conclusion, gynaecological examination of mares evoked a moderate stress response in veterinary students, which was more evident after simulator-based than animal-based training. © 2015 Blackwell Verlag GmbH.
DEFF Research Database (Denmark)
Christoffersen, Mette; Woodward, Elizabeth; Bojesen, Anders Miki
2012-01-01
endometritis based on their endometrial histopathology and ability to clear an induced uterine inflammation. To investigate the effect of immunomodulatory therapy, the mares were inoculated with 10(5) colony forming units (CFU) Escherichia coli in three consecutive estrus cycles in a modified cross-over study...... inoculation. Endometrial biopsies were recovered 3, 24 and 72 h post inoculation. Relative gene-expression analyses were performed by quantitative reverse transcriptase PCR (qRT-PCR). Endometrial gene expression of inflammatory cytokines was modulated by administration of GC. Expression of proinflammatory...
Pre-foaling period in Trotter mares – 2: variations of protein fractions in pre-colostrum secretion
Directory of Open Access Journals (Sweden)
A. Falaschini
2010-01-01
Full Text Available Mare has a diffuse epitheliochorial placenta that does not allow the transplacental passage of maternal antibodies to the foetus. As a consequence, newly-born foals are immunologically dependent on the absorption of colostral maternal immunoglobulins (Ig. Therefore, the newborn foal should immediately suckle an adequate quantity of colostrum to reach an haematological IgG concentration of 400 mg/dl which prevent the occurrence of Failure of Passive Transfer (FPT, disease which can be fatal to the foal (Jeffcott, 1972; Curadi and Orlandi, 1998.
Directory of Open Access Journals (Sweden)
Lays Regina Andriucci
2007-07-01
Full Text Available Este artigo analisa o grau da influência termo-pluviométrica em algunsindicadores do comércio de Maringá, Estado do Paraná. Para isso foram estudados os elementos climáticos, temperatura e precipitação, bem como os indicadores econômicos: ICMS, SCPC, Vídeo-Cheque, Consumo e Consumidores de Energia Elétrica. Realizaramse análises gráficas, e aplicações estatísticas de correlação e regressão, bem como, o exame de um estudo de caso. Considera-se que os grupos investigados apresentaram variações nas formas de correlações. Os resultados apresentados neste trabalho possuem o caráter de testes preliminares por ser uma primeira tentativa de aproximação real entre as variáveis do clima (temperatura e precipitação com alguns indicadores do comportamento do comércio da cidade de Maringá.This article analyzes the degree of thermopluviometric influence on certain indicators in the commerce of Maringá, state of Paraná. To that end, climate elements, such as the temperature and precipitation as well as certain economic indicators, namely: ICMS (taxes, SCPC, Video-Check, Consumption and Consumers of Electric Energy were studied. Graphical analyses along with statistical applications of correlation and regression were performed, as well as the examination of a case study. It is believed that the groups investigated showed variations in the forms of correlation. The results herein presented are in the manner of a preliminary trial, representing a first attempt at measuring the actual relationship between the climaticvariables (temperature and precipitation with certain behavioral indicators of commerce in the city of Maringá.
Directory of Open Access Journals (Sweden)
Burhan OZTÜRK
2013-06-01
Full Text Available This study was carried out to determine the effects of pre-harvest aminoethoxyvinylglycine (AVG, 150, 225 ve 300 mg/L and naphthaleneacetic acid (NAA, 20 mg/L treatments in different doses on storage performance of ‘Ak Sakı’ apple cultivar (Malus domestica Borkh. in 2012. The changes on some fruit quality parameters were measured at 2±1 oC temperature and with 90±5 % relative humidity at 45 days interval during storage. The lowest weight loss was obtained from 300 mg/L AVG treated fruits during the storage. In the all analysis date, the highest L* value was obtained from 300 mg/L AVG treated fruits, and the lowest hue angle value was reported from the fruits of control treatment. The flesh firmness was determined that the best kept in the 225 and 300 mg/L AVG treated fruits during the storage. The flesh firmness significantly reduced with NAA treatment at the end of storage. The highest soluble solids concentration (SSC was obtain from control fruit during the storage, whereas the lowest SSC was observed in fruit treated with 300 mg/L AVG. In the all analysis date, the highest titratable acidity was obtained in fruits treated with 225 and 300 mg/L AVG. The starch degradation was delayed with AVG treatments.
Aerodynamic findings and Voice Handicap Index in Parkinson's disease.
Motta, Sergio; Cesari, Ugo; Paternoster, Mariano; Motta, Giovanni; Orefice, Giuseppe
2018-04-23
To verify possible relations between vocal disability and aerodynamic measures in selected Parkinson's disease (PD) patients with low/moderate-grade dysphonia. Fifteen idiopathic dysphonic PD male patients were examined and compared with 15 euphonic subjects. Testing included the following measures: Voice Handicap Index (VHI), maximum phonation time (MPT), mean estimated subglottal pressure (MESGP), mean sound pressure level (MSPL), mean phonatory power (MPP), mean phonatory efficiency (MPE) and mean phonatory resistance (MPR). Statistical analysis showed: a significant reduction in MPR and MSPL in PD subjects compared to the healthy ones; a significant positive correlation between VHI score and MSPL, MPR, MPP, MESGP and a significant negative correlation between VHI and MTP within PD subjects. Test for multiple linear regression showed a significant correlation between VHI score, MPT, MPR and MSPL. A relationship between VHI and aerodynamic measures was shown in the present study. Compensatory mechanisms may aggravate vocal disability in PD subjects.
[Voice disorders in female teachers assessed by Voice Handicap Index].
Niebudek-Bogusz, Ewa; Kuzańska, Anna; Woźnicka, Ewelina; Sliwińska-Kowalska, Mariola
2007-01-01
The aim of this study was to assess the application of Voice Handicap Index (VHI) in the diagnosis of occupational voice disorders in female teachers. The subjective assessment of voice by VHI was performed in fifty subjects with dysphonia diagnosed in laryngovideostroboscopic examination. The control group comprised 30 women whose jobs did not involve vocal effort. The results of the total VHI score and each of its subscales: functional, emotional and physical was significantly worse in the study group than in controls (p teachers estimated their own voice problems as a moderate disability, while 12% of them reported severe voice disability. However, all non-teachers assessed their voice problems as slight, their results ranged at the lowest level of VHI score. This study confirmed that VHI as a tool for self-assessment of voice can be a significant contribution to the diagnosis of occupational dysphonia.
Pizzigatti, Dietrich; Hussni, Carlos Alberto; Rodrigues, Celso Antonio; Watanabe, Marcos Jun; Moura Alonso, Juliana de; Vulcano, Luiz Carlos; Cisneros Álvarez, Luis Emiliano
2013-01-01
Subluxation of the proximal interphalangeal joint is a rare and little studied condition in horses. We describe the case of a 12-year-old mare with bilateral dorsal subluxation of the proximal interphalangeal joint of the hind feet. Tenectomy of the medial digital flexor was performed in both limbs, and the patient showed signs of recovery within 14 days. Goniometry of the proximal interphalangeal joints 10 months after surgery showed diminution of 5° for the proximal interphalangeal axis of ...
Aquatic macrophytes from Danube Delta lagoons Musura Bay and Zatonul Mare
Directory of Open Access Journals (Sweden)
Sava D.,
2016-05-01
Full Text Available The Romanian Danube Delta, a unique, young and continuing to grow region situated in the eastern part of Europe, is the largest continuous marshland and the second largest delta on the continent, and also a favorable place for developing a unique flora and fauna in Europe, with many rare and protected species. The predominance of the aquatic environment, led to the existence of a particular macrophytic flora. In this context, the purpose of this paper is to contribute to the study of aquatic macrophytes. The present study took place over two years, between 2013-2014, and in each year a number of expeditions were made in the two lagoons (Musura Bay and Zătonul Mare in different seasons, in order to observe the diverse flora, because, due to seasonal variation in water quality, there might be a significantly seasonality of the vegetation also.
Ramires, Thiago G; Nakamura, Luiz R; Righetto, Ana J; Ortega, Edwin M M; Cordeiro, Gauss M
2018-02-05
Renal insufficiency is a serious medical and public health problem worldwide. Recently, although many surveys have been developed to identify factors related to the lifetime of patients with renal insufficiency, controversial results from several studies suggest that researches should be conducted by region. Thus, in this study we aim to predict and identify factors associated with the lifetime of patients with chronic renal failure (CRF) in the metropolitan area of Maringá, Paraná State, Brazil, based on the generalized additive models for location, scale and shape (GAMLSS) framework. Data used in this study were collected from the Maringá Kidney Institute and comprehends 177 patients (classified with CRF and mostly being treated under the Brazilian Unified National Health System) enrolled in a hemodialysis program from 1978 up to 2010. By using this approach, we concluded that in other regions, gender, kidney transplant indicator, antibodies to hepatitis B and antibodies to hepatitis C are significant factors that affect the expected lifetime.
Directory of Open Access Journals (Sweden)
Thiago G. Ramires
2018-02-01
Full Text Available Renal insufficiency is a serious medical and public health problem worldwide. Recently, although many surveys have been developed to identify factors related to the lifetime of patients with renal insufficiency, controversial results from several studies suggest that researches should be conducted by region. Thus, in this study we aim to predict and identify factors associated with the lifetime of patients with chronic renal failure (CRF in the metropolitan area of Maringá, Paraná State, Brazil, based on the generalized additive models for location, scale and shape (GAMLSS framework. Data used in this study were collected from the Maringá Kidney Institute and comprehends 177 patients (classified with CRF and mostly being treated under the Brazilian Unified National Health System enrolled in a hemodialysis program from 1978 up to 2010. By using this approach, we concluded that in other regions, gender, kidney transplant indicator, antibodies to hepatitis B and antibodies to hepatitis C are significant factors that affect the expected lifetime.
Directory of Open Access Journals (Sweden)
Jadwiga TOPCZEWSKA
2012-01-01
Full Text Available The objective of the research was to determine the relationship between evaluation of conformation and motion indicators and results of the Huculs’ path and also to ascertain the courage (basic and elimination of Hucul horses with their classification into mare families being taken account of. The scores of 116 horses presented for the evaluation of their exterior (championship breeding were analyzed. The assessment covered the type, body conformation, movement in walk and trot as well as overall impression and preparedness for the exhibition. Measurements of length of steps, frequency and rate of the walk and trot were performed during the tests for courage. The estimated correlation coefficients exhibited the existence of some interesting trends i.e., there was positive correlation between values for type, body conformation, movement in walk and trot and the length of steps in walk and trot in individuals representing most of mare families. The reverse was the case with horses from the Sroczka and Wyderka families. Amongst the Wrona, however, negative correlations between the grade for walk and frequency of steps in walk was observed while that of between the result of path and utility tests was positive.
Directory of Open Access Journals (Sweden)
Taktaz Hafshejani Taghi
2016-11-01
Full Text Available Escherichia coli are known as the most common cause of reproductive tract infection in mare. Due to the progressive process of antibiotics use and increasing prevalence of antibiotic resistance, the aim of this study is evaluate the prevalence of subclinical endometritis and antibiotic resistance genes in Escherichia coli isolated. In this study, 60 mares were used with infertility background. Diagnosis of endometritis was performed using history and ultrasonography. Cytology, culture, Antibiogram were done of samples and PCR test was used to examine the gene virulence and antibiotic resistance. E-coli bacteria was isolated 48/33 % from sample culture. In PCR test 66/21 % of bacteria had virulence gene. It was determined, the lowest resistance to chloramphenicol about 38/15% and greatest resistance into ampicillin, tetracycline and streptomycin with 23/69 percent, respectively. 93% samples cytology had neutrophil more than two and the agent of 50% showed E. coli. The cause of half of subclinical endometritis in infertile maresis E-coli bacteriaEscherichia coli are known as the most common cause of reproductive tract infection in mare. Due to the progressive process of antibiotics use and increasing prevalence of antibiotic resistance, the aim of this study is evaluate the prevalence of subclinical endometritis and antibiotic resistance genes in Escherichia coli isolated. In this study, 60 mares were used with infertility background. Diagnosis of endometritis was performed using history and ultrasonography. Cytology, culture, Antibiogram were done of samples and PCR test was used to examine the gene virulence and antibiotic resistance. E-coli bacteria was isolated 48/33 % from sample culture. In PCR test 66/21 % of bacteria had virulence gene. It was determined, the lowest resistance to chloramphenicol about 38/15% and greatest resistance into ampicillin, tetracycline and streptomycin with 23/69 percent, respectively. 93% samples cytology had
SEDIMENTS POLLUTION WITH HEAVY METALS. CASE STUDY: BAIA MARE MINING AREA.
Directory of Open Access Journals (Sweden)
PIŞTEA IOANA
2015-03-01
Full Text Available The purpose of this research was to assess the degree of sediments contamination with heavy metals. In December 2013, 8 sediments samples were collected from several areas from Baia Mare. Each of the collected sediment samples was analyzed for pH, redox potential (ORP, electrical conductivity (EC, total dissolved solids (TDS and salinity with a portable multiparameter (WTW 3210i. In laboratory, using an ICP-OES, all the sediment samples were analyzed for iron (Fe, nickel (Ni, chromium (Cr, cobalt (Co, copper (Cu, zinc (Zn, cadmium (Cd, lead (Pb, and manganese (Mn.According to Romanian legislation the level of Cd, Cu, Pb and Zn exceeded the maximum permissible limit (0.8 mg/kg, 40 mg/kg, 85 mg/kg and 150 mg/kg.Heavy metals are not removed from aquatic ecosystem by self purification and they can accumulate in suspanded particulates and sediments, as a consequence they are a real threath for the human health and ecosystem via food chain accumulation.
Specificity of Structural Assessment of Knowledge
Trumpower, David L.; Sharara, Harold; Goldsmith, Timothy E.
2010-01-01
This study examines the specificity of information provided by structural assessment of knowledge (SAK). SAK is a technique which uses the Pathfinder scaling algorithm to transform ratings of concept relatedness into network representations (PFnets) of individuals' knowledge. Inferences about individuals' overall domain knowledge based on the…
Directory of Open Access Journals (Sweden)
Jéssica Carvalho de Matos
2010-06-01
Full Text Available The aim of this study was to identify the prevalence of the risk factors for breast cancer among women between 40 and 69 years old in the city of Maringá, Paraná State, Brazil. An analytical, exploratory and cross-sectional study was carried out through a population research at homes in Maringá. The sample was composed of 439 women between 40 and 69 years old. The data were collected by home interviews, stored using the Statistical Package for the Social Sciences (SPSS software and presented in tables as absolute and relative frequency. The predominant ethnical group was Caucasian with an average age of 52 years. Among risk factors identified in the present study, an expressive number of overweight women were found. It is important and necessary to put in practice actions that identify the modifiable risk factors for the development of breast tumors in order to reduce morbidity and mortality levels due to this pathology.Ese estudio pretendió identificar la prevalencia de los factores de riesgo para el cáncer de mama en mujeres de 40 la 69 años, en el municipio de Maringá. Fue realizado un estudio analítico, exploratorio, de corte transversal, tipo encuesta poblacional domiciliar. El estudio fue realizado con 439 mujeres entre 40 y 69 años. Los datos fueron recolectados durante entrevistas domiciliares, almacenados en el programa Statisitical Package for the Social Sciences (SPSS y presentados en forma de frecuencia absoluta y relativa. La mayor parte de las mujeres estudiadas pertenecía a la raza blanca, con promedio de edad de 52 años. Entre los factores de riesgo identificados se destaca el gran número de mujeres con sobrepeso. Se resalta la importancia de la implementación de acciones que tengan por objetivo identificar los factores de riesgo modificables para el desarrollo del cáncer de mama para, con eso, disminuir el número de nuevos casos y de muerte por esa patología.Esse estudo pretendeu identificar a prevalência dos
Dysphonia in nursing home and assisted living residents: prevalence and association with frailty.
G Nichols, Brent; Varadarajan, Varun; Bock, Jonathan M; Blumin, Joel H
2015-01-01
Previous studies of geriatric dysphonia prevalence have been limited to ambulatory outpatient and senior communities. Our goal was to identify prevalence of dysphonia in nursing home residents and assisted living residents and search for correlations between indices of dysphonia and indices of frailty. Prospective epidemiological survey. Residents of a vertically integrated senior care organization who were 65 or older and able to understand and complete the questionnaire were recruited to complete the voice handicap index 10 (VHI-10) to assess for dysphonia (VHI-10 > 10 = dysphonia) and Vulnerable Elders Survey 13 (VES-13), a validated instrument to assess for frailty (VES > 3 = frailty). A total of 119 residents were surveyed. Thirty-three percent of nursing home residents, and 25% of assisted living residents reported dysphonia with 29% of all respondents reporting dysphonia. The mean VHI-10 was 7.4, the median was 5, and the interquartile range was 2-12.5. There was a significant relationship between VHI-10 and VES-13 score (P = 0.029). There were no statistically significant relationships between frailty, age, or type of living and dysphonia or VHI-10. There is a high prevalence of voice dysfunction in assisted living and nursing home residents. The correlation between VHI-10 and VES-13 suggests that voice declines as frailty increases. Copyright © 2015 The Voice Foundation. All rights reserved.
Directory of Open Access Journals (Sweden)
Alberto Saturno Madureira
2008-06-01
Full Text Available The aim of this study to analyse the occurrence of injuries in undergraduates of the Physical Education Course at the State University of Maringá. Types of injuries were diagnosed, the opinion of students and professors with regard to their probable causes was taken and the factors that could render injuries less damaging were identified. Research was carried out in the second semester of 1991 when 231 students were regularly enlisted. Data were collected by means of questionnaires for professors and for students. Forty injury cases were verified, 13 with males and 27 with females. The most common type of injury was bruises (55% followed by strain (18%. The inferior members were the most affected region. Judo was the subject in which the greatest number of injuries occurred. Students stated that salient probable causes were: agressivity of colleages in practical exercises (33% and defective sports facilities (25%. In the professors opinion, however, the two chief causes were: students’ distraction (20% and physical inability (20%. The establishment of an Internal Commission for the Prevention of Accidents has been suggested made up of professors, under graduate students and personnel of the Physical Education Department at the State University of Maringá. Its aims are to carry out a following up of this situation, to promote the prevention of injuries and to suggest possible improvements in the premises.
Fotografia religiosa: a leitura de imagens na história da Diocese de Maringá
Directory of Open Access Journals (Sweden)
Selson Garutti
2011-01-01
Full Text Available This study comprises reading photos specifically referring to the episcopate in religious photos of Dom Jaime Luiz Coelho, 1st Bishop of the Diocese of Maringá, in Paraná State, the Catholic bishops¿ period which lasted for 40 years, from 1957 to 1997. Based on acquits consists of multiple images, analyzed four categories of photographs: ecclesiastical architecture, episcopate, activities and ecclesiastical body. Noting the discourse about the Church, the social context and their relations revealed by captured images. The text also highlights the relevance of the iconographic documentation for the study of ecclesiastical history, in particular, the study of ecclesiastical institution established in the city of Maringa.
PROBIOTIC POTENCY OF LACTOBACILLUS SPP. ISOLATED FROM SUMBAWA MARE MILK
Directory of Open Access Journals (Sweden)
I Nengah Sujaya
2008-03-01
Full Text Available This research was deigned to elucidate the potency of Lactobacillus spp. isolated from sumbawa mare milk to be developed as a probiotic. Sixteen lacobacilli were screened based on their resitancy to a model of gastric juice at pH 2, 3, and 4, then followed by their resistncy to small intestional fluid model containing deoxycholic. Three lactobacilli i.e. Lactobacillus sp. SKA13, Lactobacillus rhamnosus SKG34 and Lactobacillus rhamnosus SKG49 were found to be resistentent to gastric juice at pH 3 and 4. However, there were no lactobacilli resisted to pH 2. Lactobacillus rhamnosus SKG34 and Lactobacillus rhamnosus SKG49 were able to reach the colon even after being expossed to a model of intestinal fluid containing 0,4 mM deoxycholate and pancreatine. Therefore, these isolates have a potency to be developed as probiotic lactobacilli. Nevertherless, these lactobcailli could probably transform cholic acid into secondary bile acids, which were not expected to be found in the probiotic, and this capability is not appropriate for probiotic. This character is worthly to be studied since it has never been reported in lactobacilli.
Rock spatial densities on the rims of the Tycho secondary craters in Mare Nectaris
Basilevsky, A. T.; Michael, G. G.; Kozlova, N. A.
2018-04-01
The aim of this work is to check whether the technique of estimation of age of small lunar craters based on spatial density of rock boulders on their rims described in Basilevsky et al. (2013, 2015b) and Li et al. (2017) for the craters rock counts on the rims of four craters having diameters 1000, 1100, 1240 and 1400 m located in Mare Nectaris. These craters are secondaries of the primary crater Tycho, whose age was found to be 109 ± 4 Ma (Stoffler and Ryder, 2001) so this may be taken as the age of the four craters, too. Using the dependence of the rock spatial densities at the crater rims on the crater age for the case of mare craters (Li et al., 2017) our measured rock densities correspond to ages from ∼100 to 130 Ma. These estimates are reasonably close to the given age of the primary crater Tycho. This, in turn, suggests that this technique of crater age estimation is applicable to craters up to ∼1.5 km in diameter. For the four considered craters we also measured their depth/diameter ratios and the maximum angles of the crater inner slopes. For the considered craters it was found that with increasing crater diameter, the depth/diameter ratios and maximum angles of internal slopes increase, but the values of these parameters for specific craters may deviate significantly from the general trends. The deviations probably result from some dissimilarities in the primary crater geometries, that may be due to crater to crater differences in characteristics of impactors (e.g., in their bulk densities) and/or differences in the mechanical properties of the target. It may be possible to find secondaries of crater Tycho in the South pole area and, if so, they may be studied to check the specifics and rates of the rock boulder degradation in the lunar polar environment.
Lorenz, Ralph D.; Tokano, Tetsuya; Newman, Claire E.
2012-01-01
We use two independent General Circulation Models (GCMs) to estimate surface winds at Titan’s Ligeia Mare (78° N, 250° W), motivated by a proposed mission to land a floating capsule in this ∼500 km hydrocarbon sea. The models agree on the overall magnitude (∼0.5-1 m/s) and seasonal variation (strongest in summer) of windspeeds, but details of seasonal and diurnal variation of windspeed and direction differ somewhat, with the role of surface exchanges being more significant than that of gravitational tides in the atmosphere. We also investigate the tidal dynamics in the sea using a numerical ocean dynamics model: assuming a rigid lithosphere, the tidal amplitude is up to ∼0.8 m. Tidal currents are overall proportional to the reciprocal of depth-with an assumed central depth of 300 m, the characteristic tidal currents are ∼1 cm/s, with notable motions being a slosh between Ligeia’s eastern and western lobes, and a clockwise flow pattern. We find that a capsule will drift at approximately one tenth of the windspeed, unless measures are adopted to augment the drag areas above or below the waterline. Thus motion of a floating capsule is dominated by the wind, and is likely to be several km per Earth day, a rate that will be readily measured from Earth by radio navigation methods. In some instances, the wind vector rotates diurnally such that the drift trajectory is epicyclic.
Climate services for an urban area (Baia Mare City, Romania) with a focus on climate extremes
Sima, Mihaela; Micu, Dana; Dragota, Carmen-Sofia; Mihalache, Sorin
2013-04-01
The Baia Mare Urban System is located in the north-western part of Romania, with around 200,000 inhabitants and represents one of the most important former mining areas in the country, whose socioeconomic profile and environmental conditions have greatly changed over the last 20 years during the transition and post-transition period. Currently the mining is closed in the area, but the historical legacy of this activity has implications in terms of economic growth, social and cultural developments and environmental quality. Baia Mare city lies in an extended depression, particularly sheltered by the mountain and hilly regions located in the north and respectively, in the south-south-eastern part of it, which explains the high frequency of calm conditions and low airstream channeling occurrences. This urban system has a typically moderate temperate-continental climate, subject to frequent westerly airflows (moist), which moderate the thermal regime (without depicting severe extremes, both positive and negative) and enhance the precipitation one (entailing a greater frequency of wet extremes). During the reference period (1971-2000), the climate change signal in the area is rather weak and not statistically significant. However, since the mid 1980s, the warming signal became more evident from the observational data (Baia Mare station), showing a higher frequency of dry spells and positive extremes. The modelling experiments covering the 2021-2050 time horizon using regional (RM5.1/HadRM3Q0/RCA3) and global (ARPEGE/HadCM3Q0/BCM/ECHAM5) circulation models carried out within the ECLISE FP7 project suggest an ongoing temperature rise, associated to an intensification of temperature and precipitation extremes. In this context, the aim of this study was to evaluate how the local authorities consider and include climate change in their activity, as well as in the development plans (e.g. territorial, economic and social development plans). Individual interviews have been
Kivimaa, Katrin, 1969-
2007-01-01
Mare Tralla kunstnikuteest 1990-ndatel performance'i- ja videokunstniku, feministi ning kuraatorina. Tema kunsti iseloomustab ühiskonnakriitika ja eneseirooniline nostalgia ning "väike feministllik revolutsioon ühiskonna harmoonilisema ja õiglasema arengu tarvis". Alates 1996. aastast elab ja tegutseb peamiselt Londonis
Pieters, C.
1977-01-01
The types of basal to be found on the moon were identified using reflectance spectra from a variety of lunar mare surfaces and craters as well as geochemical interpretations of laboratory measurements of reflectance from lunar, terrestrial, and meteoritic samples. Findings indicate that major basaltic units are not represented in lunar sample collections. The existence of late stage high titanium basalts is confirmed. All maria contain lateral variations of compositionally heterogenous basalts; some are vertically inhomogenous with distinctly different subsurface composition. Some basalt types are spectrally gradational, suggesting minor variations in composition. Mineral components of unsampled units can be defined if spectra are obtained with sufficient spectral coverage (.3 to 2.5 micron m) and spatial resolution (approximating .5 km).
Buff, P R; Messer, N T; Cogswell, A M; Johnson, P J; Keisler, D H; Ganjam, V K
2007-11-01
The objective of this study was to determine if seasonal and/or pulsatile variations occur in plasma concentrations of thyrotropin (TSH) and leptin in mares while maintaining a constant energy balance. Blood samples were collected every 20 min during a 24h period in winter and again in summer from six Quarter Horse type mares. Plasma concentrations of TSH, leptin, and T(4) were determined by radioimmunoassay. No differences were observed in body weight between winter (388.1+/-12.5 kg) and summer (406.2+/-12.5 kg; P=0.11). Plasma concentrations of TSH were greater in the summer (2.80+/-0.07 ng/ml) when compared to winter (0.97+/-0.07 ng/ml; P<0.001). Pulse frequency of TSH was not different between winter (6.17+/-0.78 pulses/24h) and summer (5.33+/-0.78 pulses/24h; P=0.49). Mean TSH pulse amplitude, pulse area, and area under the curve were all greater in summer compared to winter (3.11+/-0.10 ng/ml versus 1.20+/-0.10 ng/ml, 24.86+/-0.10 ng/ml min versus 13.46+/-1.90 ng/ml min, 3936+/-72.93 ng/ml versus 1284+/-72.93 ng/ml, respectively; P<0.01). Mean concentrations of leptin were greater in summer (2.48+/-0.17 ng/ml) compared to winter (0.65+/-0.17 ng/ml; P<0.001). Pulsatile secretion patterns of leptin were not observed in any horses during experimentation. Mean concentrations of T(4) were greater in winter (20.3+/-0.4 ng/ml) compared to summer (18.2+/-0.4 ng/ml; P<0.001). These seasonal differences between winter and summer provide evidence of possible seasonal regulation of TSH and leptin.
Reyes, Guadalupe; Romans, Angela; Nguyen, C Kim; May, Gregory S
2006-11-01
The genome of Aspergillus fumigatus has four genes that encode mitogen-activated protein kinases (MAPKs), sakA/hogA, mpkA, mpkB, and mpkC. The functions of the MpkB and MpkC MAPKs are unknown for A. fumigatus and the closely related and genetically amenable species Aspergillus nidulans. mpkC deletion mutants of A. fumigatus were made and their phenotypes characterized. The mpkC deletion mutants were viable and had normal conidial germination and hyphal growth on minimal or complete media. This is in contrast to deletion mutants with deletions in the closely related MAPK gene sakA/hogA that we previously reported had a nitrogen source-dependent germination phenotype. Similarly, the growth of the mpkC deletion mutants was wild type on high-osmolarity medium. Consistent with these two MAP kinase genes regulating different cellular responses, we determined that the mpkC deletion mutants were unable to grow on minimal medium with sorbitol or mannitol as the sole carbon source. This result implicates MpkC signaling in carbon source utilization. Changes in mRNA levels for sakA and mpkC were measured in response to hypertonic stress, oxidative stress, and a shift from glucose to sorbitol to determine if there was overlap in the SakA and MpkC signaling pathways. These studies demonstrated that SakA- and MpkC-dependent patterns of change in mRNA levels are distinct and have minimal overlap in response to these environmental stresses.
Directory of Open Access Journals (Sweden)
Mauro Porcu
2002-04-01
Full Text Available This paper aims to verify the prevalence of depressive symptoms in the seniors’ population, over 60 years, in a PSF restricted area, district of Maringá - PR. An oblique study was accomplished using Beck’s Inventory for Depression. From a population of 451 individuals, a sample of 123 people were analyzed (27,3% of the total. Results were the following: 1 average age ≅ 69 ± 8 years; 2 dysphoria: 15.1% for men and 17.2% for women (p=0,7590; depression: 34% for men and 37.7% for women (p=0,6942; 3 the depression prevalence was 4.8 times higher than the Brazilian population and 2.1 times of the American seniors. It was concluded that the depressive symptoms were very high in the seniors’ sample studies of a PSF areaVerificar a prevalência da sintomatologia depressiva na população de idosos com idade superior a 60 anos, numa área adstrita do PSF, no município de Maringá, Estado do Paraná. Foi realizado um estudo transversal, utilizando o Inventário para Depressão de Beck. A população estudada foi de 451 indivíduos, da qual foi utilizada uma amostra de 123 pessoas correspondendo a 27,3% do total. Obtiveram-se os seguintes resultados: 1 idade média ≅ 69 ± 8 anos; 2 disforia: 15,1% dos homens e 17,2% das mulheres (p = 0,7590; depressão: 34% dos homens e 37,7% das mulheres (p = 0,6942; 3 a prevalência de “depressão” foi 4,8 vezes maior que a população brasileira e 2,1 vezes a dos idosos americanos. Assim, a sintomatologia depressiva foi altamente prevalente na amostra de idosos estudada, de uma área de PSF
Niebudek-Bogusz, Ewa; Kuzańska, Anna; Błoch, Piotr; Domańska, Maja; Woźnicka, Ewelina; Politański, Piotr; Sliwińska-Kowalska, Mariola
2007-01-01
The aim of this study was to assess the applicability of Voice Handicap Index (VHI) to the evaluation of effectiveness of functional voice disorders treatment in teachers. The subjects were 45 female teachers with functional dysphonia who evaluated their voice problems according to the subjective VHI scale before and after phoniatric management. Group I (29 patients) were subjected to vocal training, whereas group II (16 patients) received only voice hygiene instructions. The results demonstrated that differences in the mean VHI score before and after phoniatric treatment were significantly higher in group 1 than in group II (p teacher's dysphonia.
Plants and pollinating bees in Maringá, State of Paraná, Brazil
Directory of Open Access Journals (Sweden)
Toledo Vagner de Alencar Arnaut de
2003-01-01
Full Text Available The present study was carried out to survey the bees as visitors to melliferous flora in the region of Maringá, state of Paraná, Brazil. A total of 331 insects were captured, and the fauna comprised 39.88% Trigona spinipes, 38.37% Apis mellifera, 8.16% Tetragonisca angustula, 3.93% Halictidae, 1.21% Megachilidae, 2.42% Anthophoridae, and 3.32% other Hymenoptera. Eleven plant species from nine families were observed. The four families most frequently visited by A. mellifera were Pontederiaceae (93.53%, Sterculiaceae and Polygoniaceae (47.22%, Apocynaceae and Apiaceae (42.86%. The families most visited by T. spinipes were Lamiaceae (64.70%, Apocynaceae (57.14%, Sterculiaceae (51.85% and Anacardiaceae (48.39%, and the families most visited by T. angustula were (28.57%, Asteraceae (22.22% and Labiatae (16.47%. Three species predominated in number of bee visits Dombeya wallichii (32.63%, Ocimum americanum (15.5% and Antigonon leptopus (15.2%. T. angustula was the most frequent visitor of O. gratissimum flowers (60.87%.
2012-04-05
Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6110--12-9397 2011 ESTCP Live Site Demonstrations Vallejo , CA ESTCP MR-1165 Demonstration...b. ABSTRACT c. THIS PAGE 18. NUMBER OF PAGES 17. LIMITATION OF ABSTRACT 2011 ESTCP Live Site Demonstrations Vallejo , CA ESTCP MR-1165 Demonstration...Hertz IVS Instrument Verification Strip (f)MINSY (former) Mare Island Naval Shipyard, located in Vallejo , CA MR Munitions Response MTADS Multi-sensor
Directory of Open Access Journals (Sweden)
Cibele Abdo Rodella
2011-08-01
Full Text Available Guided by the methodological perspective of analytical deconstruction, this work analyses photographic images from Maringa´s Prefecture press advisory. It seeks to answer to the following question: What strategies of senses do the photographic images build in the press advisement? In this attempt, it aims to: 1 To conceptualize the aspect of communicational intentionality; 2 To infer about its use on press advisory services; 3 To analyze if formats and genres of photographic image in journalism remain in the press advisory body. As a discourse, the photographic image in the press advisory body aims to build positive senses for the advised. In this case, with technical and photographic language domain, photojournalists intent to build elements, objects and characters to build up concepts, values and positive representation of the advised. For analysis of the photojournalists’ intentionality, they were used photographs taken from the site of the press advisory body of Maringá (PR Prefecture, referring to several articles.
Directory of Open Access Journals (Sweden)
Marcus Eduardo Kamide Gonçalves
2011-02-01
Full Text Available The increase in consumption of water, the destruction of riparian forests and the pollution caused by humans, have severely degraded several water resources. Numerous stream crisscross the city of Maringá, Paraná state, Brazil and most of their sources are scattered through the urban region. Current analysis assesses the cytotoxic potential of water from the Corregozinho, Isalto, Morangueira and Ozório streams, located within the high-populated northeastern region of Maringá, inside the urban perimeter. Root meristematic cells of Allium cepa were used as test-system. The roots of onion were prepared by Feulgen’s reaction and stained with Schiff's reagent. Results showed that there were no statistically significant changes evaluated by the chi-square test on the rates of cell division in cells of Allium cepa roots treated with the water of the streams when compared to data from controls. However, further analyses should be undertaken at different times for a periodic assessment of conditions in the streams, coupled with an awareness of the population on the environment.The increase in consumption of water, the destruction of riparian forests and the pollution caused by humans, have severely degraded several water resources. Numerous stream crisscross the city of Maringá, Paraná state, Brazil and most of their sources are scattered through the urban region. Current analysis assesses the cytotoxic potential of water from the Corregozinho, Isalto, Morangueira and Ozório streams, located within the high-populated northeastern region of Maringá, inside the urban perimeter. Root meristematic cells of Allium cepa were used as test-system. The roots of onion were prepared by Feulgen’s reaction and stained with Schiff's reagent. Results showed that there were no statistically significant changes evaluated by the chi-square test on the rates of cell division in cells of Allium cepa roots treated with the water of the streams when compared to
Wang, Jicheng; Li, Changkun; Xue, Jiangang; Yang, Jie; Zhang, Qing; Zhang, Heping; Chen, Yongfu
2015-06-01
Lactobacillus helveticus isolate H9 demonstrated high angiotensin I-converting enzyme (ACE)-inhibitory activity in previous research. Here, we evaluated the fermentation characteristics (pH, titratable acidity, free amino nitrogen, and viable bacterial counts), ACE-inhibitory activity, and contents of Val-Pro-Pro (VPP) and Ile-Pro-Pro (IPP) peptides of stored yogurt (4°C for 28 d) fermented by L. helveticus isolate H9 (initially inoculated at 4 concentrations), from cow, mare, and soy milks. During storage, the pH and titratable acidity remained stable in yogurts produced from all milk types and all inoculation concentrations. The viable bacterial counts in all stored yogurts ranged between 10(6.72) and 10(8.59) cfu/g. The highest ACE-inhibitory activity (70.9-74.5%) was achieved at inoculation concentrations of 5×10(6) cfu/mL. The ACE-inhibitory tripeptides VPP and IPP as determined by ultra-performance liquid chromatography-tandem mass spectrometry were not produced in yogurt made from soy milk or mare milk. These evaluations indicate that L. helveticus H9 has good probiotic properties and would be a promising candidate for production of fermented food with probiotic properties. Copyright © 2015 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
Medical loss ratio as a potential regulatory tool in the Israeli healthcare system.
Simon-Tuval, Tzahit; Horev, Tuvia; Kaplan, Giora
2015-01-01
The growth of the private health insurance sector in Western countries, which is characterized by information deficiencies and limited competition, necessitates the implementation of effective regulatory tools. One measure which is widely used is the medical loss ratio (MLR). Our objective was to analyze how MLR is applied as a regulatory measure in the Israeli voluntary health insurance (VHI) market in order to promote the protection of beneficiaries. The study will examine MLR values and the use of this tool by regulators of VHI in Israel. Descriptive analysis using 2005-2012 data from public reports of the Ministry of Health and the Ministry of Finance on VHI plans in three market segments: nonprofit health plans, group (collective) policies offered by commercial insurance companies and individual policies offered by commercial insurance companies. In 2012, 74% of the Israeli population owned VHI provided by nonprofit health plans and 43% owned VHI offered by for-profit commercial companies. At that time the MLRs of three nonprofit health plans were significantly lower than 80%, mostly in the upper layers of coverage. The MLR in the individual commercial segment was consistently low (38% in 2012). The use of MLR as a regulation tool was, and continues to be, relatively limited in all segments. The VHI in Israel covers several essential services that are not covered by the statutory benefits package as a result of budget constraints. Thus, due to the high penetration rate of VHI in Israel compared to European countries and the lower levels of MLR, in order to assure the protection of beneficiaries it may be warranted to increase the extent of regulation and adjust it to the nature of the services covered. This may include distinguishing between essential and nonessential coverages and implementation of the most suitable regulatory measures (such as an MLR threshold, limitation of services covered and adjusting the actuarial models to the beneficiaries' behavior
van der Sluis, L.G.; Hollund, H.I.; Buckley, M.; de Louw, P.G.B.; Rijsdijk, K.F.; Kars, H.
2014-01-01
Taphonomic research of bones can provide additional insight into a site's formation and development, the burial environment and ongoing post-mortem processes. A total of 30 tortoise (Cylindraspis) femur bone samples from the Mare aux Songes site (Mauritius) were studied histologically, assessing
Directory of Open Access Journals (Sweden)
Terezinha Inez Estivalet Svidzinski
2005-03-01
Full Text Available Onicomicoses são infecções fúngicas que atingem as unhas e acometem cerca de 30% da população. Recentemente tem sido relatado aumento dessas infecções e também alterações em sua etiologia. O objetivo deste estudo foi avaliar a freqüência das onicomicoses e perfil dos pacientes acometidos em Maringá, Estado do Paraná, Brasil. Entre janeiro de 1999 a junho de 2003 foram analisadas, no Laboratório de Micologia do Lepac (Laboratório de Ensino e Pesquisa em Análises Clínicas da Universidade Estadual de Maringá, um total de 435 amostras de pacientes com suspeita clínica de onicomicose. Destas amostras 74,25% (N = 323 foram positivas, sendo 15,48% confirmadas por exame direto (N=50, 20,43% exclusivamente por cultura (N=66 e 64,09% por exame direto e cultura (N=207. As mulheres foram mais afetadas que os homens (72,67% e 27,33%, respectivamente, e a maior prevalência foi em indivíduos com mais de 40 anos. As unhas dos pés foram mais acometidas que as unhas das mãos (65,90% e 34,10%, respectivamente. Os agentes etiológicos mais freqüentes foram as leveduras (52,17% isoladas especialmente das unhas das mãos. Os fungos filamentosos foram prevalentes nas unhas dos pés, destacando-se os dermatófitos responsáveis por 33,85% das onicomicoses e os não dermatófitos (FFND por 13,97%Onychomycosis are fungal infections that reach the nails and affect about 30% of the population. Recently has been observed increase of these infections and also alterations in its etiology. The objective of this study was to evaluate the frequency of these mycosis and profile of the patients attacked in Maringá, Paraná State, Brazil. Between January 1999 to June 2003 were analyzed at the Mycological Laboratory from the Teaching and Research Laboratory in Clinical Analyses (Lepac a total of 435 samples of patients with clinical symptoms of onychomycoses. Of those samples 74,25% (N=323, were positive, being 15,48% confirmed by direct examination (N=50
Reyes, Guadalupe; Romans, Angela; Nguyen, C. Kim; May, Gregory S.
2006-01-01
The genome of Aspergillus fumigatus has four genes that encode mitogen-activated protein kinases (MAPKs), sakA/hogA, mpkA, mpkB, and mpkC. The functions of the MpkB and MpkC MAPKs are unknown for A. fumigatus and the closely related and genetically amenable species Aspergillus nidulans. mpkC deletion mutants of A. fumigatus were made and their phenotypes characterized. The mpkC deletion mutants were viable and had normal conidial germination and hyphal growth on minimal or complete media. This is in contrast to deletion mutants with deletions in the closely related MAPK gene sakA/hogA that we previously reported had a nitrogen source-dependent germination phenotype. Similarly, the growth of the mpkC deletion mutants was wild type on high-osmolarity medium. Consistent with these two MAP kinase genes regulating different cellular responses, we determined that the mpkC deletion mutants were unable to grow on minimal medium with sorbitol or mannitol as the sole carbon source. This result implicates MpkC signaling in carbon source utilization. Changes in mRNA levels for sakA and mpkC were measured in response to hypertonic stress, oxidative stress, and a shift from glucose to sorbitol to determine if there was overlap in the SakA and MpkC signaling pathways. These studies demonstrated that SakA- and MpkC-dependent patterns of change in mRNA levels are distinct and have minimal overlap in response to these environmental stresses. PMID:16998074
Directory of Open Access Journals (Sweden)
Gheorghe ROŞIAN
2011-04-01
Full Text Available Settlements and thoroughfares positioning in hilly terrains, fragmented by valleys, as in the Târnava Mare Corridor case, is influenced by the value of morphological parameters. The variety of the relief, as extension and altitude, determines a specific distribution of the resources offered by the other geographic components. This directs to the anthropic component adaptation to local conditions, action expressed by capitalizing the favorable areas and avoiding the restrictive ones.
Patient-reported symptom questionnaires in laryngeal cancer: voice, speech and swallowing.
Rinkel, R N P M; Verdonck-de Leeuw, I M; van den Brakel, N; de Bree, R; Eerenstein, S E J; Aaronson, N; Leemans, C R
2014-08-01
To validate questionnaires on voice, speech, and swallowing among laryngeal cancer patients, to assess the need for and use of rehabilitation services, and to determine the association between voice, speech, and swallowing problems, and quality of life and distress. Laryngeal cancer patients at least three months post-treatment completed the VHI (voice), SHI (speech), SWAL-QOL (swallowing), EORTC QLQ-C30, QLQ-HN35, HADS, and study-specific questions on rehabilitation. Eighty-eight patients and 110 healthy controls participated. Cut off scores of 15, 6, and 14 were defined for the VHI, SHI, and SWAL-QOL (sensitivity > 90%; specificity > 80%). Based on these scores, 56% of the patients reported voice, 63% speech, and 54% swallowing problems. VHI, SHI, and SWAL-QOL scores were associated significantly with quality of life (EORTC QLQ-C30 global quality of life scale) (r = .43 (VHI and SHI) and r = .46 (SWAL-QOL)) and distress (r = .50 (VHI and SHI) and r = .58 (SWAL-QOL)). In retrospect, 32% of the patients indicated the need for rehabilitation at time of treatment, and 81% of these patients availed themselves of such services. Post-treatment, 8% of the patients expressed a need for rehabilitation, and 20% of these patients actually made use of such services. Psychometric characteristics of the VHI, SHI, and SWAL-QOL in laryngeal cancer patients are good. The prevalence of voice, speech, and swallowing problems is high, and clearly related to quality of life and distress. Although higher during than after treatment, the perceived need for and use of rehabilitation services is limited. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Lembrechts, J.F.M.M.; Pruppers, M.J.M.
1993-12-01
In this report the position of the Veterinary Public Health Service (VHI), which is part of the Ministry of Welfare, Health and Cultural Affairs, within the National Organisation for Nuclear Emergency Planning and Response (NPK), is evaluated. NPK is activated in case of nuclear accidents in order to describe and model the evolution of the environmental contamination, to advise on countermeasures and to supervise their application and effects. Within this organisation VHI has to organize or execute measurements on animals and veterinary products and to coordinate countermeasures pertaining to their field of work. The suggestion is made to integrate the tasks of VHI and those of the Inspectorate for Health Protection (IGB) and to attune the activities of VHI and those of the State Institute for Quality Control of Agricultural Products (RIKILIT). Advices are given on how to detail the tasks of VHI adequately in the context of NPK, amongst others by describing methods to collect and interpret data. It is suggested to firstly put into practice in vivo monitoring techniques for '3'I and 134 Cs/ 137 Cs and to agree with other institutions on plans for sampling, sample preparation and measurements of milk. Finally a monitoring strategy for VHI is broadly outlined. It provides the framework for the definition of a detailed programme on sampling and measurement in case of a real accident. The monitoring strategy gives answers on the crucial question 'what has to be measured why and how by which person'. Since questions on where, when and how frequently measurements have to made should be tailored to the actual emergency situation, they are not dealt with in this report. 5 figs., 5 tabs., 66 refs
Directory of Open Access Journals (Sweden)
VICTOR SOROCOVSCHI
2015-05-01
Full Text Available Seasonal discharge regime of the rivers in the Transylvanian Subcarpathians and the adjacent mountainous space between Târnava Mare and Niraj. The studied region is situated in the North-East of the Transylvanian Depression and includes two distinct units: the Transylvanian Subcarpathians and the Moldavo-Transylvanian Carpathians, comprised between the valleys of Târnava Mare and Niraj. The study is based upon the processing and interpretation of data coming from 13 hydrometric stations. In order to emphasize the particuliarities of the seasonal discharge regime, we took into account three periods (1950-1967, 1950-2009 and 1970-2009. The characteristics of the geographic coating from the studied area, especially the climatic and geomorphic ones, are clearly reflected in the discharge regime of river waters. Thus, on all rivers, spring discharge is predominant, and winter and autumn are the seasons with the lowest weight of the multiannual average volume. We have underlined the particuliarities of the three subtypes of seasonal regime and we have defined the limits of the corresponding display areas. The variation of the seasonal discharge on a multiannual level was outlined with the help of variation coefficients. Likewise, we also determined the discharge tendencies for the three studied intervals. The analysis carried out has revealed the fact that the rhythmic structure of the hydric system reflects the local characteristics of the supplying sources, of geological, as well as morphological and morphometrical conditions of the relief.
Directory of Open Access Journals (Sweden)
Miguel Machinski Junior
2004-04-01
Full Text Available Os impactos de origem ambiental e ocupacional, relacionados ao uso de praguicidas, têm como alvo imediato a saúde coletiva, pois os resíduos liberados do ambiente ou remanescentes nas culturas estão sendo progressivamente transferidos para a água, para os alimentos e para o homem. Este trabalho teve como objetivo caracterizar a utilização de praguicidas por trabalhadores do setor agrícola, atendidos no Ambulatório de Toxicologia e Saúde do Trabalhador do Centro de Controle de Intoxicações de Maringá (CCI-Maringá, a fim de avaliar os impactos sobre o ambiente e a saúde dessa população. Durante o período de 2002 a 2003, foi realizado um estudo descritivo retrospectivo em vinte e cinco pacientes atendidos devido à intoxicação por praguicidas. Os resultados demonstraram que os praguicidas representam um importante risco à saúde da população estudada e ao meio ambiente.The environmental and occupational origin impacts concerning the use of pesticides have the public health as immediate target. The environment residues or remainders in the crops are being gradually transferred to water, food and human being. The purpose of this paper was to characterize the use of pesticides by agricultural workers in the outpatient’s attendance of the Toxicology and Worker Health Clinic of the Poisoning Control Center of Maringá (Brazil, in order to evaluate their impacts on the environment and on the population’s health. During the period 2002-2003, a retrospective descriptive study was carried out in twenty-five patients attended for pesticide poisoning. The results showed that the pesticides represent an important risk to the health of the studied population as well as to the environment.
SENSIBILITY OF MICROCULTIVATION ASSAY DERMATOBAC® FOR FUNGAL ENDOMETRITIS DIAGNOSIS IN MARES
Directory of Open Access Journals (Sweden)
Eriky Akio de Oliveira Tongu
2015-10-01
Full Text Available Among different etiologic factors, fungal endometritis is a common cause of decreased mare’s fertility. Two experiments were conducted to evaluate the sensitivity of Dermatobac®, a microculture system originallydevelopedfortheisolationoffungithatconcerns Human Medicine. In Experiment 1, standard (ATCC strains of Candida (n=4 and Aspergyllus (n=1 were grown and visually analyzed daily for 7 days. For Experiment 2, 34 mares were selected and subjected to material harvesting for completion of uterine cytology as well as seeding with Dermatobac®. After 24h of cultivation, the macroscopic observation of all Candida and Aspergyllus strains (Experiment 1 was possible. In Experiment 2, five animals showed presence of yeast on cytologic slides (14.71%, results also confirmed sowing in Dermatobac® system (100% sensitivity. Five false positive cases were observed, characterized by microbiological growth in Dermatobac® but not confirmed by endometrial cytology, determining specificity of 85%. However, the results did not compromise the efficiency of Dermatobac® system given all contaminants presented differentiated morphology and higher growing time (P<0.05 when compared to the major etiological agents of equine fungal endometritis. The Dermatobac® system proved to be efficient for the macroscopic diagnosis of fungal endometritis in horses, showing conclusive information only after 24 hours of culture.
Watanabe, Koichi; Makino, Hiroshi; Sasamoto, Masae; Kudo, Yuko; Fujimoto, Junji; Demberel, Shirchin
2009-06-01
Two novel micro-organisms, designated strains YIT 10443(T) and YIT 10738, were isolated from airag, a traditional fermented mare's milk from Mongolia. The two strains were Gram-positive-staining, non-motile, asporogenous, catalase-negative, facultatively anaerobic rods of various shapes. Comparative analyses of 16S rRNA and ClpC ATPase (clpC) gene sequences and the presence of fructose-6-phosphate phosphoketolase (F6PPK) demonstrated that the novel strains were members of the genus Bifidobacterium. On the basis of 16S rRNA gene sequence similarity, the type strains of Bifidobacterium minimum (96.6 %) and Bifidobacterium psychraerophilum (95.7 %) were the closest neighbours of the novel strains, and DNA-DNA reassociation values with these strains were found to be lower than 15 %. The phenotypic and genotypic features demonstrated that the two strains represent a single, novel Bifidobacterium species, for which the name Bifidobacterium mongoliense sp. nov. is proposed. The type strain is YIT 10443(T) (=JCM 15461(T) =DSM 21395(T)).
Directory of Open Access Journals (Sweden)
Gustavo Molina
2010-07-01
Full Text Available Os dados coletados na cidade de Maringá, Estado do Paraná, referentes ao consumo e à aceitação do leite e seus derivados foram utilizados para se traçar o perfil do consumo desses produtos, gerando subsídios para entendimento mais amplo sobre o mercado consumidor de leite. Trezentos indivíduos responderam à pesquisa que avaliou o grau de aceitação e frequência de consumo do leite e produtos derivados. Observou-se que o mais importante para o consumidor, no momento da compra, encontra-se na relação entre preço e qualidade do produto, e aproximadamente metade dos entrevistados (48,17% tem preferência pelo leite integral, seguido pelo desnatado com 26,20%. Entretanto,constatou-se que 8,73% dos entrevistados declararam não consumir leite, e a maior parte dos casos justifica-se por possuírem algum nível de intolerância à lactose. Enquanto isso, o iogurte e os queijos foram apontados como os derivados com maior percentual defrequência de consumo e aceitação. De forma geral, os dados coletados permitem concluir que o leite e seus derivados são produtos consumidos com regularidade e seus derivados foram apontados com alto percentual de frequência de consumo e aceitação.Data collected in Maringá, Paraná State, on the acceptance and consumption of milk and its products were used to delineate the profile of consumption of these products, generating benefits for a better understanding of the consumer market for milk. A total of 300 people answered the survey that assessed the degree of acceptance and frequency of consumption of milk and its products. It was observed that the most important to the consumer at the time of purchase, is the relationship between price and quality of product, and approximately half of respondents (48.17% prefer whole milk, followed by skimmed milk with 26.20%. However, it was found that 8.73% of respondents reported that do not consume milk, with the majority of cases justified by some level of
Directory of Open Access Journals (Sweden)
Orlando Ribeiro Prado Filho
2008-07-01
Full Text Available De todas as mortes por causas externas por trauma, metade poderia ser evitada, e um terço delas é dito potencialmente evitável. Objetiva-se determinar as características comuns referentes ao paciente com traumatismo abdominal. Realizou-se um estudo de 57 casos de pacientes com traumatismo abdominal atendidos no Hospital UniversitárioRegional de Maringá, no período de janeiro a dezembro de 2006. Constatou-se que a maioria das vítimas é do sexo masculino; a faixa etária mais acometida é a terceira década de vida; o trauma abdominal aberto mostrou-se discretamente mais frequente, sendo o ferimento por arma branca mais comum; a maioria das contusões abdominais se deveu aacidentes de trânsito; a realização de intervenção cirúrgica supera o tratamento conservador nos traumas abdominais abertos; nos traumas contusos, o baço e os rins foram os órgãos mais acometidos, enquanto nos ferimentos abertos a víscera mais acometida foi o intestinodelgado; a evolução para óbito predominou nos traumas abdominais abertos. Em virtude da prevalência, gravidade e importância do tema, sugere-se que mais estudos sejam realizados para que, assim, seja possível estabelecer condutas cada vez mais apropriadas à realidade doSistema Único de Saúde.Of all the deaths due to external cause trauma, half could be avoided, and a third are potentially preventable. The objective of this study was to determine the common characteristics related to patients with abdominal trauma. A study was conducted of 57 cases of abdominal trauma at the University Hospital of Maringá, during the period from January to December 2006. The majority of victims are male; the most affected age group is in its third decade oflife; open abdominal trauma proved to be slightly more prevalent, and wounds from cold steel weapons were the most common; most abdominal injuries were due to traffic accidents; the conduct of surgical intervention overcomes conservative treatment in
Oddon, P A; Boucekine, M; Boyer, L; Triglia, J M; Nicollas, R
2018-01-01
voice disorders are common in the pediatric population and can negatively affect children's quality of life. The pediatric voice handicap Index (pVHI) is a valid instrument to assess parental perception of their children voice but it is not translated into French language. The aim of the present study was to adapt a French version of the pVHI and to evaluate its psychometric properties including construct validity, reliability, and some aspects of external validity. we performed a cross sectional study including 32 dysphonic children and 60 children with no history of voice problems between 3 and 12 years of age. The original pVHI was translated into French language according to forward-backward rules and then administered to parents or caregivers. Construct validity and internal consistency were explored using confirmatory factor analysis and Cronbach's alpha. The questionnaire was filled twice to assess test-retest reliability using the intra-class correlation coefficient. The external validity was explored by comparing the French pVHI total and subscales scores between dysphonic and asymptomatic children. Correlations between the French pVHI and both the perceptual GRBAS scale and the health-related quality of life (HRQOL) survey "Vécu et Santé Perçu de l'Adolescent et de l'Enfant" (VSP-Ap) were also performed. the structure of the French pVHI showed a good fit with excellent reliability (α = 0.929) and high test-retest reliability. Significant differences were found between the group of dysphonic children and the control group (p life in children with voice disorder. We recommend its use in the multidimensional protocols for assessing voice disorder in the pediatric population. Copyright © 2017. Published by Elsevier B.V.
Energy Technology Data Exchange (ETDEWEB)
Mas Gornals, C.
2017-09-01
The mares sandstone has traditionally been the most representative and characteristic building stone on the island of Mallorca, used practically exclusively as construction material for centuries, since the abandonment of stone-and-mortar walls, until its progressive disuse with the appearance of the re-enforced concrete, which finally eclipsed its use. Such emblematic buildings for the island, as Bellver Castle, the Cathedral, La Lonja or the old city walls of Palma, bear witness to this. In Mallorca, the mares sandstone is quarried in the open air or in subterranean galleries. Vernacular architecture has always used the most accessible appropriate materials, and in the case of the mares sandstone, its abundance, sufficient softness, which facilitates its extraction, Together with sufficient hardness to confer solidity and durability in constructions, converge. The lack of specific scientific and geological data published about the different types of mares in Mallorca, added to the recent resurgence of technical, applied and landscape interest in this stone, have made a revision of its definition, characterization and classification necessary. [Spanish] Se definen el concepto y naturaleza de la piedra calcarenita denominada marés de la isla de Mallorca, a partir d sus características intrínsecas y de uso. Se realiza una clasificación y caracterización tipológica a partir de la cronoestratigrafía y contexto geológico de esta piedra utilizada como material de construcción. Se proporcionan datos históricos y etnológicos sobre su producción y aplicaciones. El marés de Mallorca, junto con las canteras donde se extrae, además de constituir un valioso patrimonio histórico-etnológico-cultural, constituyen también un importante patrimonio geológico-natural que registra y nos permite seguir la evolución y la historia geológica de la isla de Mallorca a través de los últimos 15 millones de años, desde el Mioceno medio (Langhiense-Serravalliense) hasta
A young multilayered terrane of the northern Mare Imbrium revealed by Chang’E-3 mission
Xiao, Long; Zhu, Peimin; Fang, Guangyou; Xiao, Zhiyong; Zou, Yongliao; Zhao, Jiannan; Zhao, Na; Yuan, Yuefeng; Qiao, Le; Zhang, Xiaoping; Zhang, Hao; Wang, Jiang; Huang, Jun; Huang, Qian; He, Qi; Zhou, Bin; Ji, Yicai; Zhang, Qunying; Shen, Shaoxiang; Li, Yuxi; Gao, Yunze
2015-03-01
China’s Chang’E-3 (CE-3) spacecraft touched down on the northern Mare Imbrium of the lunar nearside (340.49°E, 44.12°N), a region not directly sampled before. We report preliminary results with data from the CE-3 lander descent camera and from the Yutu rover’s camera and penetrating radar. After the landing at a young 450-meter crater rim, the Yutu rover drove 114 meters on the ejecta blanket and photographed the rough surface and the excavated boulders. The boulder contains a substantial amount of crystals, which are most likely plagioclase and/or other mafic silicate mineral aggregates similar to terrestrial dolerite. The Lunar Penetrating Radar detection and integrated geological interpretation have identified more than nine subsurface layers, suggesting that this region has experienced complex geological processes since the Imbrian and is compositionally distinct from the Apollo and Luna landing sites.
Directory of Open Access Journals (Sweden)
André Beal Galina
2006-10-01
Full Text Available Foi analisada a riqueza, composição e distribuição espacial de aves em um fragmento florestal urbano de 47,3 ha em Maringá, Sul do Brasil (23°25’S e 51°25W. Quatro hábitats foram categorizados neste fragmento: interior de floresta, borda de floresta, áreas abertas e lago. A borda e interior de floresta foram divididos em três estratos: inferior (abaixo de 3 m, médio (3-6 m e superior (acima de 6 m. Uma transecção abrangendo todos os hábitats foi percorrida quatro vezes por mês de janeiro a dezembro de 2003, totalizando 48 dias de amostragens. Foram registradas 86 espécies de aves no fragmento florestal, sendo os insetívoros e onívoros, respectivamente, as guildas com maior número de espécies. A maioriadas espécies foi registrada no máximo em 25% das amostragens. O interior da floresta foi o hábitat que teve a maior riqueza de espécies e a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. O estrato médio apresentou a maior riqueza e o superior a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. Ressalta-se a importância de se manter os vários fragmentos florestais urbanos e a cobertura arbórea nacidade de Maringá, a fim de se minimizar os efeitos do isolamento e tentar suprir as necessidades de uma parte da comunidade de aves que possivelmente não se manteria caso não houvesse outras áreas florestais próximas ao local estudado.Richness, composition and spatial distribution of birds were analyzed on an urban forest fragment of 47.3 ha at Maringá, Southern Brazil (23°25'S and 51°25W. Four habitats were categorized on this fragment: forest, forest edge, open areas and lagoon. The forest and forest edge were divided into three levels: understory (bellow 3 m, mid-levels (3-6 m and canopy (above 6 m. A standard transect was ran throughout all pre-established habitats four times each month of January to December 2003, totaling 48 sampling days. A total of 86
Parents' Evaluations of Their Children's Dysphonia: The Mamas and the Papas.
Amir, Ofer; Wolf, Michael; Mick, Liron; Levi, Omer; Primov-Fever, Adi
2015-07-01
This study aimed to evaluate the validity and reliability of a Hebrew translation of the Pediatric Voice Handicap Index (pVHI). It also examined differences between mothers and fathers in evaluating their child's dysphonia. Observational design. The pVHI was first translated and adapted to Hebrew. The translated version was, then, administered to a group of 141 parents of children aged younger than 14 years. Fifty-eight parents had a dysphonic child, and 83 had a nondysphonic child. Based on the parents' responses to the pVHI, statistical analyses were performed, evaluating validity and reliability, as well as group differences. Following, a subset of the participants, in which only cases where the responses of both parents were available, was examined for evaluating differences between the responses of mothers (n = 46) and fathers (n = 46). Statistical analyses revealed high reliability of the Hebrew version of the pVHI (Cronbach alpha = .97). Parents of the dysphonic children rated their children significantly higher than parents of the nondysphonic group (P 0.05). The Hebrew version of the pVHI is a reliable tool for quantifying parents' perception of their child's voice handicap. Mothers of dysphonic children evaluate their children's voice handicap more severely than fathers, whereas both parents of nondysphonic children perform this evaluation similarly. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Sanuki, Tetsuji; Yumoto, Eiji; Kodama, Narihiro; Minoda, Ryosei; Kumai, Yoshihiko
2014-06-01
To determine the long-term functional outcomes of type II thyroplasty using titanium bridges for adductor spasmodic dysphonia (AdSD) by perceptual analysis using the Voice Handicap Index-10 (VHI-10) and by acoustic analysis. Fifteen patients with AdSD underwent type II thyroplasty using titanium brides between August 2006 and February 2011. VHI-10 scores, a patient-based survey that quantifies a patient's perception of his or her vocal handicap, were determined before and at least 2 years after surgery. Concurrent with the VHI-10 evaluation, acoustic parameters were assessed, including jitter, shimmer, harmonic-to-noise ratio (HNR), standard deviation of F0 (SDF0), and degree of voice breaks (DVB). The average follow-up interval was 30.1 months. No patient had strangulation of the voice, and all were satisfied with the voice postoperatively. In the perceptual analysis, the mean VHI-10 score improved significantly, from 26.7 to 4.1 two years after surgery. All patients had significantly improved each score of three different aspects of VHI-10, representing improved functional, physical, and emotional well-being. All acoustic parameters improved significantly 2 years after surgery. The treatment of AdSD with type II thyroplasty significantly improved the voice-related quality of life and acoustic parameters 2 years after surgery. The results of the study suggest that type II thyroplasty using titanium bridges provides long-term relief of vocal symptoms in patients with AdSD. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Jovita Maria Matarezi de Souza
2006-05-01
Full Text Available OBJETIVO: avaliar os métodos contraceptivos adotados e o perfil das usuárias da rede pública de saúde do município de Maringá-PR, em relação às orientações para o seu uso, indicações, contra-indicações e razões para interrupção dos métodos. MÉTODOS: estudo transversal, descritivo, obtido por 284 entrevistas domiciliares de mulheres selecionadas das 62 equipes do Programa de Saúde da Família, mediante consentimento livre e esclarecido. O questionário foi aprovado pelo Comitê de Ética em Pesquisa envolvendo seres humanos da Universidade Estadual de Maringá. Os questionários utilizados foram pré-testados e então aplicados, interessando para este estudo as seguintes seções: caracterização da entrevistada; indicadores socioeconômicos; métodos contraceptivos. Análise estatística das distribuições de freqüências, pelo Statistical Package for the Social Sciences, versão 12.0. RESULTADOS: a maioria das mulheres eram de etnia branca, casadas, tinham idade entre 35 e 49 anos, escolaridade em nível médio, exerciam trabalho não remunerado e foram classificadas na classe econômica D e E. Quanto aos hábitos, 22,5% eram fumantes e 4,9% usuárias de bebida alcoólica. A pílula foi adotada em 50,3%, preservativo em 28,1% e laqueadura em 32%. A orientação quanto ao uso de métodos anticoncepcionais geralmente foi dos profissionais da área de saúde. Os motivos de interrupção dos métodos foram: desejo de engravidar, preferência por método definitivo e efeitos colaterais da pílula. O fator de risco mais prevalente para uso de pílula foi o tabagismo. Apenas 35,9% das entrevistadas iniciaram o uso da pílula após consulta prévia e quase a mesma proporção, 33,6%, não a fizeram antes do início de seu uso. CONCLUSÕES: observou-se que as indicações do uso do método contraceptivo e as orientações realizadas por profissionais da área de saúde foram satisfatórias, apesar das elevadas taxas de laqueadura
Directory of Open Access Journals (Sweden)
Jong H. eKim
2012-03-01
Full Text Available The cellular antioxidation system is a target in the antifungal action of amphotericin B (AMB and itraconazole (ITZ, in filamentous fungi. The sakAΔ mutant of Aspergillus fumigatus, a mitogen-activated protein kinase (MAPK gene deletion mutant in the antioxidation system, was found to be more sensitive to AMB or ITZ than other A. fumigatus strains, a wild type and a mpkCΔ mutant (MAPK gene deletion mutant in polyalcohol sugar utilization system. The sakAΔ mutant showed no growth at 0.5 μg mL-1 of ITZ or reduced growth at 1.0 to 2.0 μg mL-1 of AMB, while the other strains exhibited robust growth. Complete fungal kill (≥ 99.9% by ITZ or AMB was achieved by much lower dosages for the sakAΔ mutant than for the other strains. SakA and MpkC appear to have overlapping roles in marshalling the oxidative stress response under treatment by an organic peroxide, tert-butyl hydroperoxide (t-BuOOH, or hydrogen peroxide (H2O2. The SakA signalling pathway was found to be responsible for fungal tolerance to AMB or ITZ toxicity. It appears msnA, an Aspergillus ortholog to Saccharomyces cerevisiae MSN2 (encoding a stress-responsive C2H2-type zinc-finger regulator and sakA and/or mpkC (upstream MAPKs are in the same stress response network under t-BuOOH-, H2O2- or AMB-triggered toxicity. Of note is that ITZ-sensitive yeast pathogens (Candida krusei and Cryptococcus neoformans were also sensitive to t-BuOOH, showing a connection between ITZ toxicity and oxidative stress response. This was shown by enhanced antifungal activity of AMB or ITZ when co-applied with redox-potent natural compounds, 2,3-dihydroxybenzaldehyde, thymol or salicylaldehyde, as chemosensitizing agents. Hence, redox compounds, which target the antioxidation system in fungi, possess a potent chemosensitizing capacity to enhance efficacy of conventional drugs inducing oxidative stress. Such chemosensitization can reduce costs and alleviate negative side effects associated with current
Christoffersen, R.; Dukes, C.; Keller, L. P.; Baragiola, R.
2012-01-01
Solar wind ions are capable of altering the sur-face chemistry of the lunar regolith by a number of mechanisms including preferential sputtering, radiation-enhanced diffusion and sputter erosion of space weathered surfaces containing pre-existing compositional profiles. We have previously reported in-situ ion irradiation experiments supported by X-ray photoelectron spectroscopy (XPS) and analytical TEM that show how solar ions potentially drive Fe and Ti reduction at the monolayer scale as well as the 10-100 nm depth scale in lunar soils [1]. Here we report experimental data on the effect of ion irradiation on the major element surface composition in a mature mare soil.
Buff, Preston R; Johnson, Philip J; Wiedmeyer, Charles E; Ganjam, Venkataseshu K; Messer Iv, Nat T; Keisler, Duane H
2006-01-01
Horses fed beyond their nutritional requirement and that are physically inactive will develop obesity, which is often accompanied by insulin resistance and heightened risk of laminitis. The use of pharmacologic agents in combination with nutritional restriction may promote weight loss in obese horses unable to exercise because of laminitic pain. This study shows that reducing feed intake of brome grass hay to 75% of ad libitum intake in obese pony mares reduces body weight without induced exercise. Additional supplementation of ractopamine hydrochloride for 6 weeks resulted in a tendency for increased weight loss. Subsequent modulation of obesity-associated hormones, leptin and insulin, as a result of caloric restriction was observed.
A young multilayered terrane of the northern Mare Imbrium revealed by Chang'E-3 mission.
Xiao, Long; Zhu, Peimin; Fang, Guangyou; Xiao, Zhiyong; Zou, Yongliao; Zhao, Jiannan; Zhao, Na; Yuan, Yuefeng; Qiao, Le; Zhang, Xiaoping; Zhang, Hao; Wang, Jiang; Huang, Jun; Huang, Qian; He, Qi; Zhou, Bin; Ji, Yicai; Zhang, Qunying; Shen, Shaoxiang; Li, Yuxi; Gao, Yunze
2015-03-13
China's Chang'E-3 (CE-3) spacecraft touched down on the northern Mare Imbrium of the lunar nearside (340.49°E, 44.12°N), a region not directly sampled before. We report preliminary results with data from the CE-3 lander descent camera and from the Yutu rover's camera and penetrating radar. After the landing at a young 450-meter crater rim, the Yutu rover drove 114 meters on the ejecta blanket and photographed the rough surface and the excavated boulders. The boulder contains a substantial amount of crystals, which are most likely plagioclase and/or other mafic silicate mineral aggregates similar to terrestrial dolerite. The Lunar Penetrating Radar detection and integrated geological interpretation have identified more than nine subsurface layers, suggesting that this region has experienced complex geological processes since the Imbrian and is compositionally distinct from the Apollo and Luna landing sites. Copyright © 2015, American Association for the Advancement of Science.
USING THE FOURNIER INDEXES IN ESTIMATING RAINFALL EROSIVITY. CASE STUDY - THE SECAŞUL MARE BASIN
Directory of Open Access Journals (Sweden)
M. COSTEA
2012-03-01
Full Text Available Using the Fournier Index in Estimating Rainfall Erosivity. Case Study - The Secaşul Mare Basin. Climatic aggressiveness is one of the most important factors in relief dynamic. Of all climatic parameters, rainfall is directly involved in versant dynamic, in the loss of soil quality and through pluvial denudation and the processes associated with it, through the erosivity of torrential rain. We analyzed rainfall aggressiveness based on monthly and annual average values through the Fournier's index (1970 and Fournier's index modified by Arnoldus (1980. They have the advantage that they can be used not only for evaluating the land susceptibility to erosion and the calculation of erodibility of land and soil losses, but also in assessing land susceptibility to sliding (Aghiruş, 2010. The literature illustrates the successful use of this index which provides a summary assessment of the probability of rainfall with significant erosive effects. The results obtained allow observation of differences in space and time of the distribution of this index.
Evaluation in Physical Education: an analysis in state and municipal schools in Maringá-PR
Directory of Open Access Journals (Sweden)
Saray Giovana dos Santos
2008-06-01
Full Text Available Problems related to evaluation deal with many issues that Physical Education, as a pedagogical subject, has been facing. In order to investigate these aspects, this study has as its aim to analyse how and with purpose, the professionals from the area of Physical Education are evaluating studentes from the 5th to the 8th forms in state and municipal schools in Maringá. A questionnaire was used. The sample was formed by 30 teachers from 12 schools: 15 teachers from state schools and 15 from municipal schools. Descriptive statistics at simple frequency level and non-parametric test (χ2 were used. Results show that evaluation in the subject Physical Education is performed only to follow the norms, without planning and consequently without pre-defined educational objectives showing, thus, the contradictions and confusions inherent to evaluation modalities by the professionals of this area. These professionals demonstrated the precaroiusness of the understanding of evaluation role in teaching-learning process.
Cooper, B.L.; Antonenko, I.; Yamaguchi, Y.; Osinski, G.; Ono, T.; Ku-mamoto, A.
2009-01-01
The Lunar Radar Sounder (LRS) experiment on board the Kaguya spacecraft is observing the subsurface structure of the Moon, using ground-penetrating radar operating in the frequency range of 5 MHz [1]. Because LRS data provides in-formation about lunar features below the surface, it allows us to improve our understanding of the processes that formed the Moon, and the post-formation changes that have occurred (such as basin formation and volcanism). We look at a swath of preliminary LRS data, that spans from 7 to 72 N, and from 2 to 10 W, passing through the eastern portion of Mare Imbrium (Figure 1). Using software, designed for the mineral exploration industry, we produce a preliminary, coarse 3D model, showing the regional structure beneath the study area. Future research will involve smaller subsets of the data in regions of interest, where finer structures, such as those identified in [2], can be studied.
Energy Technology Data Exchange (ETDEWEB)
Hughes, S.S.; Schmitt, R.A.; (Oregon State Univ., Corvallis (USA)); Delano, J.W. (State Univ. of New York, Albany (USA))
1988-10-01
Apollo 15 yellow-brown glass is one of twenty-five, high Mg, primary magmas emplaced on the lunar surface in pyroclastic eruptions. Forty spherules of this glass were individually analyzed by electron microprobe and INAA for major- and trace-elements. The abundances demonstrate that this primary magma was produced by partial melting of differentiated cumulates in the lunar mantle. Models are developed to explain the possible source-regions of several Apollo 15 and Apollo 12 low-Ti mare magmas as being products of hybridization involving three ancient differentiated components of a primordial lunar magma ocean: (a) early olivine {plus minus} orthopyroxene cumulates; (b) late-stage clinopyroxene + pigeonite + ilmenite + plagioclase cumulates; and (c) late-stage inter-cumulus liquid.
Rodrigues-Martins, Ana; Riparbelli, Maria; Callaini, Giuliano; Glover, David M; Bettencourt-Dias, Monica
2008-01-01
Centrioles are essential for the formation of cilia, flagella and centrosome organization. Abnormalities in centrosome structure and number in many cancers can be associated with aberrant cell division and genomic instability.(1,2) Canonical centriole duplication occurs in coordination with the cell division cycle, such that a single new "daughter" centriole arises next to each "mother" centriole. If destroyed, or eliminated during development, centrioles can form de novo.(3-5) Here we discuss our recent data demonstrating a molecular pathway that operates in both de novo and canonical centriole biogenesis involving SAK/PLK4, SAS-6 and SAS-4.(6) We showed that centriole biogenesis is a self-assembly process locally triggered by high SAK/PLK4 activity that may or not be associated with an existing centriole. SAS-6 acts downstream of SAK/PLK4 to organize nine precentriolar units, which we call here enatosomes, fitting together laterally and longitudinally, specifying a tube-like centriole precursor.(7,8) The identification of mutants impaired in centriole biogenesis has permitted the study of the physiological consequences of their absence in the whole organism. In Drosophila, centrioles are not necessary for somatic cell divisions.(9,10) However, we show here that mitotic abnormalities arise in syncytial SAK/PLK4-derived mutant embryos resulting in lethality. Moreover male meiosis fails in both SAK/PLK4 and DSAS-4 mutant spermatids that have no centrioles. These results show diversity in the need for centrioles in cell division. This suggests that tissue specific constraints selected for different contributions of centrosome-independent and dependent mechanisms in spindle function. This heterogeneity should be taken into account both in reaching an understanding of spindle function and when designing drugs that target cell division.
AL FIKR AL BALAGHI FI AL MA’ĂNI ‘INDA AS SAKĂKI FI KITABIHI MIFTAHUL ULUM DIRĂSAH BALAGHIYYAH
Directory of Open Access Journals (Sweden)
Talqis Nurdianto
2018-02-01
Full Text Available Miftāhul ‘Ulūm, written by al-Sakākī, especially the third part, was the beginning of a new phase in the development of Arabic rhetoric. Al-Sakākī divided the rhetoric into three fields of study, which are (1 Ma’ānī, (2 Bayān, (3 Badī’. However, his style is influenced by philosophers, theologians and their verbal lexicon, which are difficult to take, especially for the ordinary recipient. Al-Sakākī described that his book containing several types of literature, namely, ‘ilm ṣarf in complete version and its conclusion, derivation science, and the grammatical study in the completeness of Ma’ānī and Bayān. The meaning of Makna is the study of completeness and conclusion. Therefore, books and prose, and poem require al-‘Arūḍ and al-Qawāfī include Ṣarf, Grammar, Ma’ānī, Bayān, limitation, reasoning, al’Arūḍ, and al-Qawāfī. He argued that the fields of study were influential in delivering knowledge to the student in order to reach the goal of the author towards his book.This research was an analytical descriptive study of al-Sakākī rhetoric that focused on the normative aspect represented by rhetorical rule and aesthetic aspects. Those aspects were shown by the feeling. Al-Sakākī rhetoric thought is a method based on mental division and has conducted in the construction of many factors, which the most important of them are philosophy and logic. Keywords: thought, rhetoric, meanings, sakkaki, study
Directory of Open Access Journals (Sweden)
Denise Albieri Jodas
2013-06-01
Full Text Available O objetivo deste estudo foi analisar os óbitos de menores de cinco anos por doenças evitáveis ocorridos em 2008 no município de Maringá, PR. Estudo quantitativo, descritivo, com 41 óbitos. Como instrumento norteador de coleta de dados, utilizou-se o formulário de investigação do Comitê de Prevenção do Óbito Infantil e Fetal. Dos 41 casos encontrados, 65,9% representaram óbitos neonatais, 24,4% pós-neonatais e 9,7%, de criança com mais de um ano; destes, 90,2% óbitos foram considerados evitáveis, sendo 64,9% neonatais, 27,0% pós-neonatais e 8,1% na idade acima de um ano. Quanto às medidas de evitabilidade, percebeu-se que as atividades de prevenção foram as mais encontradas entre as possibilidades de redução do óbito, com 59,5%, seguidas de ações de diagnóstico e tratamento precisos, com 35,1%. Conclui-se que a maioria dos óbitos evitáveis tem relação direta com a assistência à gestante no pré-natal e no parto, demonstrando a necessidade de instituir uma prática efetiva e de qualidade.Analizar las muertes de niños menores de cinco años por enfermedades evitables ocurridas en 2008 en Maringá, PR. Investigación cuantitativa, descriptiva, con 41 óbitos. Como instrumento de orientación para la recolección de datos, se utilizó el formulario de investigación de la Comisión de la Prevención de la Mortalidad Infantil y Fetal. De los 41 casos encontrados, un 65,9% representaron óbitos neonatales, 24,4% post-neonatales y 9,7% por encima de un año; de estos 90,2% de las muertes fueron consideradas evitables, siendo un 64,9% neonatales, 27,0% post-neonatales y 8,1% en la edad por encima de un año. Cuanto a las medidas de prevención, se observó que las actividades de prevención se han encontrado con mayor frecuencia entre las posibilidades de reducción de la muerte, dejando a un 59,5%, seguido por las acciones de diagnóstico y tratamiento, con un 35,1%. Conclusión: la mayoría de las muertes evitables
Agarwal, Sangeet Kumar; Gogia, Shweta; Agarwal, Alok; Agarwal, Rajiv; Mathur, Ajay Swaroop
2015-10-01
After total laryngectomy for laryngeal cancer, the major determinants of QOL is the patient's voice related quality of life (V-RQOL). The primary aim of this study was to assess the V-RQOL and impact of socioeconomic status over it in Indian population by using two validated scales [voice handicap index (VHI) and V-RQOL questionnaires]. Total 104 patients underwent total laryngectomy but 71 were eligible for study. Patients filled the VHI and V-RQOL questionnaires after completion of 1 year of usage of the TEP voice. The socioeconomic status of the patients was calculated according to various domains related to their life and were divided into lower and higher status. A total of 76.1% patients had VHI score between 0 to 30 (minimal voice handicap), 19.7% had score between 31 to 60 (moderate voice handicap) and only 4.2% patients had VHI score more than 61 (serious voice handicap). On V-RQOL scores, 16.9% patients had score between 10 to 15 (excellent), 40.8% patients, between 16 to 20 (very good), 22.5% patients, between 21 and 25 (good voice), 15.5% patients, between 26 and 30 (fair) and only 4.2% patients scored more than 30 with poor quality of voice. Patients with lower socioeconomic group had better V-RQOL than with high socioeconomic group. VHI and V-RQOL scores in our series were superior to other studies due to major population with lower socioeconomic status and better social support which exists in our society.
Gandhi, Sachin; Remacle, Marc; Mishra, Prasun; Desai, Vrushali
2014-12-01
Spasmodic dysphonia (SD) remains one of the most difficult of laryngeal pathologies to treat. With limited role for speech therapy, various surgical modalities have been tried with various success rates. The objective of the study is to report the results of vocal outcome after thyroarytenoid myoneurectomy in patients of adductor spasmodic dysphonia (ASD). 15 patients of ASD were selected. GRBAS, and voice handicap index (VHI) were used for perceptual evaluation of voice. Thyroarytenoid myoneurectomy was performed by vaporizing the muscular layer of the vocal fold with CO2 laser, at an intensity of 6 W with 1.2 mm diameter in scanner mode. Voice analysis was repeated at 12, 24 and 48 months follow-up. Preoperative GRBAS scores and VHI score of all the patients were poor. At 12 months 12/15 (80 %) patients having strain score of 0. There was marked improvement in VHI scores at 6 months. 10/15 (67 %) patients have been followed up for 24 months. 5/10 (50 %) patients have strain (S) value of 0. VHI scoring of 5/10 (50 %) patients was <30. Two of the four patients completed 48 months follow-up had a strain (S) value of 0, one patient has strain value of 1 and one patient had strain value of 2. 2/4 patients had VHI score of <30; one patient had that of 40. Trans-oral CO2 laser thyroarytenoid myoneurectomy shows significant long-term improvement in voice quality in terms of reduced speech brakes, effort and strain in voice.
The Comparison of Thyroarytenoid Muscle Myectomy and Type II Thyroplasty for Spasmodic Dysphonia.
Nomoto, Masaki; Tokashiki, Ryoji; Hiramatsu, Hiroyuki; Konomi, Ujimoto; Motohashi, Rei; Sakurai, Eriko; Toyomura, Fumimasa; Ueda, Yuri; Inoue, Shun; Tsukahara, Kiyoaki; Suzuki, Mamoru
2015-07-01
Surgical treatments for adductor spasmodic dysphonia include bilateral thyroarytenoid muscle myectomy (TAM) and type II thyroplasty (TPII), both of which are commonly performed. The present study aimed to compare the effects of TAM and TPII. Retrospective study. Subjects were 30 and 35 patients who underwent TAM and TPII, between March 2008 and November 2012. Voice quality was evaluated based on "voice handicap index 10 (VHI10)" and auditory impressions before and 6 months after surgery using five parameters: "strangulation," "interruption," "tremor," "grade," and "breathiness." Comparison of the two procedures revealed significant improvements in VHI10, strangulation, interruption, and tremor, and a significant decline in breathiness after surgery. In particular, VHI10 was improved by more than six points in 90% of patients with TAM, and 96% with TPII. No significant difference was observed between the severities of two procedures preoperatively. Comparison of each postoperative score between the two procedures revealed that TAM significantly improved strangulation, interruption, and tremor, and significantly worsened breathiness, with no significant difference in VHI10. Scatter plots (x: preoperative scores; y: postoperative scores) and regression lines of evaluation items demonstrated that TAM is more effective than TPII in severe cases. Compared with TPII, TAM tends to improve strangulation, interruption, and tremor; however, it tends to worsen breathiness postoperatively. Postoperative VHI10 scores did not differ significantly between the two procedures. Given favorable improvement rates, both surgical procedures were considered effective. Copyright © 2015 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Raquel Gusmão Oliveira
2007-03-01
Full Text Available O Programa de Saúde da Família (PSF propõe-se a atender a família integralmente em seu espaço social o que requer uma nova postura profissional. Este estudo tem como objetivo conhecer a prática do trabalho realizado com famílias pelos enfermeiros que atuam no PSF em Maringá, Paraná. Foi realizado um estudo descritivo exploratório com abordagem qualitativa, utilizando, para a coleta de dados, entrevistas, observação e análise documental. Os dados foram analisados, segundo o referencial teórico de Bardin. Os resultados revelaram três categorias: atividades com indivíduos, atividades na comunidade e atividades no domicílio. Concluiu-se que, apesar de os enfermeiros considerarem a família em seu espaço domiciliar, por meio de visitas domiciliares, de coleta de dados e da educação em saúde, ainda centralizam a doença e o indivíduo, e a sua postura não tem estimulado a participação e a autonomia das famílias no que se refere à assistência e ao serviço.El Programa de Salud de la Familia (PSF se propone atender a la familia integralmente en su espacio social lo que requiere de una nueva postura profesional. En este trabajo se tuvo como objetivo conocer la práctica del trabajo realizado con familias por los enfermeros que actúan en el PSF en Maringá, Paraná. Se realizó un estudio descriptivo exploratorio con abordaje cualitativo, utilizando para la recolección de datos, entrevistas, observación y análisis documental. Los datos fueron analizados según el referencial teórico de Bardin. Los resultados revelaron tres categorías: actividades con individuos, actividades en la comunidad y actividades en el domicilio. Se concluye que a pesar de que los enfermeros consideran a la familia en su espacio domiciliario, por medio de visitas domiciliarias, de recolección de datos y de la educación en salud, aun centralizan la enfermedad y al individuo, y su postura no ha estimulado la participación y la autonomía de las
Directory of Open Access Journals (Sweden)
Javad Javanbakht
2013-11-01
Full Text Available Background: Small intestinal (SI volvulus is defined as a rotation of greater than 180 degrees about its mesentery of a segment of jejunum or ileum. Horses of all ages have been affected. There is typically an acute onset of signs of mild to severe pain. Objectives: The objective of this study was to evaluate the microbial pathogens of the duodenum, ileum, cecum, colon and rectum (feces in associated with volvulus horse, and to determine whether rectal (fecal samples are representative of proximal segments of the gastrointestinal tract. Materials and Methods: A brown 26 years old mare, BCS (body condition score 4 was found dead in stall in the morning. It was moved to a suitable area to conduct a post-mortem exam. The mare was examined in hanging position and then left lateral-recumbent. Advanced abdominal tympany was present. Clinical signs, laboratory data, surgical or necropsy findings, clinic-histopathological findings and outcome for horse with SI volvulus was obtained from medical records, and identified by manual review. Horsefeces and colon were collected in autopsy. Fecal material was scooped from the center of a freshly defecated bolus into sterile sample cups, which were placed into plastic anaerobe jars with PackAnaero sachets (Mitsubishi Gas Co. via Remel, Lenexa, KS and transported to the laboratory. Alternatively, colon contents were collected from horse at the autopsy by direct incision into the colon immediately after the horse was autopsied. The samples were transported anaerobically to the laboratory. Results: On opening the abdominal cavity; a large quantity of sanguineous, foul-smelling fluid with pus exited the perforated bowel wall (hemoperitoneum. Additionally, signs of an acute diffuse peritonitis were visible. The blood vessels of the stomach and intestines were distended. Small intestinal volvulus was observed in several segments (360 degree rotation involving the mesentery. This information may aid diagnosis and
Luz, Geisa dos Santos; Carvalho, Maria Dalva de Barros; Pelloso, Sandra Marisa; Higarashi, Ieda Harumi
2008-09-01
Irreversible sequels of some genetic diseases can be prevented by neonatal screening. The aim of this paper was to verify the prevalence of diseases diagnosed by the National Program of Neonatal Screening (PNTN) in Maringá, Paraná, Brazil, between 2001 and 2006. This cross-sectional descriptive study included 20,529 newborn infants screened by that program. Out of those, 859 were re-examined, and 21 had the disease confirmed. Considering all screened newborn infants and the number of diagnostics per disease, the following disease prevalence was determine: phenylketonuria--1:20,529; congenital hypothyrodism--1:2,281; hemoglobinopahies--1:3,421; cystic fibrosis--1:10,264; and biotinidase deficiency--1:6,843. Understanding disease status and prevalence of newborns in a population allows the establishment and the improvement of public policies aimed at the children.
Taylor, Polly M; Luna, Stelio Pl; White, Kate L; Bloomfield, Malcolm; Fowden, Abigail L
2001-07-01
Objective To characterize intravenous anaesthesia with detomidine, ketamine and guaiphenesin in pregnant ponies. Animals Twelve pony mares, at 260-320 days gestation undergoing abdominal surgery to implant fetal and maternal vascular catheters. Materials and methods Pre-anaesthetic medication with intravenous (IV) acepromazine (30 µg kg -1 ), butorphanol (20 µg kg -1 ) and detomidine (10 µg kg -1 ) preceded induction of anaesthesia with detomidine (10 µg kg -1 ) and ketamine (2 mg kg -1 ) IV Maternal arterial blood pressure was measured directly throughout anaesthesia and arterial blood samples were taken at 20-minute intervals for measurement of blood gases and plasma concentrations of cortisol, glucose and lactate. Anaesthesia was maintained with an IV infusion of detomidine (0.04 mg mL -1 ), ketamine (4 mg mL -1 ) and guaiphenesin (100 mg mL -1 ) (DKG) for 140 minutes. Oxygen was supplied by intermittent positive pressure ventilation (IPPV) adjusted to maintain PaCO 2 between 5.0 and 6.0 kPa (38 and 45 mm Hg), while PaO 2 was kept close to 20.0 kPa (150 mm Hg) by adding nitrous oxide. Simultaneous fetal and maternal blood samples were withdrawn at 90 minutes. Recovery quality was assessed. Results DKG was infused at 0.67 ± 0.17 mL kg -1 hour -1 for 1 hour then reduced, reaching 0.28 ± 0.14 mL kg -1 hour -1 at 140 minutes. Arterial blood gas values and pH remained within intended limits. During anaesthesia there was no change in heart rate, but arterial blood pressure decreased by 10%. Plasma glucose and lactate increased (10-fold and 2-fold, respectively) and cortisol decreased by 50% during anaesthesia. Fetal umbilical venous pH, PO 2 and PCO 2 were 7.34 ± 0.06, 5.8 ± 0.9 kPa (44 ± 7 mm Hg) and 6.7 ± 0.8 kPa (50 ± 6 mm Hg); and fetal arterial pH, PO 2 and PCO 2 were 7.29 ± 0.06, 4.0 ± 0.7 kPa (30 ± 5 mm Hg) and 7.8 ± 1.7 kPa (59 ± 13 mm Hg), respectively. Surgical conditions were good but four ponies required a single additional dose of ketamine
Empreendedorismo Digital. Estudo do Projeto Negócios Digitais Realizado pelo Sebrae-PR em Maringá
Directory of Open Access Journals (Sweden)
Jaiane Aparecida Pereira
2016-01-01
Full Text Available Doing business in digital form has become popular across the telecommunications infrastructurecheapening and this competitiveness environment becomes increasingly difficult. In order to supportthe micro and small entrepreneurs in the process, Sebrae Paraná conceived the Digital Business Project, which was operated later by municipal units, as Sebrae Maringá. Thus, the aim of thisstudy is to understand how the Digital Business Project developed by Sebrae Maringa support inthe development of digital entrepreneurship in micro and small enterprises. For this, we made aqualitative research through semi-structured interviews with project managers and monitoring ofthree companies that participated. We also made a quantitative descriptive research to characterizethe participating profile. Therefore, the results show that the participant’s motivations was related toseeking knowledge about tools and strategies used in the digital environment, but lack of time andfinancial resources hinder this process. In addition, we indicate the importance of initiatives such asProject and suggestions for improve it.
Lar Betânia: O atendimento à infância abandonada em Maringá – PR
Directory of Open Access Journals (Sweden)
Ângela Mara de Barros Lara
2012-08-01
Full Text Available O presente artigo discute as políticas públicas de atendimento à criança e ao adolescenteem situação social de risco, na cidade de Maringá-PR, por meio da história do Lar Betânia,um abrigo fundado em 1965, no sistema casa-lar. A instituição que, em muitos períodos desua história chegou a atender, simultaneamente, 100 crianças vive hoje, a possibilidade desucumbir diante da atual filosofia do Estado de priorizar a permanência do menor junto àfamília biológica e, na impossibilidade dessa convivência, encaminhá-lo para acolhimento,junto às famílias cadastradas e preparadas para atuarem como famílias temporárias. Estadiscussão só foi possível a partir do estudo dos pressupostos que evidenciam o papel doEstado e dos direitos sociais na sociedade em que vivemos.
Directory of Open Access Journals (Sweden)
Sandra Marisa Pelloso
2002-04-01
Full Text Available Este estudo teve como objetivo descrever e analisar as causas e as taxas dos óbitos ocorridos entre as mulheres em idade fértil. Os dados foram colhidos através das declarações de óbito e das fichas de investigação do Comitê Regional de Mortalidade Materna de Maringá, Estado do Paraná, no período de 1989 a 2000. Os resultados mostram que o coeficiente de mortalidade materna é alto na região. Outro dado importante é a questão do sub registro dos óbitos. Em relação às causas de óbito materno, verificou-se que as obstétricas diretas, ou seja, as causas previníveis são as de maior incidência. Os números são absolutamente necessários para se ter uma visão do quadro epidemiológico e uma base sólida para ações. Eles permitem identificar os problemas e as falhas e possibilitam a formulação de propostas intervencionistas no sentido de diminuir os coeficientes de mortalidade maternaThis paper had the aim to describe and analyze the causes and death rates of females in fertile time. Data were collected from death certificates and investigation records of the Regional Committee of Mothers’ Death Rate in Maringá, state of Paraná, between 1980 and 2000. Results show that coefficient of mothers’ death rate is still high in the region under analysis. Other important data refer to details in these certificates. With regard to death causes, it has been verified that direct obstetric causes, that is, causes that could have been easily avoided were highest. Data are absolutely necessary so that one may have a precise idea of the epidemic picture and a solid base for triggering proceedings. In fact, if data identify problems and deficiencies, they also help in interventionist suggestions to decrease the coefficients of mothers’ death rate
Directory of Open Access Journals (Sweden)
José Lopes Silva
2011-07-01
Full Text Available Este artigo resulta da pesquisa sobre adolescentes em conflito com a lei e o cumprimento da medida sócio educativa de Prestação de Serviços a Comunidade no município de Maringá – PR. Trata-se de uma pesquisa documental qualitativa, cujo objetivo foi o de construir uma breve reflexão sobre a a infância e juventude para compreensão do envolvimento do adolescente em atos infracionais. A pesquisa foi realizada no Centro de Referência Sócio Educativo - CRSE, órgão executor das medidas sócio educativas de Prestação de Serviços a Comunidade e Liberdade Assistida, no município de Maringá- PR. A pesquisa ocorreu em duas etapas: a revisão de literatura sobre os temas criança e adolescente e adolescente em conflito com a lei. A segunda ocorreu por meio da consulta ao banco de dados do CRSE; do registro dos prontuários dos adolescentes que cumprem a referida medida, bem como os instrumentos utilizados pelos profissionais do CRSE nos atendimentos realizados. A pesquisa foi desenvolvida no período de julho a novembro de 2010. Foi possível identificar o perfil do adolescente em cumprimento de medida sócio educativa de PSC no CRSE. Esta identificação nos deu a dimensão da situação econômica e social do adolescente e família atendidos pela equipe do programa.
Analysis of Agricultural Drought in East Java Using Vegetation Health Index
Amalo, Luisa Febrina; Hidayat, Rahmat; Sulma, Sayidah
2018-01-01
Drought is a natural hazard indicated by the decreasing of rainfall and water storage and impacting agricultural sector. Agricultural drought assessment has been used to monitor agricultural sustainability, particularly in East Java as national agricultural production center. Identification of drought characteristics –correlated with El Niño-Southern Oscillation, and agricultural impact on paddy fields and rice production using VHI (Vegetation Health Index) were conducted. VHI is produced by ...
Directory of Open Access Journals (Sweden)
Francesca Martuzzi
2010-01-01
Full Text Available Aim of this work was to investigate nursing mares milk characteristics at the end of lactation (D and to make a comparisonwith milk taken during early lactation (3 to 30 d post partum (E. The survey was carried out on 17 Italian Saddlemares (IS (193 days in milk; 147 pregnancy days and on 12 Haflinger mares (H (174 days in milk; 146 pregnancydays. N fractions were determined by means of Kjeldahl; fat and lactose by means of mid infrared lectures; mineral elementswere determined by Atomic Absorption Spectrophotometry; P by colorimetry. Data referring to 58 individual milksamples were analyzed by ANCOVA. Significant variations, similar in both breeds, were observed (E vs D for density at15°C (1.036 vs 1.034, pH (6.94 vs 7.24, titratable acidity (3.56 vs 1.70 °SH, fat (1.17 vs 0.76% g/100g of milk,crude protein (2.31 vs 1.68% g/100g, casein number (52.37 vs 46.59 and ash (0.50 vs 0.30% g/100g; similarly(mg/100g for non casein N (172.31 vs 142.05, non protein N (34.43 vs 29.09, P (61.30 vs 32.48, Ca (112.88 vs54.42, Mg (8.40 vs 4.38 and K (60.77 vs 41.31. Freezing point, lactose and Na showed no significant variations. Atthe end of lactation, milk resulted poorer in all main organic components, except lactose, and in all mineral components,except Na. Only freezing point and phosphorus variations differed in IS from H. Breed significantly affected fat, casein Nand ash mean contents.
Directory of Open Access Journals (Sweden)
Eliane Alves de Freitas Souza
2007-04-01
Full Text Available FUNDAMENTOS: Onicomicoses são afecções ungueais de origem infecciosa causadas por fungos e estão entre as principais onicopatias em todo o mundo. OBJETIVOS: Determinar a freqüência de leveduras como agentes etiológicos de onicomicoses na cidade de Maringá, PR, Brasil. MATERIAL E MÉTODOS: Realizou-se um estudo retrospectivo do período entre janeiro de 1997 e dezembro de 2004, em que foram avaliados os resultados de 1.295 pacientes com suspeita de onicomicose, recebidos no Laboratório de Ensino e Pesquisa em Análises Clínicas da Universidade Estadual de Maringá, Paraná, Brasil. RESULTADOS: A confirmação micológica de onicomicose ocorreu em 761 (58,76% desses pacientes. As mulheres foram responsáveis por 71% das onicomicoses, e os homens, por 29%. A prevalência nas unhas das mãos foi de 28,67% e nas unhas dos pés, 71,33%. Em relação aos agentes, as leveduras foram mais freqüentemente isoladas (46,39%, seguidas pelos dermatófitos (40,60% e pelos fungos filamentosos não dermatófitos (13,01%. CONCLUSÃO: A alta freqüência de fungos leveduriformes em onicomicoses indica aprimoramento nas técnicas diagnósticas de confirmação laboratorial de fungos oportunistas. Esses resultados, associados à abordagem clínica do paciente, possibilitam maior segurança no diagnóstico e tratamento.INTRODUCTION: Onychomycoses are infectious ungueal diseases caused by fungi and represent the major onychopathies all over the world. OBJECTIVES: To determine the frequency of yeasts as etiological agents of onychomycoses in the city of Maringa, Parana, Brazil. METHODS: A retrospective study from January 1997 to December 2004. Results of 1295 patients with suspected onychomycosis were evaluated; tests were performed at the Teaching and Research Pathology Laboratory at the Universidade Estadual de Maringá, Parana, Brazil. RESULTS: Onychomycosis was confirmed by mycological exam in 761 (58.76% patients; 71% females and 29.00% males. The
Fractal analysis of the dark matter and gas distributions in the Mare-Nostrum universe
International Nuclear Information System (INIS)
Gaite, José
2010-01-01
We develop a method of multifractal analysis of N-body cosmological simulations that improves on the customary counts-in-cells method by taking special care of the effects of discreteness and large scale homogeneity. The analysis of the Mare-Nostrum simulation with our method provides strong evidence of self-similar multifractal distributions of dark matter and gas, with a halo mass function that is of Press-Schechter type but has a power-law exponent -2, as corresponds to a multifractal. Furthermore, our analysis shows that the dark matter and gas distributions are indistinguishable as multifractals. To determine if there is any gas biasing, we calculate the cross-correlation coefficient, with negative but inconclusive results. Hence, we develop an effective Bayesian analysis connected with information theory, which clearly demonstrates that the gas is biased in a long range of scales, up to the scale of homogeneity. However, entropic measures related to the Bayesian analysis show that this gas bias is small (in a precise sense) and is such that the fractal singularities of both distributions coincide and are identical. We conclude that this common multifractal cosmic web structure is determined by the dynamics and is independent of the initial conditions
Directory of Open Access Journals (Sweden)
Fábio Eduardo Ferreira dos Santos
2011-06-01
Full Text Available As micorrizas são consideradas importante componente na recuperação e restabelecimento da vegetação em áreas frágeis ou degradadas, bem como na manutenção da biodiversidade de plantas e das funções dos ecossistemas. O conhecimento da diversidade e dinâmica dos fungos micorrízicos arbusculares (FMA em áreas impactadas pela ação humana é importante para seu manejo e como indicador de sua qualidade. O Parque Cinqüentenário, localizado no município de Maringá, PR, pertence à formação original do conjunto Mata Atlântica, do domínio da floresta Estacional semi-decidual, é um dos poucos remanescentes florestais existentes na cidade de Maringá, PR, e encontra-se em estádio acelerado de degradação. O objetivo deste trabalho foi avaliar a diversidade de FMA nativos no solo e o grau de micorrização das plantas neste ecossistema. Amostras de solo e raízes foram coletadas em 65 pontos diferentes, na profundidade de 0-20 cm. A determinação da porcentagem de colonização micorrízica arbuscular foi feita sob microscópio estereoscópico, pelo método da interseção de quadrantes. A identificação das espécies de FMA foi realizada de acordo com a análise morfológica dos esporos. Foram estimados índices de diversidade, calculados com base no número de esporos em cada amostra. Foi verificada a ocorrência de 50 espécies de FMA, distribuídas em cinco gêneros: Glomus (31 espécies, Acaulospora (10 espécies, Scutellospora (6 espécies, Gigaspora (duas espécies e Paraglomus (uma espécie. Glomus foi o gênero mais abundante, com várias espécies esporocárpicas.Mycorrhizae are important components of any recuperation and recovery plan for threatened and endangered vegetation in degraded areas, as well as for the maintenance of plant diversity and ecosystem functions. Knowledge of diversity and dynamics of arbuscular mycorrhizal fungi (AMF in areas impacted by anthropic activities is important for managing these areas
Combining Voice Therapy and Physical Therapy: A Novel Approach to Treating Muscle Tension Dysphonia
Craig, Jennifer; Tomlinson, Carey; Stevens, Kristin; Kotagal, Kiran; Fornadley, Judith; Jacobson, Barbara; Garrett, C. Gaelyn; Francis, David O.
2015-01-01
Objective This study investigated the role of a specialized physical therapy program for muscle tension dysphonia patients as an adjunct to standard of care voice therapy. Study Design Retrospective Cohort Study Methods Adult MTD patients seen between 2007 and 2012 were identified from the clinical database. They were prescribed voice therapy and, if concomitant neck pain, adjunctive physical therapy. In a pragmatic observational cohort design, patients underwent one of four potential treatment approaches: voice therapy alone (VT), voice therapy and physical therapy (VT+PT), physical therapy alone (PT), or incomplete/no treatment. Voice handicap outcomes were compared between treatment approaches. Results Of 153 patients meeting criteria (Median age 48 years, 68% female, and 30% had fibromyalgia, chronic pain, chronic fatigue, depression, and/or anxiety), there was a similar distribution of patients with moderate or severe pre-treatment VHI scores across treatment groups (VT 45.5%, VT+PT 43.8%, PT 50%, no treatment 59.1%; p=0.45). Patients treated with VT alone had significantly greater median improvement in VHI than those not treated: 10-point vs. 2-point (p=0.02). Interestingly, median VHI improvement in patients with baseline moderate-severe VHI scores was no different between VT (10), VT+PT (8) and PT alone (10; p=0.99). Conclusions Findings show voice therapy to be an effective approach to treating MTD. Importantly, other treatment modalities incorporating physical therapy had a similar, albeit not significant, improvement in VHI. This preliminary study suggests that physical therapy techniques may have a role in the treatment of a subset of MTD patients. Larger, comparative studies are needed to better characterize the role of physical therapy in this population. PMID:26012419
Thompson, M. S.; Christoffersen, R.; Noble, S. K.; Keller, L. P.
2012-01-01
The morphology, mineralogy, chemical composition and optical properties of lunar soils show distinct correlations as a function of grain size and origin [1,2,3]. In the fraction, there is an increased correlation between lunar surface properties observed through remote sensing techniques and those attributed to space weathering phenomenae [1,2]. Despite the establishment of recognizable trends in lunar grains fraction fraction for both highland and mare derived soils. The properties of these materials provide the focus for many aspects of lunar research including the nature of space weathering on surface properties, electrostatic grain transport [4,5] and dusty plasmas [5]. In this study, we have used analytical transmission and scanning transmission electron microscopy (S/TEM) to characterize the mineralogy type, microstructure and major element compositions of grains in this important size range in lunar soils.
Directory of Open Access Journals (Sweden)
Valentim Constante Sella
2011-12-01
Full Text Available As alergias respiratórias, comumente as rinites e a asma, vêm se tornando cada vez mais frequentes. Considerando que no Noroeste do Paraná há poucos dados referentes ao assunto, propusemos a verificar os agentes causadores de alergias respiratórias e suas intercorrências em indivíduos atendidos em serviço privado de pneumologia do município de Maringá, Paraná. Estudo tipo observacional transversal, retrospectivo, realizado de janeiro/2004 a dezembro/2005. Os participantes foram avaliados clinicamente e realizado o teste de hipersensibilidade imediata, Punctura – Prick TestR. De cada indivíduo foram anotados os seguintes dados: idade, positividade ao teste, principais alérgenos reagentes, presença ou ausência de atopia, rinite ou asma. De 396 indivíduos, 236 (59,3% apresentaram positividade para um ou mais alérgenos, sendo que 80 (20,2% reagiram a três antígenos, 85 (21,5% a quatro ou mais. A reatividade dos indivíduos foi mais frequente à poeira doméstica (207, Dermatophagoides pteronyssimus (184, Dermatophagoides farinae (158 e Blomia tropicalis (95. Inclusive, poeira domiciliar, D. pteronyssimus e D. farinae ocorreram principalmente em indivíduos com moderada a severa atopia. Aproximadamente 70% dos indivíduos com idade entre seis a 20 anos apresentaram atopia. Considerando o elevado nível de atopia nos pacientes atendidos pelo serviço de pneumologia em Maringá, é imprescindível realizar programas de controle no meio ambiente, juntamente com o acompanhamento e o tratamento médico dos indivíduos atópicos.Respiratory allergies, especially rhinitis and asthma, are becoming increasingly common. Given that in northwestern Paraná there is little data on the subject, our objective was to verify the causative agents of respiratory allergies and their complications in patients treated at a private pulmonology service in the municipality of Maringá, Paraná. The study was observational, retrospective, lasting from
Water-gas dynamics and coastal land subsidence over Chioggia Mare field, northern Adriatic Sea
Teatini, Pietro; Baú, Domenico; Gambolati, Giuseppe
2000-09-01
A major development programme comprising 15 gas fields of the northern Adriatic Sea has recently been submitted to the Ministry of the Environment, VIA Committee for the assessment of the environmental impact, by ENI-Agip, the Italian national oil company. One of the largest reservoirs is Chioggia Mare, located about 10 km offshore of the Venetian littoral, with a burial depth of 1000-1400 m. The planned gas production from this field is expected to impact the shoreline stability with a potential threat to the city of Venice, 25 km northwest of the center of Chioggia Mare. To evaluate the risk of anthropogenic land subsidence due to gas withdrawal, a numerical model was developed that predicts the compaction of both the gas-bearing formations and the lateral/bottom aquifer (water drive) during a 13-year producing and a 12-year post-production period, and the transference of the deep compaction to the ground surface. To address the uncertainty of a few important hydromechanical parameters, several scenarios are simulated and the most pessimistic predictions obtained. The modeling results show that at most 1 cm of land subsidence over 25 years may be expected at the city of Chioggia, whereas Venice is not subject to settlement. If aquifer drawdown is mediated by water injection, land subsidence is arrested 5 km offshore, with the Chioggia littoral zone experiencing a rebound of 0.6-0.7 cm. Résumé. Un important programme de développement portant sur 15 gisements de gaz du nord de l'Adriatique a été récemment soumis au Comité VIA pour l'évaluation de l'impact sur l'environnement du Ministère de l'Environnement, par la société ENI-Agip, la compagnie nationale pétrolière italienne. L'un des plus importants réservoirs est celui de Chioggia Mare, situé à environ 10 km au large du littoral vénitien, à une profondeur de 1000 à 1400 m. La production de gaz prévue pour ce gisement laisse envisager un impact sur la stabilité du trait de côte, avec une
MATER - Pianeta Terra-Mare: an interactive and multidisciplinary approach to Geosphere sciences
Piangiamore, Giovanna Lucia; Fanelli, Emanuela; Furia, Stefania; Garau, Daniela; Merlino, Silvia; Musacchio, Gemma; Carla Centineo, Maria
2016-04-01
Recent studies demonstrate that Earth and Marine Sciences are not properly treated in scholastic programs and in textbooks are included in a superficial way. These topics are interdisciplinary and experimental (biology, ecology, oceanography and geology) and the recent advance in these fields is strictly linked to technologic improvement. School cannot keep up with the huge advances of knowledge experimented in the last 20 years, also for the lack of didactic laboratories sufficiently updated to support experimental activities. In this context, in 2014-15 three Italian Research Institutes (INGV, ISMAR-CNR and ENEA-CRAM) have decided to support the Unified School District "ISA 10"of Lerici (Liguria, Italy) - comprehensive of kindergartner, primary and middle schools - to develop the project MATER - Pianeta Terra-Mare (Planet Earth and Sea). The acronym MATER (MARe and TERra) has also a gender value, as people involved in the projects were women, mostly researchers and teachers, which have worked side by side with other women belonging to environmental and cultural associations of the territory. This heterogeneous group has a common objective: to promote the diffusion of a scientific culture and to sensitize students from 3 to 14 years towards problems occurring in marine and terrestrial environments, fostering the settlement of a sustainable attitude to the exploitation of natural resources and consciousness to natural hazards, such as earthquakes and floods, quite common in the Ligurian region. MATER has been considered as one of the best projects funded by MIUR (Italian Ministry of Education, University and Research) inside the Dissemination of Scientific and Technological Culture call for the year 2014. Natural hazards (Planet Earth) and the chemical-physical aspects and resources of the marine environment (Planet Sea) were the two modules of the project. Planet Earth developed through Piovono Idee! (Cloudy with a chance of Ideas!), an interactive exhibition on
Comparison between two ovulation-inducing drugs in mares
Directory of Open Access Journals (Sweden)
Paula Cardoso de Almeida Silva
2016-11-01
Full Text Available ABSTRACT. Silva P.C.A., Oliveira J.P., Sá M.A.F., Paiva S.O., Caram D.F., Junqueira R.G.C. & Jacob J.C.F. [Comparison between two ovulation-inducing drugs in mares.] Comparação entre dois agentes indutores da ovulação em éguas. Revista Brasileira de Medicina Veterinária, 38(Supl.2:45-48, 2016. Departamento de Reprodução e Avaliação Animal, Instituto de Zootecnia, Universidade Federal Rural do Rio de Janeiro, BR-465, Km 7, Seropédica, RJ 23890-000, Brasil. E-mail: paulinha_calmeida@hotmail.com Hormonal control of the ovulation is an effective tool to improve reproductive performance and reduce costs in equine breeding programs. The aim of this study was to compare the efficiency of lower doses of hCG and Deslorelina than doses traditionally used, evaluating the follicular parameters and time between induction and ovulation. Induction of ovulation was performed according to the groups, 1000 IU of hCG (G1, 0.75mg of Deslorelin (G2, and 1.0ml of saline solution (G3. Twenty-four hours after administration, ovaries were evaluated by ultrasound every six hours until detection of ovulation. The percentage of ovulation within 36 hours was 34.4%, 13.3% and 8.7%, and up to 42 hours was 96.9%, 70% and 17.4% for G1, G2 and G3, respectively, showing a significant increase (p ˂ 0.0001 in G1 compared to other groups. In G2 there was a significant increase (p ˂ 0.0001 of ovulation after 42 hours from the induction, and G3 after 48 hours. Until 48 hours the percentage of induction of ovulation was 96.8% (31/32 90% (27/30 and 30.4% (7/23, respectively, for G1, G2 and G3. Thus, the lower doses of ovulation-inducing drugs were effective in inducing ovulation within 48 hours, however hCG was faster than deslorelin, which might reduce costs and help the reproduction management.
Directory of Open Access Journals (Sweden)
Ed Pinheiro Lima
2011-01-01
Full Text Available Este artigo descreve a adaptação do modelo de emissão modal CMEM à frota da cidade de Maringá, Estado do Paraná, Brasil. Foram adotados como parâmetros de referência os fatores médios ponderados de emissão e de consumo determinados para a cidade. Esses fatores ponderados foram obtidos para cada fase do Proconve por meio dos fatores médios de emissão, corrigidos pelos fatores de deterioração do AP-42 da EPA e de consumo. Para cada fase do Proconve, foi associado um veículo representativo. Para cada veículo representativo, os parâmetros do modelo CMEM foram ajustados para aproximar-se aos fatores de emissão e consumo de referência. Observou-se que os fatores do AP42 tendem a representar melhor a deterioração da frota, principalmente para veículos mais antigos. A comparação com resultados do ciclo FTP, desagregados por fase, demonstrou variações percentuais mais significativas do que no valor total do ciclo. This paper describes the CMEM modal emission model adaptation to the fleet of the city of Maringá, Parana state, Brazil. Weighted averagefactors of determined emission and consumption for the city were adopted as reference parameters. These weighed factors were obtained for each PROCONVE phase through consumption and emission average factors, the latter corrected by AP-42 deterioration factors. For each Proconve phase a composite vehicle was associated. For each composite vehicle, the CMEM model parameters were adjusted to approach emission and consumption reference factors. It was observed AP42 deterioration factors tend to better represent the deterioration of the fleet, especially old vehicles. The comparison with FTP cycleresults, disaggregated by phase, demonstrated more significant percentile variations than the total value of the cycle.
Directory of Open Access Journals (Sweden)
Luiz Paulo Rigolon
1999-11-01
Full Text Available O experimento foi conduzido no Laboratório de Reprodução Animal e no Setor de Eqüideocultura da Fazenda Experimental da Universidade Estadual de Maringá, no período de setembro/97 a março/98, com o objetivo de testar os efeitos de dois diluidores na inseminação artificial de éguas das raças Percheron e Bretão. Foi utilizado um garanhão da raça Percheron e dezesseis éguas, as quais foram inseminadas com sêmen fresco, diluído em meios formulados à base de leite de vaca em pó desnatado (LD e à base de água de côco (AC. As inseminações foram realizadas quando se observaram folículos ovarianos com 3,5 cm de diâmetro. Utilizou-se o delineamento inteiramente casualizado, com oito éguas em cada tratamento. Para as análises utilizou-se o teste do qui-quadrado e análise de variância. A análise dos dados mostrou que não houve diferença (P > 0,05 dos tratamentos sobre o índice de prenhez das éguas no primeiro, segundo e terceiro ciclos estrais, no número de inseminações artificiais fecundas e não-fecundas, na prenhez/inseminação artificial (IA, no índice de prenhez total, na IA/prenhez e entre a motilidade progressiva e o vigor dos espermatozóides após diluição. Com base nos resultados, pode-se concluir que os dois meios foram eficientes na inseminação artificial dessas raças de éguas, utilizando-se o sêmen fresco.This experiment was carried out at Animal Reproduction Laboratory and Equine Section of the Experimental Farm of Universidade Estadual de Maringá, in the period of September 97 trough March 98. The objective was to study the effects of two extenders on artificial insemination (AI of Percheron and Breton breeding mares. One Percheron stallion and sixteen mares were used. The mares were inseminated with fresh semen diluted in two extenders formulated with skimmed powder cow milk (LS and coconut water (AW on the day ovarian follicles with 3.5 cm of diameter were observed. They. were alloted in a
Directory of Open Access Journals (Sweden)
Kazuyuki Hashimoto
2013-06-01
Full Text Available This study evaluated the profile of patients submitted to gastroplasty in the University Hospital of Maringá during 2008-2009. Clinical charts were analyzed to obtain clinical and laboratory data of all patients with morbid obesity submitted to gastroplasty. During the study period, 28 surgeries were performed, 57% of the patients lived in Maringá, 82% female, 40 years average age, with mean body mass index (BMI of 46.7kg m-2. It was verified that 39% of the patients maintained an usual non-hypocaloric diet, 25% had quoted dietary reeducation, 36% were sedentary, and 29% practiced some physical activity, and remaining 1/3 of patients presented no data about lifestyle. Regarding associated pathologies, 79% were hypertensive, and 71% of patients presented fasting glucose above 100 mg dL-1, but only 12 of them had diagnosis of Type 2 diabetes mellitus. The hospital stay length was 4 days for 89% of the patients, and 11% had surgery complications. In this group of subjects, there was a clear preponderance of females and high prevalence of other pathologies. Identifying the profile of obese patients contributes to more effective decision-making and emphasizes the crucial role of multidisciplinary approach to health promotion and prevention of early and late complications of morbid obesity and gastroplasty.
Directory of Open Access Journals (Sweden)
Rosane Freire
2012-05-01
Full Text Available This study aimed to track the spatial and temporal variations of toxic chemical compounds, such as the metals Al, Cd, Pb, Cu, Cr, Mn, Zn and the pesticide glyphosate, in Maringá stream and in a stretch of Pirapó river. The results pointed out that, in the case of metals, one of the possible sources of these elements is associated to agricultural activities. For glyphosate, were not found concentrations above those established by the Brazilian Water Quality Legislation (CONAMA 357/2005. Concerning this, we emphasized that the impact caused by the agrochemical on water quality should be evaluated considering the adverse effects to the environment caused by its degradation, that produces recalcitrant and surfactant compounds that may be even more toxic for humans and aquatic environment.
Fumuso, Elida; Giguère, Steeve; Wade, José; Rogan, Dragan; Videla-Dorna, Ignacio; Bowden, Raúl A
2003-11-15
Endometrial mRNA expression of the pro-inflammatory cytokines interleukin-1beta (IL-1beta), interleukin-6 (IL-6), and tumor necrosis factor alpha (TNF-alpha) was assessed in mares resistant (RM) or susceptible (SM) to persistent post-breeding endometritis (PPBE). Eight RM and eight SM, were selected based on reproductive records and functional tests out of a herd of 2,000 light cross-type mares. Three experiments were done to study transcription patterns in (i) basal conditions; (ii) after artificial insemination (AI); and (iii) after administration of an immunomodulator at time of artificial insemination. Endometrial biopsies were taken during consecutive cycles: (i) at estrus, when follicles reached 35 mm and at diestrus (7 +/- 1 days after ovulation); (ii) at 24 h post-AI, with dead semen (estrus) and in diestrus; (iii) at 24 h after treatment with a Mycobacterium phlei cell-wall extract (MCWE) preparation and AI (with dead semen), and at diestrus. mRNA expression was quantitated by real time PCR. Under basal conditions, SM had significantly higher mRNA expression of all cytokines in estrus and of IL-1beta and TNF-alpha in diestrus, compared to RM. After AI, there were no differences between RM and SM in estrus; however, mRNA expression for all three pro-inflammatory cytokines was higher than under basal conditions. In diestrus, RM showed significantly lower IL-1beta and TNF-alpha mRNA expression than SM. When MCWE was administered at time of AI, no differences between cytokine induction from RM and SM were found. Globally, mRNA expression for all three cytokines correlated well among themselves when expression was high. The present study showed that (i) in basal conditions RM had lower mRNA expression of pro-inflammatory cytokines than SM with no effect of estrous cycle; (ii) AI upregulated mRNA expression for all three cytokines in both RM and SM, with persistance in diestrus in the latter; (iii) treatment with MCWE at time of AI down-regulated mRNA expression
Ncube, Hlengisizwe; Duncan, Patrick; Grange, Sophie; Cameron, Elissa Z; Barnier, Florian; Ganswindt, Andre
2011-07-01
Regulative endocrine mechanisms influence the reproductive behaviour and success of mammals, but they have been studied predominantly in domestic and captive animals. The study aims at describing the pattern of faecal 20-oxopregnane and oestrogen concentrations during pregnancy in wild plains zebra Equus quagga chapmani. Data were collected during wet and dry seasons 2007-2009. Enzyme Immunoassays were used to determine 20-oxopregnane and oestrogen concentrations in faecal samples (n=74) collected from individual mares (n=32) whose dates of foaling were known through long-term monitoring. Hormonal profiles were described with a General Additive Model (GAM: Hormone ∼ Days to Foaling). Faecal 20-oxopregnanes have a complex cycle during pregnancy (GAM, n=70, R(2)=0.616, p200 ng/g DW) of faecal 20-oxopregnanes associated with high (>160 ng/g DW) faecal oestrogen levels indicate mid-pregnancy in c.90% of cases (16/17). High faecal 20-oxopregnanes (>200 ng/g DW) and low faecal oestrogen levels (<160 ng/g DW) indicate late pregnancy, again in c.90% of cases. Two faecal samples would allow the stage of pregnancy to be determined with confidence. Copyright © 2011 Elsevier Inc. All rights reserved.
Modeling Agricultural Crop Production in China using AVHRR-based Vegetation Health Indices
Yang, B.; Kogan, F.; Guo, W.; Zhiyuan, P.; Xianfeng, J.
Weather related crop losses have always been a concern for farmers On a wider scale it has always influenced decision of Governments traders and other policy makers for the purpose of balanced food supplies trade and distribution of aid to the nations in need Therefore national policy and decision makers are giving increasing importance to early assessment of crop losses in response to weather fluctuations This presentation emphasizes utility of AVHRR-based Vegetation health index VHI for early warning of drought-related losses of agricultural production in China The VHI is a three-channel index characterizing greenness vigor and temperature of land surface which can be used as proxy for estimation of how healthy and potentially productive could be vegetation China is the largest in the world producer of grain including wheat and rice and cotton In the major agricultural areas China s crop production is very dependent on weather The VHI being a proxy indicator of weather impact on vegetation showed some correlation with productivity of agricultural crops during the critical period of their development The periods of the strongest correlation were investigated and used to build regression models where crop yield deviation from technological trend was accepted as a dependent and VHI as independent variables The models were developed for several major crops including wheat corn and soybeans
Directory of Open Access Journals (Sweden)
Almir M. Cunico
2006-12-01
Full Text Available O objetivo do presente estudo foi avaliar padrões espaciais na composição, estrutura e distribuição das assembléias de peixes e suas relações com características abióticas em três córregos urbanos da cidade de Maringá, Paraná, Brasil. Peixes foram coletados ao longo de um gradiente longitudinal utilizando pesca elétrica nos meses de maio e novembro de 2004. Temperatura, nitrogênio, pH, oxigênio e fósforo foram as variáveis que mais influenciaram a análise de componentes principais (CPA. Riqueza, eqüitabilidade, índice de diversidade de Shannon-Wiener e o primeiro eixo da análise de correspondência com remoção do efeito do arco (DCA foram diretamente correlacionados com características ligadas ao impacto químico urbano. Adição de espécies prevaleceu nas estações de amostragem do córrego Miosótis e entre a cabeceira e porção intermediária nos córregos Nazaré e Mandacaru. Substituição ocorreu entre as porções intermediárias e foz desses córregos. A dominância da espécie tolerante Poecilia reticulata Peters, 1859 indicou a influência do impacto do meio urbano sobre as assembléias de peixes.The aim of the present study was to evaluate spatial patterns in composition, structure and distribution of fish assemblages and their relationships with abiotic characteristics in three urban streams of Maringá city, Paraná, Brazil. Fish were collected along the longitudinal gradient by electrofishing in May and November 2004. Temperature, nitrogen, pH, oxygen and phosphorous influenced at most the principal components analysis (PCA. Richness, evenness, Shannon-Wiener index and the first axis of detrended correspondence analysis (DCA were directly correlated with abiotic characteristics related to chemical urban impact. Species addition prevailed in Miosotis stream sampling stations, and between headwater and intermediary reaches in Nazaré and Mandacarú streams. Replacement occurred between intermediary and
International Nuclear Information System (INIS)
Mayyas, Abdel Ra'ouf; Kumar, Sushil; Pisu, Pierluigi; Rios, Jacqueline; Jethani, Puneet
2017-01-01
Highlights: •Vehicle hardware In-the-loop VHiL testing and validation is implemented in vehicle test bed. •Torque at the roller bench test is used to control the torque at wheels to reflect vehicle electrification symptoms. •Electrified powertrain with Equivalent Consumption Minimization Strategy is tested and validated using VHiL. •Fuel economy and power train performance is measured using high precision fuel measurement device. -- Abstract: Hybridization of automotive powertrains by using more than one type of energy converter is considered as an important step towards reducing fuel consumption and air pollutants. Specifically, the development of energy efficient, highly complex, alternative drive-train systems, in which the interactions of different energy converters play an important role, requires new design methods and processes. This paper discusses the inclusion of an alternative hybrid power train into an existing vehicle platform for maximum energy efficiency. The new proposed integrated Vehicle Hardware In-the-loop (VHiL) and Model Based Design (MBD) approach is utilized to evaluate the energy efficiency of electrified powertrain. In VHiL, a complete chassis system becomes an integrated part of the vehicle test bed. A complete conventional Internal Combustion Engine (ICE) powered vehicle is tested in roller bench test for the integration of energy efficient hybrid electric power train modules in closed-loop, real-time, feedback configuration. A model that is a replica of the test vehicle is executed – in real-time- where all hybrid power train modules are included. While the VHiL platform is controlling the signal exchange between the test bed automation software and the vehicle on-board controller, the road load exerted on the driving wheels is manipulated in closed –loop real-time manner in order to reflect all hybrid driving modes including: All Electric Range (AER), Electric Power Assist (EPA) and blended Modes (BM). Upon successful
Age-related risk factors with nonfatal traffic accidents in urban areas in Maringá, Paraná, Brazil.
de Melo, Willian Augusto; Alarcão, Ana Carolina Jacinto; de Oliveira, Analice Paula Rocha; Pelloso, Sandra Marisa; Carvalho, Maria Dalva de Barros
2017-02-17
The present study aimed to analyze the factors associated with the occurrence of nonfatal traffic accidents regarding age. A retrospective, transversal, and analytical study was carried out in the municipality of Maringá, Paraná, Brazil, based on data from Boletins de Ocorrência de Acidente de Trânsito ("Police Occurrence Bulletins"; BOATs). Following probability sampling, the sociodemographic aspects, logistics, environmental conditions, and time of occurrence of 418 cases of accidents were analyzed. The age of the victims was considered to be the dependent variable. The data were analyzed using descriptive statistics and bivariate, multivariate, and variance analysis, considering a confidence interval of 95% and a significance level of 5% (P accidents (P accidents were being single, having over 8 years of education, having had a driver's license for less than 3 years, roads with low luminosity, and driving at night. Demographic, environmental, and logistical factors were associated with morbidity due to traffic accidents among young people. These results challenge society and policy makers to create more effective strategies to minimize this serious public health problem.
Aryantini, Ni Putu Desy; Yamasaki, Eiki; Kurazono, Hisao; Sujaya, I Nengah; Urashima, Tadasu; Fukuda, Kenji
2017-03-01
Safety and probiotic characteristics such as antimicrobial activities of three Lactobacillus rhamnosus strains, FSMM15, FSMM22 and FSMM26, previously isolated as potential probiotics from fermented mare's milk were investigated. The three FSMM strains were susceptible to ampicillin, gentamycin, kanamycin, streptomycin, tetracycline and chloramphenicol, whereas they were resistant to erythromycin (minimal inhibitory concentration (MIC) = 4-8 µg/mL) and clindamycin (MIC = 4 µg/mL); bioconversion of bile salts, hemolytic activity and mucin degradation activity were negative; enzymatic activities of α-chymotrypsin and β-glucosidase were detected, but those of α-galactosidase, β-glucuronidase and N-acetyl-β-glucosaminidase, were undetectable. Among the strains, strain FSMM15 was chosen as a safer probiotic candidate due mainly to the lack of plasminogen binding ability. Despite lower acid production of strain FSMM15 than others, its cell-free culture supernatant inhibited growths of Salmonella Typhimurium LT-2, Shigella sonnei, Listeria monocytogenes, and Escherichia coli O157 with comparable levels of ampicillin, suggesting a favorable aspect of strain FSMM15 as a probiotic strain. © 2016 Japanese Society of Animal Science.
Subunits of the Snf1 kinase heterotrimer show interdependence for association and activity.
Elbing, Karin; Rubenstein, Eric M; McCartney, Rhonda R; Schmidt, Martin C
2006-09-08
The Snf1 kinase and its mammalian orthologue, the AMP-activated protein kinase (AMPK), function as heterotrimers composed of a catalytic alpha-subunit and two non-catalytic subunits, beta and gamma. The beta-subunit is thought to hold the complex together and control subcellular localization whereas the gamma-subunit plays a regulatory role by binding to and blocking the function of an auto-inhibitory domain (AID) present in the alpha-subunit. In addition, catalytic activity requires phosphorylation by a distinct upstream kinase. In yeast, any one of three Snf1-activating kinases, Sak1, Tos3, or Elm1, can fulfill this role. We have previously shown that Sak1 is the only Snf1-activating kinase that forms a stable complex with Snf1. Here we show that the formation of the Sak1.Snf1 complex requires the beta- and gamma-subunits in vivo. However, formation of the Sak1.Snf1 complex is not necessary for glucose-regulated phosphorylation of the Snf1 activation loop. Snf1 kinase purified from cells lacking the beta-subunits do not contain any gamma-subunit, indicating that the Snf1 kinase does not form a stable alphagamma dimer in vivo. In vitro kinase assays using purified full-length and truncated Snf1 proteins demonstrate that the kinase domain, which lacks the AID, is significantly more active than the full-length Snf1 protein. Addition of purified beta- and gamma-subunits could stimulate the kinase activity of the full-length alpha-subunit but only when all three subunits were present, suggesting an interdependence of all three subunits for assembly of a functional complex.
Il mare della fertilità Una analisi antropologica della tetralogia di Mishima Yukio
Directory of Open Access Journals (Sweden)
Giovanni Azzaroni
2013-05-01
Full Text Available Abstract – IT Neve di primavera è il primo romanzo della tetralogia 'Il mare della fertilità', il capolavoro dello scrittore giapponese, che si snoda in un Giappone caratterizzato sia da una cultura ancestrale sia da una invadente modernità e prelude a quel drammatico 25 novembre 1970 quando Mishima, scritte le ultime parole della tetralogia, si suicidò con l’antico rituale del seppuku. Neve di primavera è una narrazione polisemica costruita su opposizioni binarie strutturali, le vicende dei personaggi sono calate in un preciso contesto storico e culturale e per decodificarle è proposta una metodologia antropologica, nel tentativo, al tempo stesso, di coglierne le variegate e molteplici sfumature e, nel contempo, anche le interconnessioni con il tessuto ontologico che ne ha favorito il nascere e lo svilupparsi. Abstract – EN Spring snow is the first novel of the tetralogy The sea of Fertility, the masterpiece of the Japanese writer, which takes place in ancient and modern Japan. The novel is a prelude to the dramatic 25th November 1970: Mishima finished the tetralogy and committed suicide by the ancient seppuku ritual. Spring snow is a polisemic story which is constructed by binary and structural oppositions, the plot of the characters is drawn on a exact, historical and cultural context to catch either the variegated and various shadings or the relations with the ontological substratum, which helped its birth and development.
Il mare della fertilità Una analisi antropologica della tetralogia di Mishima Yukio
Directory of Open Access Journals (Sweden)
Giovanni Azzaroni
2012-01-01
Full Text Available Abstract – IT Neve di primavera è il primo romanzo della tetralogia Il mare della fertilità, il capolavoro dello scrittore giapponese, che si snoda in un Giappone caratterizzato sia da una cultura ancestrale sia da una invadente modernità e prelude a quel drammatico 25 novembre 1970 quando Mishima, scritte le ultime parole della tetralogia, si suicidò con l’antico rituale del seppuku. Neve di primavera è una narrazione polisemica costruita su opposizioni binarie strutturali, le vicende dei personaggi sono calate in un preciso contesto storico e culturale e per decodificarle è proposta una metodologia antropologica, nel tentativo, al tempo stesso, di coglierne le variegate e molteplici sfumature e, nel contempo, anche le interconnessioni con il tessuto ontologico che ne ha favorito il nascere e lo svilupparsi. Abstract – EN Spring snow is the first novel of the tetralogy The sea of Fertility, the masterpiece of the Japanese writer, which takes place in ancient and modern Japan. The novel is a prelude to the dramatic 25th November 1970: Mishima finished the tetralogy and committed suicide by the ancient seppuku ritual. Spring snow is a polisemic story which is constructed by binary and structural oppositions, the plot of the characters is drawn on a exact, historical and cultural context to catch either the variegated and various shadings or the relations with the ontological substratum, which helped its birth and development.
Directory of Open Access Journals (Sweden)
Marco Aurélio Valadão Fagundes
2007-07-01
Full Text Available O objetivo deste trabalho é determinar as características dos pacientes atendidos no Hospital Universitário de Maringá (HUM, com ferimento por arma branca (FAB e por arma de fogo (FAF, quanto ao sexo, idade, às regiões corporais, órgãos mais atingidos, tempo de internamento, complicações e mortalidade. Após análise de uma planilhaelaborada para a pesquisa, observou-se que 68% dos atendimentos foram por FAB e 32%, por FAF, sendo a maioria homens (mais de 90%, adultos jovens (2ª e 3ª década, por FAF e FAB, respectivamente. As regiões mais acometidas foram abdome e tórax. e os órgãos mais atingidos foram intestino delgado e fígado, na lesão por arma branca, e fígado e intestino delgado, no FAF. A complicação mais comum foi o choque hipovolêmico. Concluiu-se que os FAB ocorreram em maior número no sexo masculino, na terceira década de vida.The objective of this study is to determine the characteristics of patients assisted at the University Hospital of Maringá (HUM with wounds from edged weapons (EWW or firearms (FW, in regards to gender, age, wounded body areas, most affected body organs,length of hospitalization, complications and mortality rates. After the analysis of a worksheet elaborated for the study, it was observed that 68% of admissions had been for EWW and 32% for FW. The majority were men (90% and young adults (20s and 30s, for FW and EWW, respectively. The most affected body areas were the abdomen and thorax, and the most wounded organs were, in order: the small intestine and liver for EWW, and the liver and small intestine for FW. The most common complication was hypovolemic shock. It was concluded that EWW had occurred in larger numbers than FW, withpredominance in males in their 30s.
Tsuji, Domingos Hiroshi; Takahashi, Marystella Tomoe; Imamura, Rui; Hachiya, Adriana; Sennes, Luiz Ubirajara
2012-09-01
Adductor spasmodic dysphonia (ADSD) is a focal laryngeal dystonia, which compromises greatly the quality of life of the patients involved. It is a severe vocal disorder characterized by spasms of laryngeal muscles during speech, producing phonatory breaks, forced, strained and strangled voice. Its symptoms result from involuntary and intermittent contractions of thyroarytenoid muscle during speech, which causes vocal fold to strain, pressing each vocal fold against the other and increasing glottic resistance. Botulinum toxin injection remains the gold-standard treatment. However, as injections should be repeated periodically leading to voice quality instability, a more definitive procedure would be desirable. In this pilot study we report the long-term vocal quality results of endoscopic laser thyroarytenoid myoneurectomy. Prospective study. Surgery was performed in 15 patients (11 females and four males), aged between 29 and 73 years, diagnosed with ADSD. Voice Handicap Index (VHI) was obtained before and after surgery (median 31 months postoperatively). A significant improvement in VHI was observed after surgery, as compared with baseline values (P=0.001). The median and interquartile range for preoperative VHI was 99 and 13, respectively and 24 and 42, for postoperative VHI. Subjective improvement of voice as assessed by the patients showed median improvement of 80%. Because long-term follow-up showed significant improvement of voice quality, this innovative surgical technique seems a satisfactory alternative treatment of ADSD patients who seek a definite improvement of their condition. Copyright © 2012 The Voice Foundation. Published by Mosby, Inc. All rights reserved.
Wulijideligen; Asahina, Takayuki; Hara, Kazushi; Arakawa, Kensuke; Nakano, Hiroyuki; Miyamoto, Taku
2012-10-01
The purification and characterization of a bacteriocin produced by Leuconostoc mesenteroides strain 406 that was isolated from traditional Mongolian fermented mare's milk, airag, were carried out. Leuconostoc mesenteroides strain 406 was identified on the basis of its morphological and biochemical characteristics and carbohydrate fermentation profile and by API 50 CH kit and 16S ribosomal DNA analyses. The neutral-pH cell-free supernatant of this bacterium inhibited the growth of several lactic acid bacteria and food spoilage and pathogenic organisms, including Listeria monocytogenes and Clostridium botulinum. The bacteriocin was heat-stable and not sensitive to acid and alkaline conditions, but was sensitive to several proteolytic enzymes such as pepsin, pronase E, proteinase K, trypsin, and α-chymotrypsin, but not catalase. Optimum bacteriocin production (4000 activity units/mL) was achieved when the strain was cultured at 25°C for 24-36 h in Man Rogosa Sharpe medium. The bacteriocin was partially purified by ammonium sulfate precipitation (80% saturation), dialysis (cut-off MW: 1000), and gel filtration chromatography. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis revealed that the bacteriocin had a molecular weight of approximately 3.3 kDa. To our knowledge, this is the first report of the isolation of a bacteriocin-producing Leuconostoc strain from airag. An application to fermented milks would be desired. © 2012 The Authors. Animal Science Journal © 2012 Japanese Society of Animal Science.
Directory of Open Access Journals (Sweden)
Luciana L. Bezerra
2015-03-01
Full Text Available This study aimed to assess and evaluate the effects of Theileria equi infection on embryonic recovery, gestation and early embryonic loss. Thirteen Mangalarga Marchador Theileria equi positive donors (diagnosed through nested-PCR and 40 embryos receptors were used. Donors were submitted to two embryo collections in two consecutive estrous cycles (GId; after, the same mares were treated with imidocarb dipropionate (1.2mg/kg IM. in order to collect more embryos in two more estrous cycles (GIId. Receptors were divided into two groups (control and with treated with 20 animals each, where one group was the control (GIr and the other one (GIIr treated with 1.2mg/kg IM of imidocarb dipropionate assessing the gestation rate at 15, 30, 45 and 60 days. After 52 embryo collections, the embryonic recovery rates were 53.84% (14/26 and 65.38% (17/26 (p> 0.05 for GId and GIId, respectively. The gestation rate was 70% (14/20 (p>0.05 at 15, 30, 45 and 60 days in group GIr and for GIIr was 85% (17/20 (p>0.05 at 15 days, 80% (16/20 (p>0.05 at 30, 45 and 60 days. The treatment with imidocarb dipropionate did not cause significant improvement in the reproductive efficiency at an ET program.
Directory of Open Access Journals (Sweden)
Márcio Rodrigo Gimenes
2007-11-01
Full Text Available Foi analisada a riqueza, composição e distribuição espacial de aves em um fragmento florestal urbano de 47,3 ha em Maringá, Sul do Brasil (23°25’S e 51°25W. Quatro hábitats foram categorizados neste fragmento: interior de floresta, borda de floresta, áreas abertas e lago. A borda e interior de floresta foram divididos em três estratos: inferior (abaixo de 3 m, médio (3-6 m e superior (acima de 6 m. Uma transecção abrangendo todos os hábitats foi percorrida quatro vezes por mês de janeiro a dezembro de 2003, totalizando 48 dias de amostragens. Foram registradas 86 espécies de aves no fragmento florestal, sendo os insetívoros e onívoros, respectivamente, as guildas com maior número de espécies. A maioria das espécies foi registrada no máximo em 25% das amostragens. O interior da floresta foi o hábitat que teve a maior riqueza de espécies e a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. O estrato médio apresentou a maior riqueza e o superior a maior porcentagem de espécies com freqüência de ocorrência superior a 75%. Ressalta-se a importância de se manter os vários fragmentos florestais urbanos e a cobertura arbórea na cidade de Maringá, a fim de se minimizar os efeitos do isolamento e tentar suprir as necessidades de uma parte da comunidade de aves que possivelmente não se manteria caso não houvesse outras áreas florestais próximas ao local estudado.Richness, composition and spatial distribution of birds were analyzed on an urban forest fragment of 47.3 ha at Maringá, Southern Brazil (23°25'S and 51°25W. Four habitats were categorized on this fragment: forest, forest edge, open areas and lagoon. The forest and forest edge were divided into three levels: understory (bellow 3 m, mid-levels (3-6 m and canopy (above 6 m. A standard transect was ran throughout all pre-established habitats four times each month of January to December 2003, totaling 48 sampling days. A total of
Directory of Open Access Journals (Sweden)
EM Voltarelli
2009-01-01
Full Text Available Leishmania sp. infection was investigated in wild animals from the Ingá Park, in the municipality of Maringá, Paraná state, Brazil, where American cutaneous leishmaniasis (ACL is an endemic disease. Sixty-five mammals, comprising Didelphis albiventris, Cerdocyon thous, Lycalopex vetulus, Cebus apella, Dasyprocta azarae, Dasypus novemcinctus, Procyon cancrivorus and Nasua nasua, were captured. Blood samples were collected for parasite cultivation. Antibodies were investigated by direct agglutination test (DAT using Leishmania (Viannia braziliensis as antigen. Flagellates were observed in blood cultures of 14 (35.9% Didelphis albiventris. Anti-Leishmania antibodies were detected in 31 (51.6% specimens of Cerdocyon thous, Lycalopex vetulus, Cebus apella, Dasyprocta azarae, Procyon cancrivorus and Nasua nasua. These results suggest that Cerdocyon thous and Lycalopex vetulus (crab-eating fox, Cebus apella (capuchin monkey, Dasyprocta azarae (agouti, Procyon cancrivorus (crab-eating raccoon and Nasua nasua (coati play an important role in the ACL transmission cycle in the northwestern region of Paraná, Brazil.
Directory of Open Access Journals (Sweden)
Alessandra Valéria de Oliveira
2015-02-01
Full Text Available Many foods are susceptible to fungal contamination. Grains, such as peanuts, are commonly affected, with consequences including compromised integrity and infeasibility for human and animal consumption. Furthermore, some fungi may pose a health risk, largely due the production of mycotoxins. Among these, aflatoxins produced by Aspergillus flavus and A. parasiticus produce various carcinogenic, teratogenic, immunosuppressive, hepatotoxic and nephrotoxic effects. Molecular techniques have been used to identify and distinguish fungal species in foods. The objective of this study was molecular detection of Aspergillus species in peanut samples collected in stores in Maringá-PR, by amplification of fungal genetic material with specific primers for the intergenic spacer aflR-aflJ and later cutting with restriction enzymes. Of the 50 peanut samples analyzed, 27 were positive for the intergenic spacer aflR-aflJ, seven of which were identified as Aspergillus flavus. Our results demonstrate that peanuts sold in retail stores in this region have potential for contamination with toxigenic fungi.
Populaarsemad raamatud : [Sõnum] / Ita Saks
Saks, Ita, 1921-2003
1996-01-01
Aasta populaarseimad raamatud läti kirjanduses: Vizma Belshevica 'Bille', Regina Ezera 'Lohe Muna' ja Karlis Levinshi 'Muinasjutujärve ääres'; populaarseimad publitsistikaraamatud on Guntis Ulmanise 'Sinult ju palju ei nõuta' ja Dainis Ivansi 'Juhuslik sõdalane'
Drought Risk Identification: Early Warning System of Seasonal Agrometeorological Drought
Dalecios, Nicolas; Spyropoulos, Nicos V.; Tarquis, Ana M.
2014-05-01
By considering drought as a hazard, drought types are classified into three categories, namely meteorological or climatological, agrometeorological or agricultural and hydrological drought and as a fourth class the socioeconomic impacts can be considered. This paper addresses agrometeorological drought affecting agriculture within the risk management framework. Risk management consists of risk assessment, as well as a feedback on the adopted risk reduction measures. And risk assessment comprises three distinct steps, namely risk identification, risk estimation and risk evaluation. This paper deals with the quantification and monitoring of agrometeorological drought, which constitute part of risk identification. For the quantitative assessment of agrometeorological or agricultural drought, as well as the computation of spatiotemporal features, one of the most reliable and widely used indices is applied, namely the Vegetation Health Index (VHI). The computation of VHI is based on satellite data of temperature and the Normalized Difference Vegetation Index (NDVI). The spatiotemporal features of drought, which are extracted from VHI are: areal extent, onset and end time, duration and severity. In this paper, a 20-year (1981-2001) time series of NOAA/AVHRR satellite data is used, where monthly images of VHI are extracted. Application is implemented in Thessaly, which is the major agricultural region of Greece characterized by vulnerable and drought-prone agriculture. The results show that every year there is a seasonal agrometeorological drought with a gradual increase in the areal extent and severity with peaks appearing usually during the summer. Drought monitoring is conducted by monthly remotely sensed VHI images. Drought early warning is developed using empirical relationships of severity and areal extent. In particular, two second-order polynomials are fitted, one for low and the other for high severity drought, respectively. The two fitted curves offer a seasonal
Kataoka, Caio Shigueharu; Universidade Estadual de Ponta Grossa; Ornat, Marcio Jose; Universidade Estadual de Ponta Grossa
2014-01-01
Este artigo problematiza a relação entre os mapas de significados espaciais e a vivência geracional de homens e mulheres nikkeys no Norte do Paraná. Nosso recorte espacial refere-se às cidades de Maringá e Londrina, tendo visto o fato de apresentarem tanto considerável população relativa de japoneses, quanto expressiva manifestação cultural, organizada segundo Associações Culturais e Esportivas. O campo realizado evidencia os diferentes mapas de significados espaciais constituídos por homens ...
Directory of Open Access Journals (Sweden)
Lourival Domingos Zamuner
2002-04-01
Full Text Available O presente trabalho analisa os fatores físicos e hidrológicos da cabeceira de drenagem do córrego Cleópatra, as conseqüências advindas da urbanização e do lançamento concentrado de águas pluviais captadas pela rede de drenagem artificial em área de preservação ambiental - o Parque Florestal dos Pioneiros - Bosque II, em Maringá, Estado do Paraná, que gerou a implantação de sistema erosivo formado por ravinas e voçorocas.
Directory of Open Access Journals (Sweden)
B. Cioruţa
2013-03-01
Full Text Available Ever since “the environment” gained its place in the public international agenda (environmental legislation, sustainable development or disaster and hazard management it has been bundled with data, information, knowledge and information systems. Environmental Monitoring Systems (EMSs, Environmental Monitoring and Analyzing Systems (EMASs and especially Environmental Information Systems (EISs are integrated part of what we call Environmental Informatics (EI platform.In this context, as we speak, the are of EI is becoming more complex due to the current context and trend of making the EISs available to the public and end-users access; this phenomena is based on the assumption that public and environmental information end-users awareness, participation and acting is improved by the rate of access to the environmental information to solve the complex problematic covered by the research, engineering and environmental protection fields. The aim of the present paper is to introduce and describe an innovative possibilities of forecasting and monitoring the environment meteorological specific conditions in Baia Mare urban area using a specialized EISs software.
Directory of Open Access Journals (Sweden)
Christiane Minervino de Oliveira
2012-10-01
Full Text Available In order to evaluate the occupational exposure of dental professionals to metallic mercury in dental offices of a public primary health care in the city of Maringá, Brazil, samples of blood and urine were collected from 149 dental professionals (group exposed, and 51 healthy adults similar for age and gender of the exposed group (control group in September and October, 2008. Urinary mercury was determined using atomic absorption spectrophotometry, urea and creatinine in blood and urine by UV/VIS spectrophotometry and analysis of physical, chemical and microbiological characteristics of the urine by reactive bands. The program ‘Statistic��� version 7.1 and the software R version 2.6.2 were used for the statistical calculations. Urinary mercury was 2.08 2.11 µg g-1 creatinine in workers exposed to mercury and 0.36 0.62 µg g-1 creatinine in the control group (p Para avaliar a exposição ocupacional dos profissionais de odontologia ao mercúrio metálico nas Unidades Básicas de Saúde (UBS de Maringá, Brasil, foram coletadas amostras de sangue e urina de 149 profissionais de odontologia (grupo exposto e de 51 adultos saudáveis similares em relação à idade e ao gênero do grupo exposto (grupo controle, no período de setembro e outubro de 2008. Foi determinado o mercúrio urinário por espectrofotometria de absorção atômica, a uréia e creatinina no sangue por espectrofotometria UV/VIS, e análise dos aspectos físicos, químicos e microbiológicos da urina por fitas reativas. Para a análise estatística foi utilizado o programa Statistic versão 7.1 e o R versão 2.6.2. O mercúrio urinário foi 2,08 ± 2,11 µg g-1 de creatinina nos profissionais expostos ao mercúrio e 0,36 ± 0,62 µg g-1 de creatinina no grupo controle (p < 0,05. Os níveis de mercúrio urinário detectados estavam abaixo do Índice Biológico Máximo Permitido estabelecido no Brasil (35 µg g-1 de creatinina, 11% destes profissionais (n=16
Carroll, Thomas L; Dezube, Aaron; Bauman, Laura A; Mallur, Pavan S
2018-02-01
Clinical indications for vocal fold injection augmentation (VFI) are expanding. Prior studies demonstrate the benefit of trial VFI for select causes of glottic insufficiency. No studies have examined trial VFI for glottic insufficiency resulting from true vocal fold (TVF) scar. Retrospective chart review of patients who underwent trial VFI for a dominant pathology of TVF scar causing dysphonia. Patients who subsequently underwent durable augmentation were identified. The primary study outcome was the difference in Voice Handicap Index-10 (VHI-10) score from pretrial VFI to post-durable augmentation. Twenty-eight patients underwent trial VFI for TVF scar, 22 of whom reported a positive response. Fifteen of 22 subjects who underwent durable augmentation had viable data for analysis. Mean VHI-10 improved from 26.9 to 18.6 ( P 5). A trial VFI is a potentially useful, low-risk procedure that appears to help the patient and clinician identify when global augmentation might improve the voice when vocal fold scar is present. Patients who reported successful trial VFI often demonstrated significant improvement in their VHI-10 after subsequent durable augmentation.
Temporalis Fascia Transplantation for Sulcus Vocalis and Vocal Fold Scar: Long-Term Outcomes.
Karle, William E; Helman, Samuel N; Cooper, Amy; Zhang, Yuan; Pitman, Michael J
2018-04-01
Sulcus vocalis and vocal fold scar involve derangement of the superficial lamina propria of the vocal fold, which results in significant dysphonia. Many options exist for treatment, most of which have unsatisfactory and unpredictable outcomes. Autologous transplantation of temporalis fascia into the vocal fold (ATFV) has the potential to be a better treatment option, but long-term outcomes have not been well studied. Retrospective chart review and patient survey. Twenty-one patients diagnosed with vocal fold scar or sulcus vocalis and treated with ATFV with at least 1-year follow-up were included. Voice Handicap Index 10 (VHI-10) questionnaires were collected preoperatively and 6 months postoperatively. Patients were reached at the time of the study to complete another VHI-10 and a Likert scale survey. The mean decrease in VHI-10 scores between preoperation and 6 months postoperation was 8.35 ( P vocal fold for the treatment of vocal fold scar and sulcus vocalis is a safe surgery with good long-term outcomes and high patient satisfaction.
Use of vegetation health data for estimation of aus rice yield in bangladesh.
Rahman, Atiqur; Roytman, Leonid; Krakauer, Nir Y; Nizamuddin, Mohammad; Goldberg, Mitch
2009-01-01
Rice is a vital staple crop for Bangladesh and surrounding countries, with interannual variation in yields depending on climatic conditions. We compared Bangladesh yield of aus rice, one of the main varieties grown, from official agricultural statistics with Vegetation Health (VH) Indices [Vegetation Condition Index (VCI), Temperature Condition Index (TCI) and Vegetation Health Index (VHI)] computed from Advanced Very High Resolution Radiometer (AVHRR) data covering a period of 15 years (1991-2005). A strong correlation was found between aus rice yield and VCI and VHI during the critical period of aus rice development that occurs during March-April (weeks 8-13 of the year), several months in advance of the rice harvest. Stepwise principal component regression (PCR) was used to construct a model to predict yield as a function of critical-period VHI. The model reduced the yield prediction error variance by 62% compared with a prediction of average yield for each year. Remote sensing is a valuable tool for estimating rice yields well in advance of harvest and at a low cost.
Use of Vegetation Health Data for Estimation of Aus Rice Yield in Bangladesh
Directory of Open Access Journals (Sweden)
Mohammad Nizamuddin
2009-04-01
Full Text Available Rice is a vital staple crop for Bangladesh and surrounding countries, with interannual variation in yields depending on climatic conditions. We compared Bangladesh yield of aus rice, one of the main varieties grown, from official agricultural statistics with Vegetation Health (VH Indices [Vegetation Condition Index (VCI, Temperature Condition Index (TCI and Vegetation Health Index (VHI] computed from Advanced Very High Resolution Radiometer (AVHRR data covering a period of 15 years (1991–2005. A strong correlation was found between aus rice yield and VCI and VHI during the critical period of aus rice development that occurs during March-April (weeks 8–13 of the year, several months in advance of the rice harvest. Stepwise principal component regression (PCR was used to construct a model to predict yield as a function of critical-period VHI. The model reduced the yield prediction error variance by 62% compared with a prediction of average yield for each year. Remote sensing is a valuable tool for estimating rice yields well in advance of harvest and at a low cost.
Does CPAP Affect Patient-Reported Voice Outcomes?
Hartke, Vance; Gillespie, Amanda; Smith, Libby J; Soose, Ryan J
2018-04-01
Upper aerodigestive tract symptoms are common in patients with obstructive sleep apnea (OSA). It remains unclear whether continuous positive airway pressure (CPAP) improves or worsens these otolaryngology symptoms. As therapy-related side effects limit CPAP adherence, this study aimed to determine if CPAP negatively affects voice, sinonasal, and reflux symptoms of the upper airway. Case series with planned data collection was performed at an academic otolaryngology sleep center. Newly diagnosed patients with OSA were evaluated before and 6 months after initiating CPAP therapy. Data collected included CPAP data download, Reflux Symptom Index (RSI), Epworth Sleepiness Scale (ESS), Voice Handicap Index 10 (VHI-10), Sino-Nasal Questionnaire (SNQ), and oral dryness visual analog scale (VAS). For the 11 CPAP-adherent participants, the RSI significantly improved with CPAP (mean RSI, 22.0-9.5; P = .002); however, the VAS, VHI-10, and SNQ did not change after 6 months of CPAP therapy. In a small sample size, patient-reported voice outcomes (VHI-10) and other upper aerodigestive tract symptoms did not worsen with CPAP; rather, CPAP therapy was associated with a reduction in reflux symptoms.
Directory of Open Access Journals (Sweden)
Pedro Paulo Davantel
2009-09-01
Full Text Available Os acidentes de trânsito são atualmente a primeira causa de mortalidade no conjunto de causas externas entre as mulheres. A mulher atual, pelas mudanças em seu papel na sociedade, vem se expondo a novos riscos. Este estudo teve como objetivo caracterizar a mulher envolvida em acidente de trânsito, assim como os eventos. Foi realizado um estudo transversal, com dados secundários obtidos nos Boletins de Ocorrência de Acidente de Trânsito - BOAT, do 4º Batalhão da Polícia Militar de Maringá, Setor de Trânsito. Os dados foram categorizados e analisados por meio de testes não-paramétricos, de correlações (Spearman e teste de independência entre as variáveis (qui-quadrado. As mulheres envolvidas em acidente de trânsito eram em sua maioria solteiras (34,0%, com idade entre 21 e 30 anos (49,0%, nível de escolaridade acima do ensino médio (58,0% e predominantemente condutoras (65,0%. Os eventos ocorreram principalmente em dias úteis e nos período da tarde e da noite. As lesões foram mais frequentes em mulheres até os 20 anos e acima dos 51. Maior envolvimento em colisões com automóveis (69,%, com grande proporção de atropelamentos (14,2%, envolveram mulheres acima dos 50 anos e com menor nível de escolaridade. Foram mais atentas ao uso de dispositivos de segurança quando casadas e com maior nível de escolaridade. Estes dados sugerem novo perfil da mulher no trânsito, devendo o acompanhamento destas características e das consequências destes acidentes serem mais constantes em pesquisas, direcionando medidas e campanhas preventivas.Today traffic accidents are the first cause of morbidity in the group of external causes among women. Modern women have changed their role, exposing themselves to new risks. So, this study had as its purpose, characterize women involved in traffic accidents and to describe these accidents. A cross-sectional survey was conducted with information obtained from the Traffic Accident Report
International Nuclear Information System (INIS)
Dinapoli, Nicola; Parrilla, Claudio; Galli, Jacopo
2010-01-01
To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO 2 surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Dinapoli, Nicola [Catholic Univ. of the Sacred Heart, Rome (Italy). Dept. of Radiation Oncology; Parrilla, Claudio; Galli, Jacopo [Catholic Univ. of the Sacred Heart, Rome (IT). Dept. of Otorhinolaryngoiatry] (and others)
2010-11-15
To compare oncological outcome and voice quality among a uniform and well-defined subset of patients with T1 glottic carcinoma. Patients, affected by laryngeal glottic carcinoma, treated by laser CO{sub 2} surgery or radiotherapy, have been analyzed. Overall survival and disease-free survival were calculated. In order to verify differences in functional outcomes and voice quality, all patients were interviewed during their last follow-up visit during 2009 using the VHI (Voice Handicap Index) questionnaire. The data were analyzed using the MedCalc software. A total of 143 patients were analyzed: 73 underwent surgery and 70 underwent radiotherapy. No statistically significant differences were found between the two groups in terms of overall survival and disease-free survival; dividing patients into stages T1a and T1b also made no difference. In order to evaluate the differences in outcomes for surgery and radiotherapy, patients were interviewed using the VHI questionnaire. Better scores for each category in the VHI were found for patients receiving radiotherapy compared to surgery (physical: p = 0.0023; functional: p < 0.0001; environmental: p < 0.001). The median VHI score for radiotherapy patients was 4, while for surgical patients it was 18 (p < 0.0001). This study confirms the well-known knowledge that results from radiotherapy and surgery in early glottic cancer treatment are equivalent. Furthermore, the role of patient preference in the treatment modality choice and the value of a multidisciplinary approach for a detailed and multi-oriented discussion with the patient are outlined. (orig.)
El Mare Nostrum digital: Mito, ideología y realidad de un imaginario sociotécnico
Directory of Open Access Journals (Sweden)
Francisco García García
2012-04-01
Full Text Available En el imaginario social de la Red ha aparecido con fuerza el dibujo de una nueva generación formada por jóvenes nacidos en un entorno esencialmente digital. Bajo términos contrastantes como el de ""nativos digitales"" se engloba a un vasto grupo poblacional relacionado estrechamente con las TIC y que ha hecho de las redes un espacio social y personal básico de su actividad, de su forma de habitar y relacionase con el mundo. Pero, ¿cuáles son realmente las características que los definen?, ¿son un grupo realmente homogéneo?, ¿disponen de competencias, habilidades y conductas similares?, ¿cuál es la frontera real que separa a los nativos y a los inmigrantes digitales? ¿Son estos términos apropiados para definir esta nueva realidad social? ¿Responde la realidad social de Internet a este concepto bipolar?Tomando como referencia los principales estudios realizados hasta la fecha, el artículo realiza un ejercicio metafórico dirigido a repensar los rasgos de este universo (nuestro Mare Nostrum Digital con la finalidad de acotar, interpretar y arrojar luz sobre este relevante fenómeno de nuestra actualidad.
Directory of Open Access Journals (Sweden)
Rosinta Ria Panggabean
2010-05-01
Full Text Available International accounting topic was rare to adress between accounting practices, especially International Accounting Standard. It occured due to the restrictive source and difficulty in finding the source. However, recently the standard has been an addressed issue since Indonesia Chartered of Accountant (IAI plans to comply the Indonesia Accounting Standard (SAK with the International Financialreporting(IFRSon1stJanuary2012.The purpose of the research is to measure the compliance of the (SAK per 1st January 2008 with the IFRS per 1st January 2008 and attain the association between those two standards. Hence, the difference between the two standards and the neccessary steps to be taken for complying can be obtained. The methodology will be used in the paper are Jaccard’s Coefficients, Spearman’s Correlation Coefficient,Euclidean Distances.The sample for the paper will be 43 accounting issues adressed on both standards that have been chosen and investigated. The paper concludes that there are significant equalities (75% between SAK per 1st January 2008 and IFRS 1st January 2008. (using Jaccard’s Coefficients. Due to several problems that have been found in the research, the author wish that the further researchers could widen the research’s samples, so the result will be more accurate and comprehensive.
Directory of Open Access Journals (Sweden)
Jailson Araújo Dantas
2006-07-01
Full Text Available O objetivo deste trabalho foi estabelecer valores de referência de alguns parâmetros fisiológicos (bioquímicos, hematológicos e urinários de ratos provenientes do Biotério Central da Universidade Estadual de Maringá, Estado do Paraná. Foram utilizados ratos machos, normais e saudáveis da linhagem Wistar, com peso de 200 a 220 g. Foiavaliado o perfil hematológico (leucócitos: totais, mononucleares e polimorfonucleares e a determinação bioquímica de vários constituintes plasmáticos (aspartato aminotransferase, alanina aminotransferase, glicose, creatinina, fosfatase alcalina, fosfatase ácida, uréia, colesterol total, colesterol HDL, triglicerídeos, teste de tolerância à glicose GTT e urinários (glicose, creatinina. É imprescindível que cada laboratório estabeleça seu conjunto devalores de referência dos animais normais, de acordo com a dieta, a linhagem, o sexo e a idade de cada espécie utilizada. Assim, através deste trabalho, o pesquisador pode identificar desvios dos parâmetros, facilitando a escolha dos animais para o estudo.The present work was carried out to establish reference values for some physiological parameters (biochemical, hematological and urinary in rats proceeding from the Central Biotery at the State University of Maringá, State of Paraná. Normal male Wistar rats weighing 200-220 g were used. The hematological profile (total leukocytes, mononuclear and polymorphonuclear cells count, theclinic chemistry (aspartate aminotransferase, alanine aminotransferase, glucose, creatinine, alkaline phosphatase, acid phosphatase, urea, cholesterol, HDL-c, triglycerides, glucose tolerance and urinary parameters (glucose and creatinine were determined. Each laboratory should establish a database of reference values for their animals, according to diet, strain, sex and age foreach species used. Thus, in this work, a database is provided regarding reference values of some physiological parameters in rats for use
Thermal Demagnetization of Mare Basalts 10017 and 10020
Suavet, C. R.; Weiss, B. P.; Grove, T. L.
2012-12-01
unstable. The fact that the NRM and the ARM have similar behavior upon heating confirms that the magnetization is a TRM. We compared the AF demagnetization of a 0.1 mT ARM before and after heating a subsample of 10017 up to 250°C: there was no change in the coercivity spectrum, which shows that the demagnetization was not due to alteration of the magnetic carriers. The thermal demagnetization of a subsample of 10017 with a saturation isothermal magnetization (SIRM) does not show a Curie point at 250°C. Therefore, the low-temperature demagnetization of mare basalts 10017 and 10020 is real. It could be caused by a defect magnetization of troilite, interaction between troilite and kamacite, presence of cohenite, or an unknown phenomenon.
O aproveitamento de madeiras das podas da arborização viária de Maringá/PR
Directory of Open Access Journals (Sweden)
Carlos Humberto Martins
2013-05-01
Full Text Available A pesquisa tem o objetivo de elencar formas de aproveitamento das madeiras das podas da arborização viária da cidade de Maringá/PR. Foram identificadas as três espécies arbóreas mais frequentes: Caesalpinia peitophoroides (Sibipiruna, Tabebuia avellanedae (Ipê Roxo e a Tipuana tipu (Tipuana que correspondem a 56,21% do total. Propõe-se a investigação do aproveitamento da madeira para fabricação de pequenos objetos de madeira (POM, elementos estruturais para a construção civil, e para a obtenção de carvão vegetal. Constatou-se nas análises laboratoriais: o Ipê Roxo com alta densidade básica, com resistência mecânica para a produção de elementos estruturais e com elevado padrão de aproveitamento em carvão vegetal, a Sibipiruna na classe de densidade média pode ser utilizada em móveis e também em produção de carvão vegetal e a Tipuana como de densidade baixa ideal para fabricação de POM.
77 FR 32115 - Ocean Transportation Intermediary License Applicants
2012-05-31
... Individual), Lar D. Westerberg, CEO, Application Type: Add NVO Service. Jo-Sak Shipping USA, Inc. (NVO & OFF... Service. Waterline International Logistics, Inc. (NVO & OFF), 24178 Alicia Parkway, Mission Viejo, CA...
Protocolul persan de la Cirus cel Mare până la Chosroes I
Directory of Open Access Journals (Sweden)
Orest TĂRÎȚĂ
2017-12-01
Full Text Available În articol se abordează unele aspecte - cheie ale protocolului și ceremonialului persan din tim-pul celor patru perioade istorice ale statalității persane începând cu anul 700 până la Hristos și finalizând cu anul 651 ale erei creștine. Prin prisma analizei este trecută domnia lui Cirus al II-lea cel Mare – fondatorul Imperiului Per-san, care a introdus la curtea sa protocolul și ceremonialul pentru a-i debarasa pe persani de obiceiurile barbare și a-i familiariza cu subtilitățile bunelor maniere. Un spațiu aparte este rezervat perioadei sasanide (224 î. Hr. - 651, când curtea regală este con¬dusă de șeful de protocol, situat pe primul loc la curtea șahinșahului, fiind urmat de succesorul la tron, șeful regimentului de „nemuritori” și alte demnități; este descrisă scena încoronării lui Șapur I și ordinea ierarhică a înalților demnitari regali de la curtea sa, primirea cu onoruri a ambasa¬dorilor străini la curte și alaiurile publice ale șahinșahului, care urmăreau nu altceva decât să perpetueze măreția Marelui Imperiu, atât în interior, cât și în relațiile cu țările vecine.
Energy Technology Data Exchange (ETDEWEB)
Al-Mamgani, Abrahim, E-mail: a.almamgani@nki.nl [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands); Kwa, Stefan L.S.; Tans, Lisa; Moring, Michael; Fransen, Dennie; Mehilal, Robert; Verduijn, Gerda M. [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands); Baatenburg de Jong, Rob J. [Department of Otolaryngology and Head and Neck Surgery – Erasmus MC, University Medical Center Rotterdam, Rotterdam (Netherlands); Heijmen, Ben J.M.; Levendag, Peter C. [Department of Radiation Oncology – Erasmus MC Cancer Institute, University Medical Center Rotterdam, Rotterdam (Netherlands)
2015-10-01
Purpose: To report, from a retrospective analysis of prospectively collected data, on the feasibility, outcome, toxicity, and voice-handicap index (VHI) of patients with T1a glottic cancer treated by a novel intensity modulated radiation therapy technique developed at our institution to treat only the involved vocal cord: single vocal cord irradiation (SVCI). Methods and Materials: Thirty patients with T1a glottic cancer were treated by means of SVCI. Dose prescription was set to 16 × 3.63 Gy (total dose 58.08 Gy). The clinical target volume was the entire vocal cord. Setup verification was done by means of an online correction protocol using cone beam computed tomography. Data for voice quality assessment were collected prospectively at baseline, end of treatment, and 4, 6, and 12 weeks and 6, 12, and 18 months after treatment using VHI questionnaires. Results: After a median follow-up of 30 months (range, 7-50 months), the 2-year local control and overall survival rates were 100% and 90% because no single local recurrence was reported and 3 patients died because of comorbidity. All patients have completed the intended treatment schedule; no treatment interruptions and no grade 3 acute toxicity were reported. Grade 2 acute dermatitis or dysphagia was reported in only 5 patients (17%). No serious late toxicity was reported; only 1 patient developed temporary grade 2 laryngeal edema, and responded to a short-course of corticosteroid. The VHI improved significantly, from 33.5 at baseline to 9.5 and 10 at 6 weeks and 18 months, respectively (P<.001). The control group, treated to the whole larynx, had comparable local control rates (92.2% vs 100%, P=.24) but more acute toxicity (66% vs 17%, P<.0001) and higher VHI scores (23.8 and 16.7 at 6 weeks and 18 months, respectively, P<.0001). Conclusion: Single vocal cord irradiation is feasible and resulted in maximal local control rate at 2 years. The deterioration in VHI scores was slight and temporary and
Nemr, Katia; Cota, Ariane; Tsuji, Domingos; Simões-Zenari, Marcia
2018-01-01
OBJECTIVES: To characterize the voice quality of individuals with dysphonia and to investigate possible correlations between the degree of voice deviation (D) and scores on the Dysphonia Risk Screening Protocol-General (DRSP), the Voice-Related Quality of Life (V-RQOL) measure and the Voice Handicap Index, short version (VHI-10). METHODS: The sample included 200 individuals with dysphonia. Following laryngoscopy, the participants completed the DRSP, the V-RQOL measure, and the VHI-10; subsequently, voice samples were recorded for auditory-perceptual and acoustic analyses. The correlation between the score for each questionnaire and the overall degree of vocal deviation was analyzed, as was the correlation among the scores for the three questionnaires. RESULTS: Most of the participants (62%) were female, and the mean age of the sample was 49 years. The most common laryngeal diagnosis was organic dysphonia (79.5%). The mean D was 59.54, and the predominance of roughness had a mean of 54.74. All the participants exhibited at least one abnormal acoustic aspect. The mean questionnaire scores were DRSP, 44.7; V-RQOL, 57.1; and VHI-10, 16. An inverse correlation was found between the V-RQOL score and D; however, a positive correlation was found between both the VHI-10 and DRSP scores and D. CONCLUSION: A predominance of adult women, organic dysphonia, moderate voice deviation, high dysphonia risk, and low to moderate quality of life impact characterized our sample. There were correlations between the scores of each of the three questionnaires and the degree of voice deviation. It should be noted that the DRSP monitored the degree of dysphonia severity, which reinforces its applicability for patients with different laryngeal diagnoses. PMID:29538494
Darawsheh, Wesam B; Natour, Yaser S; Sada, Eve G
2018-07-01
This pilot study aimed to evaluate the internal consistency, convergent construct validity and criterion validity of Arabic version of the Vocal Tract Discomfort Scale (VTDS), and to investigate the correlation between the scores of the VTDS, the VHI and the acoustic measures of fundamental frequency (F0), shimmer, jitter and signal-to-noise ratio (SNR). A cross-sectional study where 97 participants participated (47 males and 50 females) (mean age 20.5 ± 2.1 years) (31 student singers and 66 other non-professional voice user students). Participants were without self-perceived voice disorders who completed the VTDS-Arab scale and the Voice Handicap Index (VHI-Arab), and recorded a vocal sample of/a:/at a comfortable level. A positive internal consistency that signifies reliability was confirmed by Cronbach's α = .884 and 0.874 for the VTDS-Arab frequency and severity subscales, respectively. A moderate positive correlation was found between the VTDS-Arab (frequency, severity, total) and the VHI-Arab total where values of Pearson's correlation coefficient were r= 0.459, 0.430 and 0.451, respectively. Weak correlations were found between all of the acoustic measures and the scores of the VTDS-Arab and VHI-Arab (total and subscales). The area under curve for the VTDS was AUC= 0.824, 0.804 and 0.817 for the VTDS frequency, VTDS severity and VTDS total, respectively. The VTDS-Arab is a valid and reliable tool in measuring vocal tract sensations and predicting the perception of vocal handicap in student singers and can be used to predict the vocal load among professional voice users.
B lymphocyte selection and age-related changes in VH gene usage in mutant Alicia rabbits.
Zhu, X; Boonthum, A; Zhai, S K; Knight, K L
1999-09-15
Young Alicia rabbits use VHa-negative genes, VHx and VHy, in most VDJ genes, and their serum Ig is VHa negative. However, as Alicia rabbits age, VHa2 allotype Ig is produced at high levels. We investigated which VH gene segments are used in the VDJ genes of a2 Ig-secreting hybridomas and of a2 Ig+ B cells from adult Alicia rabbits. We found that 21 of the 25 VDJ genes used the a2-encoding genes, VH4 or VH7; the other four VDJ genes used four unknown VH gene segments. Because VH4 and VH7 are rarely found in VDJ genes of normal or young Alicia rabbits, we investigated the timing of rearrangement of these genes in Alicia rabbits. During fetal development, VH4 was used in 60-80% of nonproductively rearranged VDJ genes, and VHx and VHy together were used in 10-26%. These data indicate that during B lymphopoiesis VH4 is preferentially rearranged. However, the percentage of productive VHx- and VHy-utilizing VDJ genes increased from 38% at day 21 of gestation to 89% at birth (gestation day 31), whereas the percentage of VH4-utilizing VDJ genes remained at 15%. These data suggest that during fetal development, either VH4-utilizing B-lineage cells are selectively eliminated, or B cells with VHx- and VHy-utilizing VDJ genes are selectively expanded, or both. The accumulation of peripheral VH4-utilizing a2 B cells with age indicates that these B cells might be selectively expanded in the periphery. We discuss the possible selection mechanisms that regulate VH gene segment usage in rabbit B cells during lymphopoiesis and in the periphery.
Directory of Open Access Journals (Sweden)
Daniele de Pinho Freitas Kneube
2006-07-01
Full Text Available Este trabalho investiga a ocorrência de anorexia nervosa e distúrbio de imagem corporal em 187 estudantes do ensino médio da cidade de Maringá, Estado do Paraná. O Índice de Massa Corporal (IMC e a classificação do estado nutricional foram utilizados para a avaliação antropométrica. A análise das respostas do questionário Body ShapeQuestionnaire (BSQ demonstrou que 66,1% das estudantes do sexo feminino apresentaram distúrbios de imagem corporal e somente 18,6% dos estudantes do sexo masculino apresentaram tal distúrbio. Com relação às respostas ao questionário Teste de Atitudes Alimentares (EAT, verificou-se que 10% do sexo masculino e 32% do sexo femininoapresentaram sintomatologia anoréxica. Os resultados sugerem uma elevada incidência da anorexia nervosa na população estudada bem como uma significativa presença de distorção da imagem corporal. As informações são relevantes para estudos clínicos voltados paraorientação nutricional dos adolescentes visando à reeducação alimentar.This study investigates the occurrence of nervous anorexy and body image disorders in 187 middle school students in the city of Maringá, State of Paraná, Brazil. Body Mass Index (BMI and the classification of the nutritional state were used to the anthropometrical evaluation. The analysis of the questionnaire BSQ answers demonstrated that 66.1% of female students presented the body image disorder, and only 18.6% of male students presented such disorder. Regarding the questionnaire EAT answers, the analysis showed that 32% female and 10% male sex presented anorexic symptoms. The obtained results indicated high incidence of nervous anorexy in the population studied as well as a significant presence of body image distortion.These results are relevant to clinic studies of teenagers, mainly those directing to future studies on nutritional orientation focusing on alimentary reeducation.
Aydınlı, Fatma Esen; Özcebe, Esra; Kulak Kayıkçı, Maviş E; Yılmaz, Taner; Özgür, Fatma F
2016-11-01
The aim was to investigate the effects of glottal stop productions (GS) on voice in children with cleft palate using multidimensional voice assessment methods. This is a prospective case-control study. Children with repaired cleft palate (n = 34) who did not have any vocal fold lesions were separated into two groups based on the results of the articulation test. The glottal stop group (GSG) consisted of 17 children who had GS. The control group (CG) consisted of an equal number of age- and gender-matched children who did not have GS. The voice evaluation protocol included acoustic analysis, Pediatric Voice Handicap Index (pVHI), and perceptual analysis (Grade, Roughness, Breathiness, Asthenia, Strain method). The velopharyngeal statuses of the groups were compared using the nasopharyngoscopy and the nasometer. The total pVHI score and the subscales of the pVHI were found to be significantly higher in the GSG. The F0, jitter, and shimmer were found to be numerically higher in the GSG with the difference being statistically significant in jitter (P speech and language pathology intervention including voice therapy techniques. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Esposito, Marcello; Dubbioso, R; Apisa, P; Allocca, R; Santoro, L; Cesari, U
2015-09-01
Spasmodic dysphonia (SD) is a focal dystonia of laryngeal muscles seriously impairing quality of voice. Adductor SD (ADSD) is the most common presentation of this disorder that can be identified by specialized phoniatricians and neurologists firstly on a clinical evaluation and then confirmed by videolaryngoscopy (VL). Botulinum toxin (BTX) injection with electromyographic guidance in muscles around vocal cords is the most effective treatment. Voice Handicap Index (VHI) questionnaire is the main tool to assess dysphonia and response to treatment. Objective of this study is to perform VL and voice spectrography (VS) to confirm the efficacy of BTX injections over time. 13 patients with ADSD were studied with VHI, VL and VS before and after 4 consecutive treatment with onobotulinumtoxin-A. For each treatment vocal improvement was proved by a significant reduction of VHI score and increase of maximum time phonation and harmonic-to-noise ratio while VL showed the absence of spasm in most of patients. No change of the response to BTX was found between injections. This study supports the efficacy of the treatment of SD with BTX with objective measurements and suggests that the efficacy of recurring treatments is stable over time.
Graafika Filharmoonias : Harry Liivrand soovitab / Harry Liivrand
Liivrand, Harry, 1961-
2004-01-01
Alustatakse regulaarse kunstinäituse programmiga Estonia Kontserdisaalis. Avatakse graafikanäitus "Lähenemised" (koostaja Vappu Vabar). Osalevad Marje Üksine, Reti Saks, Maria-Kristiina Ulas, Kelli Kagovere, Naima Neidre jt
Eduard Odinets : "Olen eestlane, kelle emakeel on vene keel" / Eduard Odinets ; interv. Erik Kalda
Odinets, Eduard, 1976-
2006-01-01
Ilmunud ka: Severnoje Poberezhje Ilmunud ka: Severnoje Poberezhje : Subbota 3. juuni lk. 3. Riigikogu sotsiaaldemokraatide fraktsiooni nõunik oma poliitikukarjäärist. Arvamust avaldab Katrin Saks ja Meelis Goldberg (Severnoje Pob.)
International conference "Cultural Plurality in Estonia : Policies and Solutions"
2000-01-01
Ettekandjad: Katrin Saks, Mall Hellam, Mati Luik, Kirsti Häkkinen, Vello Pettai, Ivi Proos, Katri Raik, NiinaOrhimenko, Ib Ostergaard Rasmussen, Urve Läänemets, Jüri Valge, Aleksander Dusman, Raivo Juurak, Rein Ruutsoo
Directory of Open Access Journals (Sweden)
Carlos de Barros Júnior
2012-01-01
Full Text Available The physic-chemical characteristics of leach deposited in the landfill waste pond and of water from the Borba Gato streamlet are evaluated. Twenty-six physic-chemical parameters were analyzed from three collection sites, or rather, two in the streamlet, one upstream (P-01 and one downstream (P-02 of the landfill waste pond, and one in the leach deposit pond (P-03. The streamlet area under analysis was impacted due to being in an agricultural area and for its urban waste deposits. Parameter concentrations of aluminum, iron and mercury were reported above the quality standard of freshwater, according to Conama 357/2005 resolution (class 2. Further, throughout the rainy period, the ammoniac nitrogen content was above the resolution quality standard for fresh water. Moreover, landfill leach was above standards of effluent discharge established by Conama 357/2005. An efficient treatment for the effluent generated in Maringá is required since there is evidence of leach pollution of the Borba Gato streamlet.Este estudo teve como objetivo avaliar as características físico-químicas do lixiviado depositado na lagoa do aterro e da água do ribeirão Borba Gato. Foram analisados 26 parâmetros físico-químicos de três pontos de coletas, dois no ribeirão, a montante (P-01 e a jusante (P-02 do aterro de resíduos, e um na lagoa de depósito de percolado do aterro (P-03. A área do ribeirão estudada se apresentou impactada, por ser uma região agrícola e pela deposição dos resíduos de Maringá. Dentre os parâmetros estudados, registrou-se que, na maioria dos meses, concentrações de alumínio, ferro e mercúrio estavam acima do padrão de qualidade de água doce da resolução do Conama 357/2005 (Classe 2. Além disso, verificou-se que no período chuvoso, P-02 registrou teores de nitrogênio amoniacal acima do padrão de qualidade de água doce da resolução, assim como o lixiviado do aterro apresentou-se acima do padrão do lançamento de
Harmonisasi SAK dan Aturan Pajak: Mungkinkah?
Directory of Open Access Journals (Sweden)
Heri Sukendar Sukendar
2014-11-01
Full Text Available This paper is intended to illustrate the fact that the case today, especially in Indonesia's commitment to convergency of IFRS, where the decision was certainly not out of global importance that in order to improve the information from the financial statements of companies in Indonesia. In addition, the IFRS Convergence is one of the Indonesian government agreements as a member of the G20 forum, the results of the meeting of G20 leaders in Washington DC forum, 15 November 2008. On the other hand, the tax rules that apply are still using the old accounting standards and do not follow the development of increasingly different. Previous differences between GAAP and tax rules are limited to the "deductible and non-deductible" which is resolved through fiscal reconciliation mechanism with positive correction and correction negatipnya. The widening gap today would be a separate issue for IAI as the organization of the accounting profession. Tax Accountant compartment formation in March 2014 is a serious evidence of the organization as an anticipation, particularly in an effort to bridge the gap widening
METHANE HYDRATE PRODUCTION FROM ALASKAN PERMAFROST
Energy Technology Data Exchange (ETDEWEB)
Richard Sigal; Kent Newsham; Thomas Williams; Barry Freifeld; Timothy Kneafsey; Carl Sondergeld; Shandra Rai; Jonathan Kwan; Stephen Kirby; Robert Kleinberg; Doug Griffin
2005-02-01
Natural-gas hydrates have been encountered beneath the permafrost and considered a nuisance by the oil and gas industry for years. Engineers working in Russia, Canada and the USA have documented numerous drilling problems, including kicks and uncontrolled gas releases, in arctic regions. Information has been generated in laboratory studies pertaining to the extent, volume, chemistry and phase behavior of gas hydrates. Scientists studying hydrate potential agree that the potential is great--on the North Slope of Alaska alone, it has been estimated at 590 TCF. However, little information has been obtained on physical samples taken from actual rock containing hydrates. The work scope drilled and cored a well The Hot Ice No. 1 on Anadarko leases beginning in FY 2003 and completed in 2004. An on-site core analysis laboratory was built and utilized for determining the physical characteristics of the hydrates and surrounding rock. The well was drilled from a new Anadarko Arctic Platform that has a minimal footprint and environmental impact. The final efforts of the project are to correlate geology, geophysics, logs, and drilling and production data and provide this information to scientists developing reservoir models. No gas hydrates were encountered in this well; however, a wealth of information was generated and is contained in this report. The Hot Ice No. 1 well was drilled from the surface to a measured depth of 2300 ft. There was almost 100% core recovery from the bottom of surface casing at 107 ft to total depth. Based on the best estimate of the bottom of the methane hydrate stability zone (which used new data obtained from Hot Ice No. 1 and new analysis of data from adjacent wells), core was recovered over its complete range. Approximately 580 ft of porous, mostly frozen, sandstone and 155 of conglomerate were recovered in the Ugnu Formation and approximately 215 ft of porous sandstone were recovered in the West Sak Formation. There were gas shows in the bottom
Directory of Open Access Journals (Sweden)
Carlos de Barros Júnior
2003-04-01
Full Text Available Este trabalho apresenta um modelo de gestão integrada dos resíduos sólidos urbanos para a cidade de Maringá, o qual além do seu caráter tecnológico moderno, com base nos resultados obtidos nesta pesquisa, constitui-se em uma integração entre as várias fases, principalmente na coleta diferenciada, com as várias formas de tratamento/destino final, que levam a um menor impacto ambiental, social e econômico, buscando o resgate da cidadania, por meio da garantia de melhores condições de vida para os segmentos menos favorecidos da sociedade e de melhor qualidade de vida. O modelo consta de um sistema de gerenciamento integrado, composto por: coleta segregada, coleta seletiva, unidades de triagem, unidade de compostagem e aterro sanitário. O trabalho apresenta um enfoque sobre a situação atual na questão dos resíduos sólidos urbanos na cidade de Maringá e prevê uma ação de remediação e fechamento do lixão, iniciando-se com a formulação de um modelo tecnológico, da implantação do projeto e de seu monitoramento.
Directory of Open Access Journals (Sweden)
Suzana de Paiva
2005-09-01
Full Text Available Hypostomus strigaticeps and two morphotypes of Hypostomus were collected from Ribeirão Maringá, a small tributary of the Rio Pirapó, an effluent of the upper Rio Paraná. The three populations were analyzed by allozyme electrophoresis that allowed the scoring of 25 loci from 14 enzyme systems. Heterozygosity values (He were 0.028 in H. strigaticeps, 0.027 in Hypostomus sp. 1 and zero in Hypostomus sp. 2. Several diagnostic loci and fixed differences were observed for each population at loci Acp-A, Gcdh-A and Mdhp-A. Thus, all populations were genetically distinct, although there were many common alleles. The unbiased genetic identities of Nei (I were estimated as 0.780 for Hypostomus sp. 1 and H. strigaticeps, 0.357 for H. strigaticeps and Hypostomus sp. 2 and 0.322 for Hypostomus sp. 1 and Hypostomus sp. 2. The data indicate that the two morphotypes are distinct species from Hypostomus strigaticeps.
Does CPAP treatment affect the voice?
Saylam, Güleser; Şahin, Mustafa; Demiral, Dilek; Bayır, Ömer; Yüceege, Melike Bağnu; Çadallı Tatar, Emel; Korkmaz, Mehmet Hakan
2016-12-20
The aim of this study was to investigate alterations in voice parameters among patients using continuous positive airway pressure (CPAP) for the treatment of obstructive sleep apnea syndrome. Patients with an indication for CPAP treatment without any voice problems and with normal laryngeal findings were included and voice parameters were evaluated before and 1 and 6 months after CPAP. Videolaryngostroboscopic findings, a self-rated scale (Voice Handicap Index-10, VHI-10), perceptual voice quality assessment (GRBAS: grade, roughness, breathiness, asthenia, strain), and acoustic parameters were compared. Data from 70 subjects (48 men and 22 women) with a mean age of 44.2 ± 6.0 years were evaluated. When compared with the pre-CPAP treatment period, there was a significant increase in the VHI-10 score after 1 month of treatment and in VHI- 10 and total GRBAS scores, jitter percent (P = 0.01), shimmer percent, noise-to-harmonic ratio, and voice turbulence index after 6 months of treatment. Vague negative effects on voice parameters after the first month of CPAP treatment became more evident after 6 months. We demonstrated nonsevere alterations in the voice quality of patients under CPAP treatment. Given that CPAP is a long-term treatment it is important to keep these alterations in mind.
Reval Hotel Lietuva Vilniuses : Konstitucijos pr. 20 / Piret Lindpere
Lindpere, Piret, 1963-
2004-01-01
Vilniuse hotelli "Lietuva" renoveerimine. Arhitektuurse projekti koostaja Rootsi arhitektuuribüroo AB SWECO (arhitektid Aare Saks, Nils Palm. Sisekujundus: Vaikla Disain AS (Katrin ja Argo Vaikla, Liis Lindvere, Peeter Loo). Kommenteerivad Argo ja Katrin Vaikla. 3 ill
On Zweier Sequence Spaces and de la Vall\\'{e}e-Poussin mean of order $\\alpha$
Directory of Open Access Journals (Sweden)
Bipan Hazarika
2016-07-01
Full Text Available The main purpose of this paper is to study some geometrical properties such as order continuous, the Fatou property and the Banach-Saks property of the new space $[\\mathcal{Z}_{\\lambda}^{\\alpha}]_{\\infty}(p.$
DEFF Research Database (Denmark)
Argo, C.M.; Cox, J.E.; Lockyer, C.
2002-01-01
Seven, 3-year-old pony mares (similar to230 kg) were used in a cross-over study to compare the appetite, energy and nutrient digestibilities, growth rate and feeding behaviour, when a complete diet was offered ad libitum in either the original loose-chaff mix (C), or as a more convenient, milled...... provision continued for a further 4 weeks. Behaviour and apparent nutrient digestibilities were assessed in weeks 3 and 4 of each period. Pelleted food had a lower proportion of water (P, 0.12; C, 0.22), but relative proportions of oil (0.04), crude protein (0.08), crude fibre (0.29), neutral....... Following transfer from pellets to chaff, DEI decreased (P behaviour caused no detectable change in the appetite...
Directory of Open Access Journals (Sweden)
Lucila Akiko Nagashima
2007-07-01
Full Text Available Os resíduos sólidos de serviços de saúde (RSSS representam reduzida parcela do total dos resíduos sólidos urbanos gerados diariamente por uma cidade. Considerando a própria origem, parte desses resíduos apresenta riscos e dificuldades especiais em seu manejo, devido especialmente ao caráter infeccioso de alguns componentes. Estasconstatações associadas à necessidade de conhecer a situação dos RSSS do Hospital Universitário Regional de Maringá motivaram a elaboração do estudo. A pesquisa buscou identificar as diferentes fontes geradoras, caracterizar qualitativa e quantitativamente osresíduos gerados determinando a taxa de geração diária. A caracterização foi efetuada mediante a pesagem dos resíduos, acompanhamento das atividades internas do hospital, quanto aos procedimentos de coleta, armazenamento interno e externo e transporte de seus resíduos sólidos. Constatou-se que do total de resíduos gerados, cerca de 53% são considerados contaminados, percentual creditado como não-satisfatório para uma parcela significante de bibliografia consultada.Solid health-care waste (SHCW represents only a small fraction of the total urban solid waste generated daily in a city. Taking its origin into consideration, part of this waste presents risks and special difficulties in handling, especially due to the infectious aspects of some components. The elaboration of study was motivated by these findings, associated with the need to find out the conditions of the SHCW from the Maringá Regional University Hospital. The research attempted to identify the different generating sources, quantifying and qualifying the generated waste, and determining the daily generated rate. The characterization was done by weighing the waste, observing internal hospital activities regarding collection procedures, internal and external storage and transportation of the waste. It was verified that from the total generated waste, around 53% is considered
Basilevsky, A. T.; Abdrakhimov, A. M.; Head, J. W.; Pieters, C. M.; Wu, Yunzhao; Xiao, Long
2015-11-01
We compared and assessed the results of measurements and observations by the Lunokhod 1 and Yutu rovers, both of which explored the northwestern part of Mare Imbrium. Both sites are within the distinctive Eratosthenian-aged lava flow geologic unit and our comparisons showed that the geologies of these exploration sites are very similar. As in the majority of other areas of the Moon, the dominant landforms in these sites are small impact craters, having various degrees of morphologic prominence and states of preservation, and rock fragments, mostly associated with the rims and interiors of fresh craters. The shape and the degree of preservation of the observed rock fragments in these two sites are similar. In both sites sporadic rock fragments were observed whose morphologies suggest that their source rocks had columnar jointing. Localization of these specific rocks on the rims of 450-470 m in diameter craters implies that the source rocks are at depths of 40-50 m. Regolith in the study areas is typically a few meters thick, but locally can be much thicker. The ground penetrating radar of the Yutu rover revealed the multilayer regolith structure, which is determined by superposition of crater ejecta; with some local variations, this type of the regolith stratigraphy should be typical of the majority of lunar mare sites. The physico-mechanical properties of the regolith in these two sites appear to be rather similar: the bearing capacity ranges from 0.04 to 1.44 kg/cm2, with a modal value ∼0.45 kg/cm2, and the shear strength ranges from 0.02 to 0.1 kg/cm2, with a modal value ∼0.05 kg/cm2. Both these factors decrease by a factor of 3-4 with an increase of surface slope from ∼2 to 12°. The chemical composition of surface materials determined by the rover instruments at these two sites differ from those derived from the remote sensing data for the Eratosthenian-aged basalts on which the two sites are located. This could be partly due to low measurement accuracies
The Use of Pocket Electronic Dictionaries by Thai University Students
Directory of Open Access Journals (Sweden)
Atipat Boonmoh
2011-10-01
Full Text Available
ABSTRACT: This article reports on a small-scale study of Thai-speaking learners using pocket electronic dictionaries (PEDs to read an English news article. It investigates how the subjects use their PEDs for reading comprehension. Thirty-nine undergraduate students completed a questionnaire survey. Of these, four were chosen to participate in the experiment. Observations and interviews were utilized to ascertain how the subjects used their PEDs. The findings showed superficial and partial reading of the dictionary entries. It also revealed several factors that may hinder dictionary look-up success. On the basis of this research, guidelines for buying PEDs and for teaching PED skills are proposed.
OPSOMMING: Die gebruik van sak- elektroniese woordeboeke deur Thaise universiteitstudente. Hierdie artikel doen verslag van 'n kleinskaalse studie van Thaisprekende aanleerders wat sak- elektroniese woordeboeke (SEW's gebruik om 'n Engelse nuusartikel te lees. Dit ondersoek hoe die proefpersone hul SAW's gebruik vir leesbegrip. Nege-en-dertig voorgraadse studente het 'n vraelysopname voltooi. Uit hulle is vier gekies om aan die eksperiment deel te neem. Waarnemings en onderhoude is aangewend om te bepaal hoe die proefpersone hul SEW's gebruik het. Die bevindings het oppervlakkige en gedeeltelike lees van die woordeboekinskrywings getoon. Dit het ook verskeie faktore uitgewys wat woordeboekopsoeksukses mag belemmer. Op grond van hierdie navorsing word riglyne vir die koop van SEW's en vir die onderrig van SEWvaardighede voorgestel.
Sleutelwoorde: WOORDEBOEKGEBRUIK, SAK- ELEKTRONIESE WOORDEBOEK, WOORDEBOEKRAADPLEGING, EENTALIGE WOORDEBOEK, TWEETALIGE WOORDEBOEK
Targeting the Oxidative Stress Response System of Fungi with Redox-Potent Chemosensitizing Agents
Kim, Jong H.; Chan, Kathleen L.; Faria, Natália C. G.; Martins, M. de L.; Campbell, Bruce C.
2012-01-01
The cellular antioxidant system is a target in the antifungal action of amphotericin B (AMB) and itraconazole (ITZ), in filamentous fungi. The sakAΔ mutant of Aspergillus fumigatus, a mitogen-activated protein kinase (MAPK) gene deletion mutant in the antioxidant system, was found to be more sensitive to AMB or ITZ than other A. fumigatus strains, a wild type and a mpkCΔ mutant (a MAPK gene deletion mutant in the polyalcohol sugar utilization system). Complete fungal kill (≥99.9%) by ITZ or AMB was also achieved by much lower dosages for the sakAΔ mutant than for the other strains. It appears msnA, an Aspergillus ortholog to Saccharomyces cerevisiae MSN2 (encoding a stress-responsive C2H2-type zinc-finger regulator) and sakA and/or mpkC (upstream MAPKs) are in the same stress response network under tert-butyl hydroperoxide (t-BuOOH)-, hydrogen peroxide (H2O2)- or AMB-triggered toxicity. Of note is that ITZ-sensitive yeast pathogens were also sensitive to t-BuOOH, showing a connection between ITZ sensitivity and antioxidant capacity of fungi. Enhanced antifungal activity of AMB or ITZ was achieved when these drugs were co-applied with redox-potent natural compounds, 2,3-dihydroxybenzaldehyde, thymol or salicylaldehyde, as chemosensitizing agents. We concluded that redox-potent compounds, which target the antioxidant system in fungi, possess a chemosensitizing capacity to enhance efficacy of conventional drugs. PMID:22438852
Directory of Open Access Journals (Sweden)
Sandra Valéria Inácio
2012-12-01
Full Text Available The present study aimed to analyze the occurrence of infection by Cryptosporidium spp. in mares and their respective foals. This study was carried out in 11 farms located in the municipalities of Araçatuba, Birigui, Guararapes and Santo Antônio do Aracangua, in the northwest region of the State of Sao Paulo, from November 2010 to March 2011. A total of 98 mares and 98 foals of several breeds were analyzed; among foals, 59 were males and 39 females, aged from three to 330 days. Feces were collected directly from the rectal ampulla, purified and processed according to modified Kinyoun stain. Occurrence of Cryptosporidium spp. was 21.4% (21/98 for foals and 18.4% (18/98 for mares. Occurrence of Cryptosporidium spp. had significant association with breeds and age of animals. Results obtained led to the conclusion that foals older than two months and Mangalarga animals are less susceptible to the occurrence of Cryptosporidium spp.O presente estudo teve como objetivo analisar a ocorrência da infecção por Cryptosporidium spp. em éguas e seus respectivos potros. Este estudo foi realizado em 11 fazendas localizadas nos municípios de Araçatuba, Birigui, Guararapes e Santo Antônio do Aracangua, na região Noroeste do Estado de São Paulo, de novembro de 2010 a março de 2011. Um total de 98 éguas e 98 potros de diversas raças foram analisados, sendo que, entre os filhotes, 59 eram machos e 39 fêmeas, cujas idades variavam de três até 330 dias. Fezes foram colhidas diretamente da ampola retal, purificadas e processadas pela técnica de Kinyoun modificada. A ocorrência de Cryptosporidium spp. observada foi de 21,4% (21/98 para potros e 18,4% (18/98 para éguas. A ocorrência de Cryptosporidium spp. teve uma associação significativa com a raça e a idade dos animais. A partir dos resultados obtidos, conclui-se neste estudo que potros com idade superior a dois meses e animais da raça Mangalarga foram menos susceptíveis à ocorrência de
Directory of Open Access Journals (Sweden)
Ana Carolina Schiavon
2008-03-01
Full Text Available O objetivo deste trabalho é determinar as características dos pacientes atendidos no Hospital Universitário de Maringá (HUM, com ferimento por arma branca (FAB e por arma de fogo (FAF, quanto ao sexo, idade, às regiões corporais, órgãos mais atingidos, tempo de internamento, complicações e mortalidade. Após análise de uma planilha elaborada para a pesquisa, observou-se que 68% dos atendimentos foram por FAB e 32%, por FAF, sendo a maioria homens (mais de 90%, adultos jovens (2ª e 3ª década, por FAF e FAB, respectivamente. As regiões mais acometidas foram abdome e tórax. e os órgãos mais atingidos foram intestino delgado e fígado, na lesão por arma branca, e fígado e intestino delgado, no FAF. A complicação mais comum foi o choque hipovolêmico. Concluiu-se que os FAB ocorreram em maior número no sexo masculino, na terceira década de vidaThe objective of this study is to determine the characteristics of patients assisted at the University Hospital of Maringá (HUM with wounds from edged weapons (EWW or firearms (FW, in regards to gender, age, wounded body areas, most affected body organs, length of hospitalization, complications and mortality rates. After the analysis of a worksheet elaborated for the study, it was observed that 68% of admissions had been for EWW and 32% for FW. The majority were men (90% and young adults (20s and 30s, for FW and EWW, respectively. The most affected body areas were the abdomen and thorax, and the most wounded organs were, in order: the small intestine and liver for EWW, and the liver and small intestine for FW. The most common complication was hypovolemic shock. It was concluded that EWW had occurred in larger numbers than FW, with predominance in males in their 30s
Effect of pregnant mare serum gonadotrophin injection on litter size in young Etawah-cross does
Directory of Open Access Journals (Sweden)
N.M Artiningsihi
1996-03-01
Full Text Available The incidence of twins and/or multiple births in 20 heads of young Etawah-cross does was studied following oestrous synchronization using intravaginal sponges containing 60 mg medroxyprogesterorle acetate (Repromap for 15 days . Twenty four hours priorto sponges withdrawal, the does were injected with pregnant mare serum gonadotrophin (PMSG at dose rates of 0 (Group A, 10 (Group B, 15 (Group C and 20 iu/kg (Group D body weight. Amature buck fitted with an apron was used to detect the onset of oestrus at every four hours. The oestrous doe was naturally mated twice, 12 hours after onset of oestrus and 10 hours later. About 3-5 days after oestrus, all does were subjected to mid-ventral laparoscopy to detect ovulation rate . Two months after mating all does were subjected to pregnancy test using diagnostic ultrasonography. Results showed that all does exhibited clear sign of oestrus. The onset of oestrus occurred 15-43 hours after sponges withdrawal or 39-59 hours after PMSG injection. Does injected with PMSG (Groups B, C and D showed oestrus 16-21 hours earlier (P0 .05 than that of control (Group A . However, there was no significant differences among the PMSG-treated groups . Ovulation rates increased from 1.0 in Group Ato 1.8 in Group B and 2.6 in bah Groups Cand D. Average litter size in Groups A, B, C and D were 1.0, 1.8, 2.4 and 1.0, respectively. It was concluded that injection of 15 iu PMSG/kg body weight gave the best result for increasing litter size in young Etawah-cross does .
Challenges in Utilising Key Leader Engagement in Civil-Military Operations
2011-06-01
experience from Afghanistan represented different organisations: Swedish Armed Forces (SwAF), Swedish International Development Cooperation Agency ( Sida ...with Swedish civil and military personnel • Extensive experience from several missions, focus on Afghanistan • Organisations: SwAF, Sida , SAK and
Arvutijuhtimisega korter annab omanikule kontrolli / Siiri Suutre
Suutre, Siiri
2007-01-01
Järgmisel aastal valmib Tallinnas Juurdeveo 19 maja, kus korteriomanikel on pidev virtuaalne juurdepääs oma kodule. Projekteerijad Harry Klaar ja Kätlin Saks arhitektuuribüroost On Arhitektid. Tehnoloogiline lahendus AS Eltron ja Yoga Intelligence AS
Directory of Open Access Journals (Sweden)
Fabio Angeoletto
2014-11-01
Full Text Available Resumen: Patios urbanos tienen un potencial considerable para la conservación de la biodiversidad y la mejora de la seguridad alimentaria. Sin embargo, estos espacios no son planificados, y existe poca información sobre la diversidad de la flora presente en los patios de las diferentes clases sociales. Hemos cuantificado y comparado la diversidad vegetal de los patios de dos barrios de la zona metropolitana de Maringá (Paraná, Brasil, mediante el cálculo de índices de diversidad, correlaciones bivariadas y del potencial de plantíos, y trazamos directrices de planificación, con el objetivo de aumentar la presencia de la vegetación arbórea, fortalecer la seguridad alimentaria y contribuir a la conservación de la diversidad biológica, incluyéndose la conservación de las especies de plantas en peligro de extinción.
Directory of Open Access Journals (Sweden)
Josiane Miyaji Daniel
2008-12-01
Full Text Available De todas as mortes por causas externas por trauma, metade poderia ser evitada, e um terço delas é dito potencialmente evitável. Objetiva-se determinar as características comuns referentes ao paciente com traumatismo abdominal. Realizou-se um estudo de 57 casos de pacientes com traumatismo abdominal atendidos no Hospital Universitário Regional de Maringá, no período de janeiro a dezembro de 2006. Constatou-se que a maioria das vítimas é do sexo masculino; a faixa etária mais acometida é a terceira década de vida; o trauma abdominal aberto mostrou-se discretamente mais frequente, sendo o ferimento por arma branca mais comum; a maioria das contusões abdominais se deveu a acidentes de trânsito; a realização de intervenção cirúrgica supera o tratamento conservador nos traumas abdominais abertos; nos traumas contusos, o baço e os rins foram os órgãos mais acometidos, enquanto nos ferimentos abertos a víscera mais acometida foi o intestino delgado; a evolução para óbito predominou nos traumas abdominais abertos. Em virtude da prevalência, gravidade e importância do tema, sugere-se que mais estudos sejam realizados para que, assim, seja possível estabelecer condutas cada vez mais apropriadas à realidade do Sistema Único de Saúde.Of all the deaths due to external cause trauma, half could be avoided, and a third are potentially preventable. The objective of this study was to determine the common characteristics related to patients with abdominal trauma. A study was conducted of 57 cases of abdominal trauma at the University Hospital of Maringá, during the period from January to December 2006. The majority of victims are male; the most affected age group is in its third decade of life; open abdominal trauma proved to be slightly more prevalent, and wounds from cold steel weapons were the most common; most abdominal injuries were due to traffic accidents; the conduct of surgical intervention overcomes conservative treatment
Directory of Open Access Journals (Sweden)
Evi Tahapari
2014-06-01
Full Text Available The success of spawning is influenced by internal and external factors. One of the factors that affect the var iabi li ty of Pangasianodon hypophthalmus female reproductive is the change of seasons that cause disrupted continuity of the seed availability, especially in the dry season. In the present study, combination of PMSG (pregnant mare serum gonadotropin + HCG (hormone chorionic gonadotropin hormone injections was done to induce gonad development. The treatments in this study were without hormone injections as control (A, injection of PMSG 10 IU/kg + HCG 10 IU/kg (B, and injection of PMSG 20 IU/kg HCG + 10 IU/kg (C. Injections were conducted at intervals of two weeks as many as six times. The results showed that gonad maturation generally occurs 2-4 weeks after estradiol-17 peak. PMSG + HCG hormone injections gave a significant effect on increasing the quantity and quality of eggs production. The fecundity in the A, B, C treatments, were 233,700±220,676; 300,305±24,581 and 488,433±142,228; respectively. Number of larvae produced from the A, B, C treatments, were 156,979±170,838; 229,997±18,081 and 362,713±101,850; respectively. Combination of PMSG 20 IU/kg + HCG 10 IU/kg hormone injection gave the best result on fecundity and the number of larvae production.
Climate change and urbanization threaten water resources in South ...
International Development Research Centre (IDRC) Digital Library (Canada)
2014-08-14
Aug 14, 2014 ... JAGP: Have you found that climate-related pressures are related to ... SAK: We found that urbanization and climate change have put extra stress on water ... JAGP: Will the research team continue to work together on water ...
Müller-Unterberg, Maarit; Wallmann, Sandra; Distl, Ottmar
2017-10-18
The Black Forest Draught horse (BFDH) is an endangered German coldblood breed with its origin in the area of the Black Forest in South Germany. In this retrospective study, the influence of the inbreeding coefficient on foaling rates was investigated using records from ten breeding seasons. Due to the small population size of BFDH, the level of inbreeding is increasing and may have an effect on foaling rates.The data of the present study included all coverings reported for 1024 BFDH mares in the years 2001-2009. These mares were covered by 32 BFDH stallions from the State Stud Marbach. Data from 4534 estrus cycles was used to calculate per cycle foaling rate (CFR). Pedigree data contained all studbook data up to the foundation of the breed as early as 1836. The level of inbreeding of the mare, stallion and expected foal along with other systematic effects on CFR were analysed using a generalized linear mixed model approach. Stallion was employed as a random effect. Systematic fixed effects were month of mating, mating type, age of the mare and stallion, reproductive status of the mare and stallion line of the mare. Inbreeding coefficients of the stallion, mare and expected foal were modelled as linear covariates. The average CFR was 40.9%. The mean inbreeding coefficients of the mares, stallions and expected foals were 7.46, 7.70 and 9.66%. Mating type, age of the mare, reproductive status of the mare and stallion line of the mare had a significant effect. The results showed that the mating type, stallion line of the mare, sire, age and reproductive status of the mare exerted the largest influences on CFR in BFDH. Inbreeding coefficients of the stallion, mare and expected foal were not significantly related with CFR.
Voice-related of quality of life after treatment for laryngeal cancer
International Nuclear Information System (INIS)
Oridate, Nobuhiko; Furuta, Yasushi; Homma, Akihiro; Suzuki, Seigo; Suzuki, Fumiyuki; Hatakeyama, Hiromitsu; Taki, Shigenari; Sakashita, Tomohiro; Fukuda, Satoshi
2007-01-01
There are many methods of treating laryngeal cancers: definitive irradiation with or without concurrent chemotherapy, endoscopic laser surgery, partial surgery techniques, and total laryngectomy. Few studies have been reported on vocal function and quality of life of patients after the definitive treatment for laryngeal cancer, using single voice related QOL measures. The aim of this study was to examine voice related QOL in patients treated with various modalities using a Voice-Related Quality of Life (V-RQOL) questionnaire as well as Voice Handicap Index-10 (VHI-10) questionnaire. Between August 2006 and May 2007, survey data on voice utilizing the V-RQOL and VHI-10 were obtained from a total of 130 patients who had received definitive treatment for laryngeal cancers with follow-up at the Hokkaido University Hospital, and who were alive with no evidence of malignancy at the time of survey. Mean V-RQOL scores of the patients who received radiation therapy (n=63), chemoradiotherapy (n=29), laser resection (n=14) and total laryngectomy (n=27) as the final treatment for laryngeal cancer were 92.6, 92.9, 85.5, and 68.4, respectively. Mean VHI-10 values were 2.87, 2.34, 5.43, and 11.26. Such measures of quality of life are important endpoints to help judge the overall effectiveness of treatment options for laryngeal cancers. (author)
Jafari, Narges; Salehi, Abolfazl; Izadi, Farzad; Talebian Moghadam, Saeed; Ebadi, Abbas; Dabirmoghadam, Payman; Faham, Maryam; Shahbazi, Mehdi
2017-07-01
Muscle tension dysphonia (MTD) is a functional dysphonia, which appears with an excessive tension in the intrinsic and extrinsic laryngeal musculatures. MTD can affect voice quality and quality of life. The purpose of the present study was to assess the effectiveness of vocal function exercises (VFEs) on perceptual and self-assessment ratings in a group of 15 subjects with MTD. The study comprised 15 subjects with MTD (8 men and 7 women, mean age 39.8 years, standard deviation 10.6, age range 24-62 years). All participants were native Persian speakers who underwent a 6-week course of VFEs. The Voice Handicap Index (VHI) (the self-assessment scale) and Grade, Roughness, Breathiness, Asthenia, Strain (GRBAS) scale (perceptual rating of voice quality) were used to compare pre- and post-VFEs. GRBAS data of patients before and after VFEs were compared using Wilcoxon signed-rank test, and VHI data of patients pre- and post-VFEs were compared using Student paired t test. These perceptual parameters showed a statistically significant improvement in subjects with MTD after voice therapy (significant at P self-assessment ratings measurements (with the VHI). As a result, the data provide evidence regarding the efficacy of VFEs in the treatment of patients with MTD. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Impact of Perioperative Voice Therapy on Outcomes in the Surgical Management of Vocal Fold Cysts.
Tibbetts, Kathleen M; Dominguez, Laura M; Simpson, C Blake
2018-05-01
Vocal fold cysts are benign mid-membranous lesions of the true vocal fold, classified as mucus retention or epidermal inclusion cysts. Treatment is surgical excision with or without postoperative voice therapy. A retrospective review was performed of the demographics, treatment approach, and outcomes of patients treated for vocal fold cysts between 2009 and 2014. Voice Handicap Index (VHI)-10 scores before and after treatment were compared using the Wilcoxon Rank-Sum test and the two-tailed Student's t test. Videostroboscopy examinations were reviewed for posttreatment changes in vibratory characteristics of the vocal folds. Twenty-five patients were identified, and one was excluded for incomplete records. Mean age was 41.9 years (66.7% female), and mean follow-up time was 5.58 months. Microflap excision was pursued by 21/24 (87.5%) patients, with 14 patients (58.3%) undergoing perioperative voice therapy. One cyst recurred. Two patients elected for observation, and their cysts persisted. VHI-10 decreased from 23.8 to 6.6 (P Vocal fold cysts impact mucosal wave and glottic closure. Surgical excision resulted in low rates of recurrence, and in improvement in the mucosal wave and VHI-10. Perioperative voice therapy did not offer a significant benefit. Mucus retention cysts were the majority, in contrast to other published studies. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
A lattice calculation of the hadronic vacuum polarization contribution to (g-2)μ
DEFF Research Database (Denmark)
Della Morte, Michele; Francis, Anthony; Gerardin, A.
2018-01-01
We present results of calculations of the hadronic vacuum polarisation contribution to the muon anomalous magnetic moment. Specifically, we focus on controlling the infrared regime of the vacuum polarisation function. Our results are corrected for finite-size effects by combining the Gounaris-Sak...
Culicov, O A; Steinnes, E; Okina, O S; Santa, Z; Todoran, R
2001-01-01
The mosses Pleurozium schreberi, Pseudoscleropodium purum and Rhytidiadelphus squarrosus were used as biomonitors to study the atmospheric deposition of metals around the lead and copper-zinc smelters in Baia Mare. Samples representing the last three years' growth of moss or its green part, collected on the ground at 28 sites located 2-20 km from the source area, were analyzed by instrumental neutron activation analysis using epithermal neutrons (ENAA) and by flame atomic absorption spectrometry (FAAS). A total of 30 elements were determined, including most of the heavy metals known to be released into the air from this kind of industry. Obtained concentrations for As and Cu are comparable with those observed in Karabash, South Ural Mountains, one of the most polluted regions in Europe. Besides, these two elements correlate very well with each other. The mean values for Zn (136 ppm) and Pb (41 ppm) are substantially higher than those normally found in the literature. The highest value for Pb (175 ppm) was obs...
Directory of Open Access Journals (Sweden)
Adrian
2009-12-01
Full Text Available Twenty cattle were used in this experiment to determine the effect of administration follicle stimulating hormone (FSH and pregnant mare serum gonadotrophin (PMSG hormones on superovulation of Brahman cross cattle. The experiment was designed into completely randomized design with 5 treatments as follows. Treatments 1 (T1: 4 mg of FSH was injected twice a day intra-ovary, T2: 8 mg of FSH was injected twice a day intra-ovary, T3: 300 IU of PMSG was injected single dose intra-ovary, T4: 600 IU of PMSG was injected single dose intra-ovary, T5: 40 mg of FSH was injected intramuscular. All experimental cattle were oestrus synchronized using 15 mg of PGF2α twice at 11-days intervals. Number of corpus luteum (CL was detected by rectal palpation at day-7 after artificial insemination. Results showed that 19 cattle (95% indicated oestrus sign. Eleven cattle (57.9% showed oestrus sign 2 days after PGF2α injection and the rest 8 cattle (42.1% oestrus sign was detected at 3 days after PGF2α injection. FSH and PMSG treatments increased significantly (P<0.05 number of CL. The highest CL number was found in T5, meanwhile number of CL in T2 and T4 were higher compared to T1 and T3. The average treatment effect could produce 6.8±5.42 CL with range 2–26 CL. On the other hand single dose treatment of 600 IU PMSG (T4 showed high significant number of non ovulatory (persistent follicle compared to other treatments (T1, T2, T3 and T5 on average number of persistent follicle 2.0±1.97 from 19 cattles. It is concluded that the best superovulation treatment was produced by injection 40 mg of FSH intra-musculary.
Geologic structure of shallow maria. [topography of lunar maria
Dehon, R. A.; Waskom, J. A.
1975-01-01
Isopach maps and structural contour maps of the eastern mare basins (30 deg N to 30 deg S; 0 deg to 100 deg E), constructed from measurements of partially buried craters, are presented and discussed. The data, which are sufficiently scattered to yield gross thickness variations, are restricted to shallow maria with less than 1500-2000 m of mare basalts. The average thickness of basalt in the irregular maria is between 200 and 400 m. Correlations between surface topography, basalt thickness, and basin floor structure are apparent in most of the basins that were studied. The mare surface is commonly depressed in regions of thick mare basalts; mare ridges are typically located in regions of pronounced thickness changes; and arcuate mare rilles are confined to thin mare basalts. Most surface structures are attributed to shallow stresses developed within the mare basalts during consolidation and volume reduction.
Gerszberg, Aneta; Wiktorek-Smagur, Aneta; Hnatuszko-Konka, Katarzyna; Łuchniak, Piotr; Kononowicz, Andrzej K
2012-03-01
One of the most dynamically developing sectors of green biotechnology is molecular farming using transgenic plants as natural bioreactors for the large scale production of recombinant proteins with biopharmaceutical and therapeutic values. Such properties are characteristic of certain proteins of bacterial origin, including staphylokinase. For many years, work has been carried out on the use of this protein in thrombolytic therapy. In this study, transgenic Solanum tuberosum plants expressing a CaMV::sak-mgpf-gusA gene fusion, were obtained. AGL1 A. tumefaciens strain was used in the process of transformation. The presence of the staphylokinase gene was confirmed by PCR in 22.5% of the investigated plants. The expression of the fusion transgene was detected using the β-glucuronidase activity assay in 32 putative transgenic plants. Furthermore, on the basis of the GUS histochemical reaction, the transgene expression pattern had a strong, constitutive character in seven of the transformants. The polyacrylamide gel electrophoresis of a protein extract from the SAK/PCR-positive plants, revealed the presence of a119 kDa protein that corresponds to that of the fusion protein SAK-mGFP-GUSA. Western blot analysis, using an antibody against staphylokinase, showed the presence of the staphylokinase domain in the 119 kDa protein in six analyzed transformants. However, the enzymatic test revealed amidolytic activity characteristic of staphylokinase in the protein extract of only one plant. This is the first report on a Solanum tuberosum plant producing a recombinant staphylokinase protein, a plasminogen activator of bacterial origin.
Directory of Open Access Journals (Sweden)
OLIMPIA NEAGU
2017-06-01
Full Text Available The sustainable development essentially depends on natural capital or environment assets and conceiving a sustainable development strategy at local level means first to evaluate it, through inventorying all types of natural resources: vegetable, animal, protected areas, forest and water resources, crops and farming resources, land and pastures and meadows. The area called Țara Oașului, located in the north-eastern part of Satu Mare county has some particular features: a wealth of natural resources (such as forests, stone, mineral water, wild flora and fauna, population with a high level of income and luxurious but uninhabited houses, a high level of migration for work abroad (from the very beginning of nineties, a lack of labour force and active population, a reduced life expectancy, and specific popular traditions (costume, events and culture. We carried out a field reseach, by applying a questionnaire to local population, authorities and experts in order to obtain an estimation of natural resources, as volumes and ways of exploitation (for own consumption or market selling and the main trends in local traditional employment. The research conclusions are valuable in order to conceive the sustainable development strategy of the area, taking into consideration the local capabilities to use the existing natural resources by protecting the environment, to build an appropriate social capital and to attract the required for economic growth human and financial resources.
Niebudek-Bogusz, Ewa; Kotyło, Piotr; Politański, Piotr; Sliwińska-Kowalska, Mariola
2008-01-01
To assess the usefulness of acoustic analysis with vocal loading test for evaluating the treatment outcomes in occupational voice disorders. Fifty-one female teachers with dysphonia were examined (Voice Handicap Index--VHI, laryngovideostroboscopy and acoustic analysis with vocal loading) before and after treatment. The outcomes of teachers receiving vocal training (group I) were referred to outcomes of group II receiving only voice hygiene instructions. The results of subjective assessment (VHI score) and objective evaluation (acoustic analysis) improved more significantly in group I than in group II. The post-treatment examination revealed a decreased percentage of subjects with deteriorated jitter parameters after vocal loading, particularly in group I. Acoustic analysis with vocal loading test can be a helpful tool in the diagnosis and evaluation of treatment efficacy in occupational dysphonia.
Relation of Knowledge and Performance in Boys' Tennis: Age and Expertise.
McPherson, Sue L.; Thomas, Jerry R.
1989-01-01
Examined 10- to 13-year-old boys' development of knowledge structure and sport performance in tennis by comparing skills and knowledge of experts and novices. Experts focused on higher concepts and exhibited greater decision-making ability because of their more highly developed knowledge structure. (SAK)
Foaling rates in feral horses treated with the immunocontraceptive porcine zona pellucida
Ransom, J.I.; Roelle, J.E.; Cade, B.S.; Coates-Markle, L.; Kane, A.J.
2011-01-01
Locally abundant feral horses (Equus caballus) can rapidly deplete available resources. Fertility control agents present promising nonlethal tools for reducing their population growth rates. We tested the effect of 2 forms of the immunocontraceptive porcine zona pellucida (PZP) on foaling rates in 3 populations of feral horses in the western United States. A liquid form requiring annual boosters was administered at Little Book Cliffs Wild Horse Range, Mesa County (CO), and Pryor Mountain Wild Horse Range, Bighorn County (WY) and Carbon County (MT), and a time-release pellet form designed to produce 2 yr of infertility was administered at McCullough Peaks Herd Management Area, Park County (WY). Average foaling rates (foals born/mare-yr) from direct observation of untreated and treated female horses (mares), 2004-2008, were 60.1% (n = 153 mare-yr) versus 6.6% (n = 91 mare-yr) at Little Book Cliffs, and 62.8% (n = 129 mare-yr) versus 17.7% (n = 79 mare-yr) at Pryor Mountain, respectively. At McCullough Peaks, mean annual foaling rates from 2006 to 2008 were 75.0% (n = 48 mare-yr) for untreated mares and 31.7% (n = 101 mare-yr) for treated mares. Controlling for age of mares and pretreatment differences in fertility, PZP reduced foaling rates in all 3 herds. The pellets used at McCullough Peaks (produced by cold evaporation) were less effective than pellets used in a previous trial and produced by heat extrusion. Immunocontraception with PZP may be a useful tool in reducing fertility rates in some western United States feral horse herds, but population growth reduction will depend on timely access to mares for inoculation and the proportion of mares that can be successfully treated. ?? 2011 The Wildlife Society.
Jezierski, Tadeusz; Jaworski, Zbigniew; Sobczyńska, Magdalena; Ensminger, John; Górecka-Bruzda, Aleksandra
2017-09-27
The aim of the study was to assess whether adult stallions differentiate their olfactory and marking behaviour towards the excreta of their potential male rivals and mares. Four Konik polski stallions were individually exposed simultaneously to their own and each others' faeces as well as faeces of mares in oestrus vs. dioestrus. Five series of 30min observation sessions were conducted in a round pen each on two consecutive days from March to July, totaling in 5h observation per stallion. Stallions sniffed and displayed flehmen reaction towards mares' faeces significantly longer (P<0.01) than towards stallions' faeces. No significant differences were found in marking by defecations upon stallions' vs. mares' faeces. The stallions urinated exclusively on mares' faeces. Sniffing, flehmen, defecations and urinations performed towards faeces of mares in oestrus vs. dioestrus did not differ significantly. The results showed that stallions differentiate their olfactory behaviour towards excreta of conspecifics of different sex but perhaps not towards faeces of females in different reproductive status. This for the first time establishes that stallions exhibit different marking behaviour upon stallions' vs. mares' faeces. It is hypothesized that marking of other stallions' faeces by defecation may advertise presence of the stallion, whereas marking of mares' faeces by urination may serve to mask the presence of a mare to prevent potential rivals from locating the mare in an area where mares' faeces are found. Copyright © 2017 Elsevier B.V. All rights reserved.
Ebavõrdsus hukutab Eesti arengu / Katrin Saks
Saks, Katrin, 1956-
2004-01-01
Ilmunud ka: Pärnu Postimees, 22. jaan. 2004, lk. 11; Võrumaa Teataja, 24. jaan. 2004, lk. 2; Meie Maa, 24. jaan. 2004, lk. 2; Hiiu Leht, 27. jaan. 2004, lk. 2; Põhjarannik, 31. jaan. 2004, lk. 2; Severnoje Poberezhje, 31. jaan. 2004, lk. 2; Koit, 3. veebr. 2004, lk. 6; Hiiumaa, 3. veebr. 2004, lk. 2. Autor vaatleb riigi osa ebavõrduse ilmingute likvideerimisel Eestis ja leiab, et ebavõrdsus on meie arengu peamine takistus, mille kõrvaldamine on sotsiaaldemokraatide peamine eesmärk
Kas holokaust võib korduda? / Elhonen Saks
Saks, Elhonen, 1927-
2000-01-01
Eestit külastas USA Kongressi Esindajatekoja välissuhete komisjoni liige Tom Lantos. Dokumentaalfilm "Viimased päevad" ("The Last Days") Eesti välisministeeriumi pressikeskuses. režissöör James Moll : Ameerika Ühendriigid 1998. Survivors of the Shoah Visual History Foundation algatus. Filmi esitusel osalesid ka L. Meri ja T. H. Ilves.
Pikk tee märkamiseni / Katrin Saks
Saks, Katrin, 1956-
2008-01-01
Õpilaste koolisuhetest ning koolivägivallast. Ilmunud ka Vooremaa 9. okt. 2008, lk. 2 ; Võrumaa Teataja 11. okt. 2008, lk. 2 ; Koit 11. okt. 2008, lk. 6 ; Meie Maa 13. okt. 2008, lk. 2 ; Pärnu Postimees 10. okt. 2008, lk. 15 ; Virumaa Teataja 15. okt. 2008, lk. 11
Äraaetud hobused lastakse maha / Katrin Saks
Saks, Katrin, 1956-
2008-01-01
Tööaja direktiivi muutmise eelnõust, mis suurendaks töötajate tööaja piiranguid. Ilmunud ka Põhjarannik 19. juuni 2008, lk.2 ; Vooremaa 21. juuni 2008, lk. 2 ; Virumaa Teataja 27. juuni 2008, lk. 11 ; Pärnu Postimees 27. juuni 2008, lk. 15 ; Järva Teataja 1. juuli 2008, lk. 2 ; Koit 3. juuli 2008, lk. 6 ; Nädalaleht 20. juuni 2008, lk. 7
McCartan, C G; Russell, M M; Wood, J L; Mumford, J A
1995-01-07
An outbreak of equine herpesvirus-1 (EHV-1) occurred on a large stud farm with 133 mares, 54 foals and four stallions, and at least 85 mares, 22 foals and three stallions were infected. Clinical disease was observed in 16 mares, two stallions and 13 foals and the predominant clinical signs were scrotal oedema, ataxia and loss of libido in the stallions, ataxia and recumbency in the mares and uveitis and nasal discharge in the foals, although pneumonia and colic with intussusception were also recorded at autopsy. Neurological disease was more common in the mares nursing foals (12 of 38 infected) than in barren mares (one of 46 infected). Three mares died during the outbreak and no mares that had been recumbent bred again. Control procedures were based on virological and serological testing and stringent management practices to limit the spread of infection between groups of mares and foals and away from the stud farm. There were marked antibody responses in the adult horses, but they were generally poor in the foals; three of the nine viraemic foals did not develop significant increases in the levels of circulating antibody. Recommendations are made for the management of future outbreaks.
Clonal Streptococcus equi subsp. zooepidemicus post breeding endometritis in thoroughbred broodmares
DEFF Research Database (Denmark)
Christoffersen, Mette; Söderlind, Maja; Rydemann Rudefalk, Sofia
Streptococcus equi subsp. zooepidemicus is one of the most commonly isolated pathogens from the uterus of mares with infectious endometritis. Its ability to cause chronic latent infection by residing deep within the endometrial tissue has previously been described. The aim of the study was to inv......Streptococcus equi subsp. zooepidemicus is one of the most commonly isolated pathogens from the uterus of mares with infectious endometritis. Its ability to cause chronic latent infection by residing deep within the endometrial tissue has previously been described. The aim of the study...... was to investigate whether clonal or genetically distinct S. zooepidemicus strains isolated from mares with endometritis were associated with mare risk factors and the outcome of natural cover. Uterine swabs were obtained from mares with intrauterine fluid after natural cover (n=31) at thoroughbred stud farms...... in Australia. Fifty two percent of the mares (n=16) were diagnosed with infectious endometritis, and S.zooepidemicus was isolated in 81% (n=13) of these mares. Up to four S. zooepidemicus isolates were selected from each mare with growth of S. zooepidemicus and isolates from an additional five mares were...
Directory of Open Access Journals (Sweden)
Carlos de Barros Junior
2007-01-01
Full Text Available Os resíduos sólidos gerados em estabelecimentos de saúde (RSS representam uma pequena parcela dos resíduos gerados no meio urbano, mas não podem ser ignorados, devido ao grande caráter infeccioso, que pode causar acidentes intra e extra-hospitalares. O presente trabalho apresenta um enfoque sobre a situação atual na questão dos RSS geradospelo laboratório de análises clínicas da Universidade Estadual de Maringá, Estado do Paraná, e realiza um inventário sobre os tipos de resíduos gerados nesse local. A avaliação qualitativa foi efetuada mediante inspeções técnicas, identificando, classificando e segregando os diferentes grupos de resíduos gerados de acordo com a RDC nº 33/2003, adaptada para a Resolução RDC nº 306/2004 (Anvisa. Para determinação das composições quantitativas foi pesado todo o resíduo gerado nesse laboratório durante dois períodos em cinco dias úteis, aferindo-se as massas dos resíduos separados de acordo com seus tipos, bem como suas procedências.Solid residues generated in health sectors (HSR represent a little part of residues which are generated in the urban environment. However, they cannot be ignored due to their great infectious potential, which may cause accidents inside and outside the hospitalenvironment. The present work has the aim to make an inventory about the types of the HSR generated in the clinical analysis laboratory of the State University of Maringá, state of Paraná. Technical inspections were made in order to provide a qualitative evaluationthrough the identification, classification and segregation of the different groups of residues generated, according to ANVISA (National Agency of Sanitary Vigilance, RDC nº 33/2003, adapted in the final study for the Resolution RDC nº 306/2004. Aiming to determine thequantitative composition, the weighting of every residue generated in the laboratory was proceeded twice a day during five days, measuring every residue mass selected
Fathers: A Placement Resource for Abused and Neglected Children?
Greif, Geoffrey L.; Zuravin, Susan J.
1989-01-01
Investigated 17 custodial and 18 noncustodial fathers of abused or neglected children to determine: (1) how fathers get custody; (2) how situations in which fathers get custody differ from those in which they do not; and (3) the degree to which father placements are satisfactory. (SAK)
Kwon, Young Hwi; Bishayee, Kausik; Rahman, Ataur; Hong, Jae Seung; Lim, Soon-Sung; Huh, Sung-Oh
2015-07-01
Morus alba root extract (MARE) has been used to treat hyperglycaemic conditions in oriental medicine. Here, we studied whether MARE possesses a cytotoxic effect on neuroblastoma. To check the cytotoxicity generated by MARE was whether relatively higher against the cancer cells rather than normal cells, we chose a neuroblastoma cell line (B103) and a normal cell line (Rat-2). A CCK assay revealed that MARE (10 μg/ml) reduced cell viability to approximately 60% compared to an untreated control in B103 cells. But in Rat-2 cells, MARE induced relatively lower cytotoxicity. To investigate the mechanisms underlying the cytotoxic effect of MARE, we used flow cytometry combined with immunoblot analyses. We found that MARE-treatment could accumulate ROS and depolarize mitochondria membrane potential of B103 cells. Further treatment with MARE in B103 cells also could damage DNA and induce apoptosis. An expression study of p-Akt also suggested that there was a reduction in cellular proliferation and transcription along with the process of apoptosis, which was further evidenced by an increase in Bax and cleaved-caspase 3 activity. Together, our findings suggest that MARE produces more cytotoxicity in cancer cells while having a relatively attenuated effect on normal cells. As such, MARE may be a safer option in cancer therapeutics, and it also shows potential for the patients with symptoms of hyperglycemia and cancer.
Directory of Open Access Journals (Sweden)
Ieda Harumi Higarashi
2011-01-01
Full Text Available El estudio tuvo como objetivo caracterizar las acciones de prevención de enfermedades, promoción y recuperación de los adolescentes realizadas por los enfermeros del Programa Salud de la Familia (PSF en el municipio de Maringá/PR. Participaron de la investigación, ocho enfermeros, representando las cinco micro- regiones que componen el municipio. Los datos fueron recogidos a través de entrevistas semiestructuradas, en el mes de mayo de 2009, teniendo como referencial metodológico el enfoque cualitativo, por análisis de contenido. Los resultados del estudio demostraron que los enfermeros desarrollan acciones para prevención de enfermedades y promoción de la salud, por medio de orientaciones individuales, pláticas en las escuelas y con grupo de adolescentes, especialmente relacionados con la sexualidad y las drogas. Se percibió, un vacío asistencial atribuido a la baja demanda de adolescentes que busquen espontáneamente el servicio de salud, la ausencia de acciones sistematizadas dirigidas a esta clientela y la falta de recursos formativos que soporten la acción más efectiva de los profesionales de salud en esta área.
Lifescience Database Archive (English)
Full Text Available *nlifqel*lqiei*lnglqlnyicivildqnhqeih gvvhy*qfsqsfhqielfyhhqkvnlhvlsmqyy*lmkhqsml...EQQTQQ*lskkykq*kn*kn*nkiflnk ir Translated Amino Acid sequence (All Frames) Frame A: ---ivsqmlqk*lkimvqislvy
Lifescience Database Archive (English)
Full Text Available alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 40 0.067 AY6...12344_1( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 40 0.088 DQ018662_1( DQ018662 |pid:none) ...Plethodon dunni isolate 75356 NADH... 37 0.57 AY612348_1( AY612348 |pid:none) Desmog...nathus quadramaculatus vouch... 36 1.3 AY698038_1( AY698038 |pid:none) Desmognathus marmoratus isolate T0...... 36 1.3 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 36 1.3 CP000270_2676( CP000
Lifescience Database Archive (English)
Full Text Available mammvlpsqerfyfkmnfpllclltetgrldresylsmwksipesnersveiqvrlph vdvdsilrrlnsknifeivrkkapxx Translated Amino Acid ...vgqstdvtipiscngqisnplnpv idmammvlpsqerfyfkmnfpllclltetgrldresylsmwksipesnersveiqvrlph vdvdsilrrlnsknife
Lifescience Database Archive (English)
Full Text Available scular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 46 0....uence. 44 0.006 2 AL387523 |AL387523.1 Medicago truncatula EST MtBC43B08F1 : T3 end of clone MtBC43B08 of cDNA library MtBC from arbu
Lifescience Database Archive (English)
Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941
Lifescience Database Archive (English)
Full Text Available 7( AC116551 |pid:none) Dictyostelium discoideum chromoso... 79 3e-13 AJ575138_1( AJ575138 |pid:none) Sorda...ria macrospora app gene for a... 50 1e-04 BX571864_113( BX571864 |pid:none) Photorh
Lifescience Database Archive (English)
Full Text Available ) Pongo abelii mRNA; cDNA DKFZp469L1... 53 4e-06 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid... oxidas... 53 4e-06 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic acid o... AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 53 4e-06 AX882278_1( AX882278 |pid:none) Sequence
Lifescience Database Archive (English)
Full Text Available none) Homo sapiens full open reading fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli...006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 7e-13 protein
Lifescience Database Archive (English)
Full Text Available omal sarcosine oxidase; S... 75 3e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... ...pid:none) Homo sapiens full open reading fra... 75 5e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecoli
Lifescience Database Archive (English)
Full Text Available 295 |pid:none) Pongo abelii mRNA; cDNA DKFZp469L1... 62 9e-09 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecoli...one) Synthetic construct Homo sapiens c... 61 2e-08 BC027622_1( BC027622 |pid:none) Homo sapiens pipecolic a
Lifescience Database Archive (English)
Full Text Available AJ271965_3( AJ271965 |pid:none) Transmissible gastroenteritis viru... 35 4.4 AY452031_1( AY452031 |pid:none) Feline infectious perito...nitis viru... 35 4.4 protein update 2009. 7.13 PSORT psg: 1.00 gvh: 0.65 alm: 0.51
Lifescience Database Archive (English)
Full Text Available 002.10.25 Translated Amino Acid sequence vsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng *r*qwm...me A: vsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspakwtspeng *r*qwmvdaqslke
Lifescience Database Archive (English)
Full Text Available ih**ipqkvlvh*dsrtvamevgir*gvcnnspa kwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldggskysk eftlkaevgkgs...dktsnih**ipqkvlvh*dsrtvamevgir*gvcnnspa kwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsadldggskysk eftlkae
Lifescience Database Archive (English)
Full Text Available TTTAATCCTATTTGGTGTTCGTACCAATAACCAXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *gvcnns...GP*kpdygi*sylvfvpit--- Translated Amino Acid sequence (All Frames) Frame A: *gvcnnspakwtspeng*r*qwmvdaqslkev
Lifescience Database Archive (English)
Full Text Available wdktsnih**ipqkvlvh*dsrtvamevgir*gvcnns pakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrsln...sgpflvsrtgdvg*tkywdktsnih**ipqkvlvh*dsrtvamevgir*gvcnns pakwtspeng*r*qwmvdaqslkeviilltcrka*r*rrslnvnssgvvfsa
Duarte, Paulo C; Conrad, Patricia A; Barr, Bradd C; Wilson, W David; Ferraro, Gregory L; Packham, Andrea E; Carpenter, Tim E; Gardner, Ian A
2004-12-01
The study objective was to assess the risk of transplacental transmission of Sarcocystis neurona and Neospora hughesi in foals from 4 California farms during 3 foaling seasons. Serum of presuckle foals and serum and colostrum of periparturient mares were tested using indirect fluorescent antibody tests for S. neurona and N. hughesi. Serum antibody titers were neurona and N. hughesi in mares increased with age. Mares neurona and N. hughesi, respectively, than mares from California. The strength of association between positivity to either parasite and state of birth decreased as age increased. Mares positive for S. neurona and N. hughesi were 2.2 and 1.7 times more likely, respectively, to have a previous abortion than negative mares, adjusted for age and state of birth. The annual mortality rate for mares was 4%. The annual incidence rate of equine protozoal myeloencephalitis was 0.2%. In conclusion, there was no detectable risk of transplacental transmission of S. neurona and N. hughesi. Prevalence of antibodies against both parasites in mares increased with age.
Psychological effects of dysphonia in voice professionals.
Salturk, Ziya; Kumral, Tolgar Lutfi; Aydoğdu, Imran; Arslanoğlu, Ahmet; Berkiten, Güler; Yildirim, Güven; Uyar, Yavuz
2015-08-01
To evaluate the psychological effects of dysphonia in voice professionals compared to non-voice professionals and in both genders. Cross-sectional analysis. Forty-eight 48 voice professionals and 52 non-voice professionals with dysphonia were included in this study. All participants underwent a complete ear, nose, and throat examination and an evaluation for pathologies that might affect vocal quality. Participants were asked to complete the Turkish versions of the Voice Handicap Index-30 (VHI-30), Perceived Stress Scale (PSS), and the Hospital Anxiety and Depression Scale (HADS). HADS scores were evaluated as HADS-A (anxiety) and HADS-D (depression). Dysphonia status was evaluated by grade, roughness, breathiness, asthenia, and strain (GRBAS) scale perceptually. The results were compared statistically. Significant differences between the two groups were evident when the VHI-30 and PSS data were compared (P = .00001 and P = .00001, respectively). However, neither HADS score (HADS-A and HADS-D) differed between groups. An analysis of the scores in terms of sex revealed that females had significantly higher PSS scores (P = .006). The GRBAS scale revealed no difference between groups (P = .819, .931, .803, .655, and .803, respectively). No between-sex differences in the VHI-30 or HADS scores were evident We found that voice professionals and females experienced more stress and were more dissatisfied with their voices. 4. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.
Pedrosa, Vanessa; Pontes, Antônio; Pontes, Paulo; Behlau, Mara; Peccin, Stella Maria
2016-05-01
To evaluate the effectiveness of the Comprehensive Voice Rehabilitation Program (CVRP) compared with Vocal Function Exercises (VFEs) to treat functional dysphonia. This is a randomized blinded clinical trial. Eighty voice professionals presented with voice complaints for more than 6 months with a functional dysphonia diagnosis. Subjects were randomized into two voice treatment groups: CVRP and VFE. The rehabilitation program consisted of six voice treatment sessions and three assessment sessions performed before, immediately after, and 1 month after treatment. The outcome measures were self-assessment protocols (Voice-Related Quality of Life [V-RQOL] and Voice Handicap Index [VHI]), perceptual evaluation of vocal quality, and a visual examination of the larynx, both blinded. The randomization process produced comparable groups in terms of age, gender, signs, and symptoms. Both groups had positive outcome measures. The CVRP effect size was 1.09 for the V-RQOL, 1.17 for the VHI, 0.79 for vocal perceptual evaluation, and 1.01 for larynx visual examination. The VFE effect size was 0.86 for the V-RQOL, 0.62 for the VHI, 0.48 for the vocal perceptual evaluation, and 0.51 for larynx visual examination. Only 10% of the patients were lost over the study. Both treatment programs were effective. The probability of a patient improving because of the CVRP treatment was similar to that of the VFE treatment. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Ebersole, Barbara; Soni, Resha S; Moran, Kathleen; Lango, Miriam; Devarajan, Karthik; Jamal, Nausheen
2018-05-01
Examine the relationship among the severity of patient-perceived voice impairment, perceptual dysphonia severity, occupational voice demand, and voice therapy adherence. Identify clinical predictors of increased risk for therapy nonadherence. A retrospective cohort study of patients presenting with a chief complaint of persistent dysphonia at an interdisciplinary voice center was done. The Voice Handicap Index-10 (VHI-10) and the Voice-Related Quality of Life (V-RQOL) survey scores, clinician rating of dysphonia severity using the Grade score from the Grade, Roughness Breathiness, Asthenia, and Strain scale, occupational voice demand, and patient demographics were tested for associations with therapy adherence, defined as completion of the treatment plan. Classification and Regression Tree (CART) analysis was performed to establish thresholds for nonadherence risk. Of 166 patients evaluated, 111 were recommended for voice therapy. The therapy nonadherence rate was 56%. Occupational voice demand category, VHI-10, and V-RQOL scores were the only factors significantly correlated with therapy adherence (P demand are significantly more likely to be nonadherent with therapy than those with high occupational voice demand (P 40 is a significant cutoff point for predicting therapy nonadherence (P demand and patient perception of impairment are significantly and independently correlated with therapy adherence. A VHI-10 score of ≤9 or a V-RQOL score of >40 is a significant cutoff point for predicting nonadherence risk. Copyright © 2018 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Reliability and Validity of the Turkish Version of the Voice-Related Quality of Life Measure.
Tezcaner, Zahide Çiler; Aksoy, Songül
2017-03-01
This study aims to test the validity and reliability of the Turkish version of the Voice-Related Quality of Life (V-RQOL) questionnaire. This is a nonrandomized, prospective study with control group. The questionnaire was administered to 249 individuals-130 with vocal complaint and 119 without-with a mean age of 37.8 ± 12.3 years. The Turkish version of the Voice Handicap Index (VHI) and perceptual voice evaluation measures were also administered at 2-14 days for retest reliability. The instrument was submitted to validity and reliability evaluation. The V-RQOL measure showed a strong internal consistency and test-retest reliability; the Cronbach's alpha coefficient for the overall V-RQOL was 0.969, the physical functioning domain was 0.949, and the social-emotional domain was 0.940. In the test-retest reliability test, the overall V-RQOL was found to be 0.989. The construct validity of the V-RQOL was determined based on the strength and direction of its relation to the VHI and the perceptual voice evaluation measure. The higher the VHI level, the lower the physical functioning, social-emotional, and overall score levels of the V-RQOL (r = -0.927, r = -0.912, r = -0.944, respectively; P reliability and validity and may play a crucial role in evaluating Turkish-speaking patients with voice disorders. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Factors Associated With Patient-perceived Hoarseness in Spasmodic Dysphonia Patients.
Hu, Amanda; Hillel, Al; Meyer, Tanya
2016-11-01
The American Academy of Otolaryngology-Head and Neck Surgery Clinical Practice Guidelines on Hoarseness distinguishes between hoarseness, which is a symptom perceived by the patient, and dysphonia, which is a diagnosis made by the clinician. Our objective was to determine factors that are associated with patient-perceived hoarseness in spasmodic dysphonia (SD) patients. Retrospective study. Adductor SD patients who presented for botulinum toxin injections from September 2011 to June 2012 were recruited. The main outcome variable, Voice Handicap Index-10 (VHI-10), was used to quantify patient-perceived hoarseness. Clinical data, Hospital Anxiety and Depression Scale (HADS), and VHI-10 were collected. Clinician-perceived dysphonia was measured by a speech-language pathologist with Consensus Auditory Perceptual Evaluation of Voice (CAPE-V). Statistical analysis included univariate analyses and multiple linear regression. One hundred thirty-nine SD patients had VHI-10 score of 26.0 ± 7.2 (mean ± standard deviation), disease duration of 10.5 + 7.0 years, CAPE-V overall score of 43.2 ± 21.8, HADS anxiety score of 6.7 ± 3.8, and HADS depression score of 3.6 ± 2.8. In univariate analyses, there were positive correlations (P dysphonia are associated with higher levels of patient-perceived hoarseness in SD patients. Hoarseness is a very personal symptom. Multiple factors determine its self-perception. Copyright © 2016 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Mothes, A R; Runnebaum, M; Runnebaum, I B
2018-05-01
First evaluation of dual-phase vaginal Er:YAG laser to omit hormonal treatment for atrophy-related symptoms in post-menopausal breast cancer survivors following prolapse surgery. Patients with a history of breast cancer at the time of surgery for pelvic organ prolapse were offered non-hormonal vaginal Er:YAG laser treatment when complaining of atrophy-related genitourinary syndrome of menopause. A single 10-min course of dual-phase protocol of pulsed Er:YAG laser (2940 nm, fractional ablative and thermal mode, fluence according to tissue thickness). Follow-up included subjective satisfaction, vaginal pH, vaginal health index (VHI), and complications after 6 weeks. A total of 16 breast cancer survivors (age 71 years, SD 7) had been seeking treatment for pelvic floor symptoms related to vaginal atrophy at follow-up visits after prolapse surgery. All ablative vaginal Er:YAG laser outpatient procedures were successfully completed, all patients returned to daily activities without a need for analgetic medication. Evaluation was performed after 8.3 (SD 2.5) weeks. Pre-laser VHI scored 16 (SD 4.6) and post-laser VHI 20 (SD 3) with p = 0.01. Patients were satisfied in 94% (n = 15) regarding symptom relief. Breast cancer survivors with atrophy-related complaints after pelvic floor surgery may benefit from vaginal application of this innovative dual protocol of Er:YAG laser technology as a non-hormonal treatment approach.
African Journals Online (AJOL)
DR. AMIN
Gadagi” tea preparations,. “sak'',”sada” and “magani”.. LD50 values of each type of the tea were determined. Results of phase. I and phase II of the study showed no mortality was recorded in any of the experimental groups of rats in 24hours ...
Pärnu piirivalvekordoni hoone arhitektuurivõistlus / Hindrek Kesler
Kesler, Hindrek
2006-01-01
Žürii liige eskiisprojekti võistlusest ja võistlustöödest. Tulemused: II koht - töö "Arava", autor Toomas Mägi, III koht - töö "Vilgatus", autorid Kätlin Saks, Harry Klaar, ergutuspreemia - töö "Maru", autorid Heidi Urb, Siiri Vallner, Toomas Paaver
Naval Research Laboratory 1986 Review
1986-01-01
probabil- infinitesimal impedance elements cannot be dep- ity density, icted .) If PR (r. 1 is the joint probability den- sity function for r and 1, a...Dynamics. 1-5 Sept. 1986, finse Research. Medellin , Colombia. % Rosenblum, L.J., Chairperson, IEEE Computer Saks, N.S., Coorganizer and lecturer, IEEE
Macroscopic modelling of solid-state fermentation
Hoogschagen, M.J.
2007-01-01
Solid-state fermentation is different from the more well known process of liquid fermentation because no free flowing water is present. The technique is primarily used in Asia. Well-known products are the foods tempe, soy sauce and saké. In industrial solid-state fermentation, the substrate usually
Preoperative radiochemotherapy and radical surgery in comparison with radical surgery alone
International Nuclear Information System (INIS)
Mohr, C.; Schettler, D.; Bohndorf, W.
1994-01-01
A multicentric, randomized study of squamous cell carcinoma (SCC) of the oral cavity and the oropharynx has been undertaken by DOeSAK. The results after radical surgery alone have been compared with the results of combined preoperative radiochemotherapy followed by radical surgery. Patients with primary (biopsy proven) SCC of the oral cavity or the oropharynx with tumor nodes metastasis (TNM) stages T2-4, N0-3, M0 were included in the study. A total of 141 patients were treated by radical surgery alone, whereas 127 patients were treated by radical surgery preceded by preoperative radiochemotherapy. The pre-operative treatment consisted of conventionally fractioned irradiation on the primary and the regional lymph nodes with a total dose of 36 Gy (5 x 2 Gy per week) and low-dose cisplatin chemotherapy with 5 x 12.5 mg cisplatin per m 2 of body surface during the first week of treatment. Radical surgery according to be DOeSAK definitions (DOeSAK, 1982) was performed after a delay of 10-14 days. During the follow-up period, 28.2% of all patients suffered from locoregional recurrence, and 27.2% of the patients died. The percentages were higher after radical surgery alone for locoregional recurrence (31% and 15.6%) and for death (28% and 18.6%). The life-table analysis showed improved survival rates of 4.5% after 1 year and 8.3% after 2 years in the group of patients treated with combined therapy. The demonstrated improvement appeared to be significant with the Gehan-Wilcoxon test as well as with the log rank test below a P value of 5%. (au) (29 refs.)
METHANE HYDRATE PRODUCTION FROM ALASKAN PERMAFROST
Energy Technology Data Exchange (ETDEWEB)
Donn McGuire; Steve Runyon; Richard Sigal; Bill Liddell; Thomas Williams; George Moridis
2005-02-01
Natural-gas hydrates have been encountered beneath the permafrost and considered a nuisance by the oil and gas industry for years. Engineers working in Russia, Canada and the USA have documented numerous drilling problems, including kicks and uncontrolled gas releases, in arctic regions. Information has been generated in laboratory studies pertaining to the extent, volume, chemistry and phase behavior of gas hydrates. Scientists studying hydrate potential agree that the potential is great--on the North Slope of Alaska alone, it has been estimated at 590 TCF. However, little information has been obtained on physical samples taken from actual rock containing hydrates. This gas-hydrate project is in the final stages of a cost-shared partnership between Maurer Technology, Noble Corporation, Anadarko Petroleum, and the U.S. Department of Energy's Methane Hydrate R&D program. The purpose of the project is to build on previous and ongoing R&D in the area of onshore hydrate deposition to identify, quantify and predict production potential for hydrates located on the North Slope of Alaska. Hot Ice No. 1 was planned to test the Ugnu and West Sak sequences for gas hydrates and a concomitant free gas accumulation on Anadarko's 100% working interest acreage in section 30 of Township 9N, Range 8E of the Harrison Bay quadrangle of the North Slope of Alaska. The Ugnu and West Sak intervals are favorably positioned in the hydrate-stability zone over an area extending from Anadarko's acreage westward to the vicinity of the aforementioned gas-hydrate occurrences. This suggests that a large, north-to-south trending gas-hydrate accumulation may exist in that area. The presence of gas shows in the Ugnu and West Sak reservoirs in wells situated eastward and down dip of the Hot Ice location indicate that a free-gas accumulation may be trapped by gas hydrates. The Hot Ice No. 1 well was designed to core from the surface to the base of the West Sak interval using the
Directory of Open Access Journals (Sweden)
Aline Aparecida Buriola
2016-06-01
Full Text Available RESUMO Objetivo: Identificar a sobrecarga do cuidador de criança ou adolescente com transtorno mental. Métodos: Estudo transversal, descritivo, exploratório, quantitativo, realizado com 82 cuidadores/familiares de crianças e adolescentes atendidos no Centro de Atenção Psicossocial infantil do município de Maringá, Paraná, Brasil. A coleta foi de dezembro de 2012 a julho de 2013, utilizando-se a Escala de Sobrecarga dos Familiares de Pacientes Psiquiátricos e um questionário sócio-demográfico. Resultados: Identificou-se sobrecarga objetiva elevada quanto à assistência em atividades da vida cotidiana, como supervisão na tomada de medicamentos, e sobrecarga subjetiva alta decorrente do convívio com comportamentos problemáticos. Conclusão: Nesse contexto é imprescindível vincular a família nas ações de cuidado prestadas nos serviços de saúde, sendo necessário que os profissionais atuem potencializando pontos positivos da convivência da família com essas crianças e adolescentes, sanando dúvidas e sendo o suporte da família para as dificuldades que surgem no convívio.
Benjamin Vassermanile preemiad
2007-01-01
Graafik Benjamin Vasserman pälvis kolme digitaalse graafilise lehe eest žürii kiituse Ungaris Györis toimunud biennaalil "The Master of Drawing and Graphic Arts" ning II preemia nelja lehe eest Leedus Vilniuses toimunud VI rahvusvahelisel väikegraafika triennaalil. Eestist osalesid veel Reti Saks ja Kelli Valk
Trachypodaceae. A critical revision
Zanten, van B.O.
1959-01-01
1. Trachypus. 1. T. bicolor Reinw. et Hornsch. is divided into 4 varieties: a. var. bicolor, b. var. hispidus (C. Muell.) Card., c. var. viridulus (Mitt.) Zant. comb. nov., d. var. scindifolius (Sak.) Nog. 2. T. humilis Lindb. is divided into 2 varieties: a. var. humilis, b. var. tenerrimus (Herz.)
ON STRONG AND WEAK CONVERGENCE IN n-HILBERT SPACES
Directory of Open Access Journals (Sweden)
Agus L. Soenjaya
2014-03-01
Full Text Available We discuss the concepts of strong and weak convergence in n-Hilbert spaces and study their properties. Some examples are given to illustrate the concepts. In particular, we prove an analogue of Banach-Saks-Mazur theorem and Radon-Riesz property in the case of n-Hilbert space.
Los Mares Interiores. (Libro de Poemas del Académico Juan Mendoza Vega
Directory of Open Access Journals (Sweden)
Efraim Otero Ruiz
2001-12-01
Full Text Available
(Presentación del libro en la Fundación Santillana para Iberoamérica, Bogotá, Noviembre 23, 2001.
Ha querido la deferencia del señor exPresidente Belisario Betancur, Presidente de la Fundación Santillana para lberoamérica, que sea yo quien les presente el libro "Los mares interiores" del médico, periodista y poeta Juan Mendoza Vega. Tarea que acometo con singular afecto, nacido de una amistad que supera ya los 40 años y de una admiración continua por las dotes intelectuales y artísticas que lo colocan en un sitial especial entre los médicos de Colombia.
Nacido en Chinácota y bachiller en Pamplona, su infancia y adolescencia transcurrieron en esos paisajes idílicos que se extienden entre el río Pamplonita y las colinas de Iscalá, donde ha trasegado la vida de muchos hijos ilustres del Norte de Santander. Después cursó sus estudios de Medicina en la Universidad
Nacional, en Bogotá, entre 1952 y 1957, habiéndose graduado de médico en 1960 a los dos años de haber iniciado su especialización en neurología y neurocirugía, temas que constituirían la mayor dedicación de su vida. Pues de ahí saltó a la cátedra de la especialidad en la Facultad de Medicina del Rosario entre 1969 y 1985, siendo además iniciador de la cátedra y profesor de Historia de la Medicina en la misma Universidad desde 1980 hasta el presente; al tiempo, ha sido profesor de Etica Médica allí mismo desde 1983. A estas actividades de planta ha unido su participación como catedrático invitado en numerosas instituciones y universidades de dentro y fuera del país. Y la autoría de 55 publicaciones científicas en revistas nacionales e internacionales sobre temas de neurología y neurocirugía, ética médica e historia de la medicina...
Ähvardus : olümpiamängude teleülekanne jääb ära / Kai Kalamees
Kalamees, Kai
2005-01-01
Riigikogu liige Jaak Allik peab vajalikuks leida ETV-le lisamiljoneid olümpiamängude ja jalgpalli MM-i teleülekanneteks. Riigikogu liikmed Olav Aarna ja Katrin Saks kritiseerisid valitsust, et rahvusringhäälingu arengukava suhtes pole võetud seisukohta. Kultuuriminister Raivo Palmaru arvamusi. Lisa: Ringhäälingureform tulekul
AMERICAN QUARTER HORSES’ BEHAVIORAL FORMS
Directory of Open Access Journals (Sweden)
Iryna Olexandrivna Suprun
2016-02-01
Full Text Available The review of basic literary sources is made out of behavior of horse. On the basis of the field researches (visual supervisions after three different aged groups of mares it is built ethograms. An ethogram of behavioral forms among mares was developed. They represent the different forms of mares’ behavior in a dynamics. The reaction of mares of the different age-related and physiology groups on appearance of extraneous objects on a pasture, their activity, hierarchy, socialization is analyzed in groups. Several main studies on equines were reviewed in ethogram. Four objects were placed into the pasture with the mares and foals including a mat, cone, halter, and mounting block. Initial interest of mares in objects was high. Herd mentality highly evident. When one horse spooked at object the whole herd followed. After 5 minutes, majority of mares and foals lose interest in objects. The major general behavior categories observed include: locomotion, comfort, and harem social. Dominance was demonstrated while looking at the objects. Dominance was also demonstrated when a mare wanted to be in a specific place or play with a specific toy, she would pin her ears back, bite, or kick at the other mare.
To the problem about the origin of lunar maria and continents (Moessbauer investigations)
Malysheva, T. V.
1977-01-01
A comparative study of Mossbauer spectra of regolith returned by the Luna 16 and Luna 20 spacecraft is presented. The Mossbauer spectra of the mare regolith differs significantly for all fractions from the spectra for the same fractions of continental regolith. The total quantity of iron is 1.85 times greater in the mare regolith. There is 2.4 times less olivine in the mare region than in the continental region. The pyroxene component of the mare regolith is less homogeneous in composition (contains more augite and glass) and is present in larger quantities. Ilmenite was found only in the mare regolith. In the continental region, the predominant titanium-containing phase is ulvospinel. The mare regolith contains more metallic iron, which is more finely dispersed and contains less nickel. Troilite is found in the maria region. Based on these differences, it is concluded that the formation of continental rocks occurred at an earlier stage of crystallization from the melt and at higher temperatures and higher partial pressures of oxygen. The mare basalts crystallized from a more reduced magma, apparently in a later process.
Mehran, A.; AghaKouchak, A.; Phillips, T. J.
2014-02-01
The objective of this study is to cross-validate 34 Coupled Model Intercomparison Project Phase 5 (CMIP5) historical simulations of precipitation against the Global Precipitation Climatology Project (GPCP) data, quantifying model pattern discrepancies, and biases for both entire distributions and their upper tails. The results of the volumetric hit index (VHI) analysis of the total monthly precipitation amounts show that most CMIP5 simulations are in good agreement with GPCP patterns in many areas but that their replication of observed precipitation over arid regions and certain subcontinental regions (e.g., northern Eurasia, eastern Russia, and central Australia) is problematical. Overall, the VHI of the multimodel ensemble mean and median also are superior to that of the individual CMIP5 models. However, at high quantiles of reference data (75th and 90th percentiles), all climate models display low skill in simulating precipitation, except over North America, the Amazon, and Central Africa. Analyses of total bias (B) in CMIP5 simulations reveal that most models overestimate precipitation over regions of complex topography (e.g., western North and South America and southern Africa and Asia), while underestimating it over arid regions. Also, while most climate model simulations show low biases over Europe, intermodel variations in bias over Australia and Amazonia are considerable. The quantile bias analyses indicate that CMIP5 simulations are even more biased at high quantiles of precipitation. It is found that a simple mean field bias removal improves the overall B and VHI values but does not make a significant improvement at high quantiles of precipitation.
Voice Outcomes of Adults Diagnosed with Pediatric Vocal Fold Nodules and Impact of Speech Therapy.
Song, Brian H; Merchant, Maqdooda; Schloegel, Luke
2017-11-01
Objective To evaluate the voice outcomes of adults diagnosed with vocal fold nodules (VFNs) as children and to assess the impact of speech therapy on long-term voice outcomes. Study Design Prospective cohort study. Setting Large health care system. Subjects and Methods Subjects diagnosed with VFNs as children between the years 1996 and 2008 were identified within a medical record database of a large health care system. Included subjects were 3 to 12 years old at the time of diagnosis, had a documented laryngeal examination within 90 days of diagnosis, and were ≥18 years as of December 31, 2014. Qualified subjects were contacted by telephone and administered the Vocal Handicap Index-10 (VHI-10) and a 15-item questionnaire inquiring for confounding factors. Results A total of 155 subjects were included, with a mean age of 21.4 years (range, 18-29). The male:female ratio was 2.3:1. Mean VHI-10 score for the entire cohort was 5.4. Mean VHI-10 scores did not differ between those who received speech therapy (6.1) and those who did not (4.5; P = .08). Both groups were similar with respect to confounding risk factors that can contribute to dysphonia, although the no-therapy group had a disproportionately higher number of subjects who consumed >10 alcoholic drinks per week ( P = .01). Conclusion The majority of adults with VFNs as children will achieve a close-to-normal voice quality when they reach adulthood. In our cohort, speech therapy did not appear to have an impact on the long-term voice outcomes.
Directory of Open Access Journals (Sweden)
Recep Yağız
2012-03-01
Full Text Available Objective: To evaluate functional and oncological results of patients who were treated with frontal anterior laryngectomy with epiglottic reconstruction (Tucker’s operation.Material and Methods: From September 1985 to November 2009, 58 patients whose early glottic carcinomas were operated on with Tucker’s operation. The time of decannulation, nasogastric tube removal, hospitalization and oncological results were analyzed. Acoustic analysis and Voice Handicap Index (VHI were used to evaluate vocal function.Results: The mean time for decannulation and nasogastric tube removal were 11.8±7.6 and 15.4±4.4 days, respectively. The mean duration of hospital stay was 19.3±6.1 days. It was found that early decannulation significantly reduced patient decannulation and hospitalization time. The 5-year overall and cause-specific actuarial survival rates were 81.5% and 96.9%, respectively. The 10-year overall and cause-specific survival rates were 67% and 92.3%, respectively. The 5-year local and nodal control rates were 95.4% and 95.2%, respectively. The mean values for jitter, shimmer and noise-to-harmonic ratio were 8.10±5.59%, 16.60±5.81% and 0.51±0.23, respectively, and these scores showed a significant increase. Total VHI score and subscale scores except VHI-emotional noted that patients had a mild level of vocal disability. Conclusion: Tucker’s operation is one of the preferred techniques in the treatment of early glottic carcinoma with its high oncologic success rate and satisfactory functional results.
Vocal Parameters and Self-Perception in Individuals With Adductor Spasmodic Dysphonia.
Rojas, Gleidy Vannesa E; Ricz, Hilton; Tumas, Vitor; Rodrigues, Guilherme R; Toscano, Patrícia; Aguiar-Ricz, Lílian
2017-05-01
The study aimed to compare and correlate perceptual-auditory analysis of vocal parameters and self-perception in individuals with adductor spasmodic dysphonia before and after the application of botulinum toxin. This is a prospective cohort study. Sixteen individuals with a diagnosis of adductor spasmodic dysphonia were submitted to the application of botulinum toxin in the thyroarytenoid muscle, to the recording of a voice signal, and to the Voice Handicap Index (VHI) questionnaire before the application and at two time points after application. Two judges performed a perceptual-auditory analysis of eight vocal parameters with the aid of the Praat software for the visualization of narrow band spectrography, pitch, and intensity contour. Comparison of the vocal parameters before toxin application and on the first return revealed a reduction of oscillation intensity (P = 0.002), voice breaks (P = 0.002), and vocal tremor (P = 0.002). The same parameters increased on the second return. The degree of severity, strained-strangled voice, roughness, breathiness, and asthenia was unchanged. The total score and the emotional domain score of the VHI were reduced on the first return. There was a moderate correlation between the degree of voice severity and the total VHI score before application and on the second return, and a weak correlation on the first return. Perceptual-auditory analysis and self-perception proved to be efficient in the recognition of vocal changes and of the vocal impact on individuals with adductor spasmodic dysphonia under treatment with botulinum toxin, permitting the quantitation of changes along time. Copyright © 2017. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Daniele de Pinto Freitas Kneube
2006-03-01
Full Text Available Este trabalho investiga a ocorrência de anorexia nervosa e distúrbio de imagem corporal em 187 estudantes do ensino médio da cidade de Maringá, Estado do Paraná. O Índice de Massa Corporal (IMC e a classificação do estado nutricional foram utilizados para a avaliação antropométrica. A análise das respostas do questionário Body Shape Questionnaire (BSQ demonstrou que 66,1% das estudantes do sexo feminino apresentaram distúrbios de imagem corporal e somente 18,6% dos estudantes do sexo masculino apresentaram tal distúrbio. Com relação às respostas ao questionário Teste de Atitudes Alimentares (EAT, verificou-se que 10% do sexo masculino e 32% do sexo feminino apresentaram sintomatologia anoréxica. Os resultados sugerem uma elevada incidência da anorexia nervosa na população estudada bem como uma significativa presença de distorção da imagem corporal. As informações são relevantes para estudos clínicos voltados para orientação nutricional dos adolescentes visando à reeducação alimentarThis study investigates the occurrence of nervous anorexy and body image disorders in 187 middle school students in the city of Maringá, State of Paraná, Brazil. Body Mass Index (BMI and the classification of the nutritional state were used to the anthropometrical evaluation. The analysis of the questionnaire BSQ answers demonstrated that 66.1% of female students presented the body image disorder, and only 18.6% of male students presented such disorder. Regarding the questionnaire EAT answers, the analysis showed that 32% female and 10% male sex presented anorexic symptoms. The obtained results indicated high incidence of nervous anorexy in the population studied as well as a significant presence of body image distortion. These results are relevant to clinic studies of teenagers, mainly those directing to future studies on nutritional orientation focusing on alimentary reeducation
De Veterinaire Hoofdinspectie en het NPK ; ontwikkeling van een meetstrategie
Lembrechts JFMM; Pruppers MJM
1993-01-01
This report elaborates the position of the Veterinary Public Health Service (VHI), which is part of the Ministry of Welfare, Health and Cultural Affairs, within the National Organisation for Nuclear Emergency Planning and Response (NPK). This organisation is activated in case of nuclear accidents
Directory of Open Access Journals (Sweden)
Necati Akbulut
2015-02-01
Full Text Available Gıda Teknolojisinin gelişmesi ile, gıda maddesinin tüketici için daha alımlı olmasını sağlamak, kısa zamanda bozulmasını engellemek ve pazara yeni çeşitler sunmak için bazı kimyasal maddeler kullanılmaya başlanılmıştır. Bunun yanında tarımda kullanılan kimyasal maddeler artmış, ambalaj sanayi gelişmiş, bu da gıda maddelerine bulaşan maddelerin türlerini arttırmıştır. Ayrıca gıda maddelerine belirli amacı olmadan katılan maddelerde vardır. Diğer taraftan tüketiciyi aldatmak, hile yapmak, çok kar sağlamak veya kötü kaliteyi gizlemek amacı ile de kullanılan maddeler bulunmaktadır. İster teknik zorunluk, ister hile amacıyla olsun bu tür yabancı maddeler öncelikle insan sağlığını ilgilendirmektedir. Bazı maddelerin vücuda alınması sakıncasız olduğu halde, bazıları sakıncalıdır. Sakıncasız olanlarında belirli bir sınırın üzerinde uzun süre alınmaları zararlı olabilmektedir. Bu toplum sağlığı sorunu birçok ülkeyi gıda sanayiinde kullanılan kimyasal maddelerin hoşgörü sınırlarının hesaplanması noktasına götürmüştür.
Directory of Open Access Journals (Sweden)
Massimo Clemente
2012-12-01
basato sulla sua cultura di città di mare. Le attività legate al mare sono stati potenziate, creando spazi per la vela e la nautica da diporto, che ha portato alla riqualificazione delle aree dismesse e dell'area portuale. Questo processo di riqualificazione, legato alla sua identità storica, la costruzione di nuove infrastrutture e dei nuovi attrattori economici e funzionali, stanno garantendo la sua candidatura come sede di Mega eventi velici. I risultati sono stati una migliore qualità della vita per i residenti, sviluppo economico e del turismo.Il secondo caso riguarda la città di Valencia. Rappresenta un esempio emblematico perché la designazione come città ospitante la 32° America’s Cup ha avviato un lungo processo di rigenerazione urbana. Questo evento ha proiettato la città sulla scena internazionale e ha consolidato alcuni processi e strategie già avviati.La riabilitazione della zona del porto storico per la 32° America’s Cup, insieme a interventi importanti come La Ciudad de las Artes y las Ciencias e il circuito di Formula 1, ha dato un nuovo volto alla città negli ultimi decenni. La metamorfosi della città è avvenuta con il contributo di importanti architetti contemporanei.Il recupero del waterfront è stato progettato non solo per la competizione velica, ma, soprattutto, come occasione per dotare la città di nuove attrezzature formative, culturali, ricreative e del tempo libero, per promuovere il turismo e l'ospitalità.L'importanza e il valore emblematico del caso Valencia ha attirato l'interesse di esperti, non solo pianificatori e architetti, ma anche specialisti del marketing turistico e della gestione degli eventi sportivi.
Energy Technology Data Exchange (ETDEWEB)
Nicolet, L.; Rott, U. [Stuttgart Univ. (Germany). Inst. fuer Siedlungswasserbau, Wasserguete- und Abfallwirtschaft; Bardeck, S. [Optek-Danulat GmbH (Germany)
1999-07-01
The work describes the measurement of UV extinction - expressed as the spectral absorption coefficient SAC - at a randomly chosen wave length as a technique for monitoring organic load in effluents from sequencing batch reactors (SBR) at municipal and industrial waste water treatment plants. Further described is to what extent the continuous determination of the SAC can be used in practice for the control of the aerated phase of sequencing batch reactors. By this means, process stabilization and optimization can be achieved and operating reliability can be enhanced. (orig.) [German] Inhalt dieses Beitrages ist es, die Messung der UV-Extinktion - ausgedrueckt durch den spektralen Absorptionskoeffizient (SAK) - bei einer frei gewaehlten Wellenlaenge als Verfahren fuer die Ueberwachung der organischen Belastung in den Ablaeufen von SBR-Anlagen (Sequencing-Batch-Reactor) in der kommunalen und industriellen Abwasserreinigung vorzustellen. Weiterhin soll dargestellt werden, in wieweit die kontinuierliche Bestimmung des SAK in der Praxis fuer die Regelung der beluefteten Phase von SBR-Anlagen eingesetzt werden kann. Hiermit kann eine Prozessstabilisierung und -optimierung der Anlagen erreicht sowie die Betriebssicherheit erhoeht werden. (orig.)
Equine goiter associated with excess dietary iodine.
Eroksuz, H; Eroksuz, Y; Ozer, H; Ceribasi, A O; Yaman, I; Ilhan, N
2004-06-01
Naturally occurring goiter cases are described in 2 newborn Arabian foals whose mares were supplemented with excess iodine during the final 24 w of the pregnancy. Six nursing foals and 2 mares were also affected clinically with thyroid hypertrophy. At least 12 times the maximum tolerable level of iodine supplementation was given, as the daily iodine intake for each mare was 299 mg. The prevalence of goiter cases was 2 and 9% in the mares and foals, respectively.
Porti, trasporti e cultura del mare nelle città d’Italia, per i 150 anni dall’Unità
Directory of Open Access Journals (Sweden)
Marta Moretti
2011-04-01
Full Text Available Le celebrazioni per i 150 anni dell’Unità d’Italia offrono anche l’occasione per interrogarsi sulla storia e lo sviluppo di questo Paese, in particolare in riferimento alla cultura del mare e al sistema dei trasporti via acqua. In un paese peninsulare come l’Italia, con i suoi 7.500 chilometri di fronte d’acqua, la presenza dei porti è sempre stata elemento determinante per la crescita economica e per la sua affermazione sui mercati internazionali. Ma, dalla seconda metà del Novecento, le città e i loro porti sono andati progressivamente separandosi, determinando situazioni di forti contrasti e di continue tensioni. Solo più recentemente – a seguito della legge n. 84 del 1994 – nuove forme di ‘dialogo’ hanno consentito, in talune occasioni, di riavviare politiche di concertazione sui piani di sviluppo delle aree portuali e sul miglioramento della situazione delle zone urbane prossime ai porti. Per tutti questi motivi, l’occasione del 150esimo anniversario dell’Unità d’Italia può rappresentare un momento significativo per riprendere la riflessione sul ruolo dei porti italiani nella storia del nostro paese, ed, eventualmente, sul potenziale rafforzamento che essi possono subire, alla luce dei dati positivi ed incoraggianti dell’intero cluster marittimo in questi ultimi anni, almeno fino alla crisi congiunturale del 2008.Al tempo stesso, si può analizzare la complessa relazione porto-città, in un’ottica di mutuo riconoscimento delle rispettive esigenze e della volontà di sviluppare le proprie attività in un quadro di concreto ed efficace spirito di collaborazione, che richiede sia una maggiore conoscenza reciproca, così come una più efficace definizione degli obiettivi per il raggiungimento di una qualità urbana sostenibile e duratura.La progressiva globalizzazione dell’economia e la liberalizzazione del mercato hanno determinato una generale crescita degli scambi commerciali a livello mondiale e in
FoalinMare: insights inside the foaling mare
Directory of Open Access Journals (Sweden)
Giuseppe Stradaioli
2011-02-01
Full Text Available Jan Govaere, Katrien Martens and Aart de Kruif, together with their talented collaborators at the Department of Reproduction, Obstetrics and Herd Health at Ghent university (in cooperation with Utrecht university, Ohio State University and the University of Nantes, have produced an educational DVD that is intended mainly at students, vets and teachers; however, the DVD may also be suitable for biologists, horse’s breeders and owners. They used some of the best 3D animations I have ever seen. By means of this video support, they showed exactly what normally happens and what instead can deviate from physiologic during equine pregnancy and parturition; all in an effective and intuitive way......
Meulenbroek, L.F.P.; Thomas, G.; Kooijman, P.G.C.; Jong, F.I.C.R.S. de
2010-01-01
OBJECTIVE: The aim of the study was to assess biopsychosocial impact of the voice in relation to the psychological features in female student teachers. METHODS: This research was a cross-sectional study in 755 student teachers using general questionnaires, the Voice Handicap Inventory (VHI), Type D
Cross-cultural Adaption and Validation of the Danish Voice Handicap Index
DEFF Research Database (Denmark)
Sorensen, Jesper Roed; Printz, Trine; Mehlum, Camilla Slot
2018-01-01
version of the VHI was used. Data from 208 patients with voice disorders of different etiology (neurogenic, functional, and structural) and a control group of 85 vocally healthy individuals were included. A test-retest reliability analysis of 42 patients and 45 control persons was performed. The internal...
Investigating self-representation with virtual reality
Ma, Ke
2016-01-01
The main issue addressed in this thesis is the degree to which the representation of our body is flexible, and what possible implication this has. By using the virtual hand illusion (VHI) paradigm, we provided evidence for a dissociation between subjective ownership perception and the skin
Eesti graafika edu Hispaanias / Benjamin Vasserman
Vasserman, Benjamin
1999-01-01
Hispaanias Orenses dets. 1998/jaan. 1999 peetud V rahvusvahelisel graafikabiennaalil "Julio Prieto Nespereira auhind" pälvisid žürii kiituse eesti graafikud R. Saks, V. Tolli, B. Vasserman. I preemia ئ T. Uchida. Näitusel osales S. Liiva. 1998. a. sügisel Jaapanis toimunud II Tokio rahvusvahelisest väikegraafika triennaalist võttis osa N. Neidre.
Medición de la discapacidad vocal en los pacientes con nódulos vocales
Directory of Open Access Journals (Sweden)
Wasim Elhendi Halawa
2012-06-01
Full Text Available Con el objetivo de analizar el grado de discapacidad que suponen los nódulos vocales para los pacientes,presentamos los resultados de la valoración subjetiva (el índice de discapacidad vocal (V.H.I.-30adaptado al español y valoración de la sintomatología asociada a la disfonía en 97 pacientesdiagnosticados de nódulos vocales, encontrando un grado importante de discapacidad reflejado por unosvalores elevados del V.H.I.-30 (61,18, por sus tres subescalas (orgánica -26,48, funcional -21,75 yemocional -12,94 y por un importante grado de afectación por los síntomas asociados. Se comparannuestros resultados con los del grupo control de nuestro entorno y se estratifican los resultados según laprofesión de los pacientes. Concluimos que la presencia de nódulos vocales supone una discapacidadimportante a nivel de las actividades sociales y laborales del paciente y un impacto emocionalconsiderable.
Toiduvilja koht pole kütusepaagis / Katrin Saks
Saks, Katrin, 1956-
2008-01-01
Ilmunud ka: Nädaline 22. mai, lk. 4, Pärnu Postimees 22. mai, lk. 15, Võrumaa Teataja 22. mai, lk. 2, Vooremaa 22. mai, lk. 2, Valgamaalane 22. mai lk. 2, Hiiu Leht 23. mai, lk. 2, Kuulutaja 23. mai lk. 4, Koit 24. mai lk. 6, Järva Teataja, Harju Elu 27. mai lk. 2, Vali Uudised 28. mai lk. 2, Meie Maa 29. mai lk. 2, Lääne Elu 5. juuni lk. 2, Virumaa Teataja 6. juuni, lk. 11, Sakala 6. juuni lk. 2, Molodjozh Estonii 9. juuni lk. 7. Euroopa Parlamendi liige annab ülevaate EL biokütusepoliitikast
Newcombe, John R; Cuervo-Arango, Juan
2013-03-12
It is believed that during the spring transition, the developing follicle tends to grow more slowly, persist longer and grow to a larger diameter prior to ovulation than at subsequent oestrus periods. A general suspicion, that the first ovulation of the year is less fertile than subsequent ovulations could be explained by a slower growth rate of the ovulatory follicle during transition with the consequent production of a subfertile oocyte. By detailed serial examination of the same group of Irish Draught mares over three winter/spring periods, no significant difference was found in either growth rate or pre-ovulatory diameter when compared with subsequent ovulations. Mean growth rates over the ten days prior to ovulation were 2.20 mm/day (range 1.18 to 3.64) and 2.19 mm/day (range 1.25 to 3.41) for first and subsequent ovulations respectively. Mean maximum pre-ovulatory diameters were 44.7 mm (range 35 to 59) and 43.5 mm (range 31 to 57.5) for first and subsequent ovulations respectively. The impression gained by practitioners that the first follicle develops more slowly during the transition to the first ovulation of the season may be due to less frequent examinations and consequently a failure to observe and record that follicles may grow and then regress during this period. The largest follicle observed a few days previously is not necessarily the same large follicle found at a later examination.
Directory of Open Access Journals (Sweden)
Bruno Luiz Domingos De Angelis
2012-10-01
Full Text Available This study proposes to recover the Mandacarú Stream, located in the city of Maringá, Paraná State, Brazil by developing a greenway. The stream in question has been extremely degraded, principally by human activity. The proposed methodology begins with preparing a scenario for the valley floor with a greenway in place. This is followed by an investigation of the corridor’s ecological and cultural variables, taking a holistic view to synthesise and diagnose the information collected. Guidelines for recovering the valley floor and developing the greenway are then drawn up to direct the preparation of the final plan. As a result, the principal environmental impacts that undermine the quality of the study area were surveyed, such as erosion, loss of riparian vegetation, illegal sewage connections and lack of environmental education. A list of guidelines was developed for recovering and conserving the area, in combination with the development of a greenway along the valley floor. It is hoped that these guidelines can assist a future intervention at this location and that the proposed method can be used as the basis for the recovery of other urban valley floors.O presente estudo propõe a recuperação do fundo de vale do córrego Mandacarú, localizado na cidade de Maring, Estado do Paraná, por meio da implantação de um parque linear. O córrego em questão encontra-se bastante degradado, principalmente, pela ação antrópica. A metodologia proposta parte da elaboração de um cenário prévio para o fundo de vale com o parque linear implantado, em seguida será realizada uma investigação das variáveis ecológicas e culturais do corredor, além de uma síntese e diagnóstico destas informações coletadas por meio de uma visão holística, traçando-se diretrizes para recuperação do fundo de vale e implantação do parque que nortearão a elaboração do plano final. Como resultado, foram levantados os principais impactos ambientais que
Prevalence and Severity of Dysphonia in Patients with Cystic Fibrosis: A Pilot Study.
Willis, John; Michael, Deirdre D; Boyer, Holly; Misono, Stephanie
2015-07-01
To assess the prevalence and severity of dysphonia in patients with cystic fibrosis sinusitis. We hypothesized that patients with CF sinusitis, compared with 2 control groups, would have higher self-reported prevalence of dysphonia and greater severity of dysphonia, according to patient-reported outcome measures as well as auditory-perceptual evaluation by expert listeners. Cross-sectional comparative pilot study. Academic tertiary care clinic. Analysis included 37 study participants: 17 patients with CF sinusitis, 10 healthy individuals, and 10 patients with non-CF sinusitis. All participants completed the 10-item Voice Handicap Index (VHI-10) questionnaire and provided voice samples. On all samples, 6 blinded speech-language pathologists independently performed auditory-perceptual evaluation, using Consensus Auditory-Perceptual Evaluation of Voice. To assess severity of sinonasal symptoms, we used the 20-item Sinonasal Outcome Test (SNOT-20). Standard parametric and nonparametric statistical analysis was performed. The differences between the 3 groups in prevalence of abnormal VHI-10 scores were not statistically significant. SNOT-20 scores were similar in the 2 sinusitis patient groups. VHI-10 scores were highest in patients with CF sinusitis, intermediate in patients with non-CF sinusitis, and lowest in healthy individuals (P = .005). Auditory-perceptual evaluation demonstrated greater overall severity of dysphonia in patients with CF sinusitis compared with the 2 control groups (P = .0005). Cystic fibrosis sinusitis appeared to be associated with worse vocal function as measured by patient self-report as well as auditory-perceptual evaluation of voice compared with patients with non-CF sinusitis and healthy controls. Further investigation in this area is warranted. © American Academy of Otolaryngology—Head and Neck Surgery Foundation 2015.
A randomized controlled trial of stretch-and-flow voice therapy for muscle tension dysphonia.
Watts, Christopher R; Hamilton, Amy; Toles, Laura; Childs, Lesley; Mau, Ted
2015-06-01
To investigate the effect of stretch-and-flow voice therapy on vocal function and handicap. Randomized controlled trial. Participants with primary muscle tension dysphonia were randomly assigned to experimental or control groups. Experimental participants received vocal hygiene education followed by 6 weeks of stretch-and-flow voice therapy. Control participants received vocal hygiene education only. Outcome variables consisted of a measure of vocal handicap (Voice Handicap Index [VHI]), maximum phonation time, s/z ratio, and acoustic measures. All measures were obtained at baseline prior to treatment and within 2 weeks posttreatment or at the end of the control period. The pre- to posttreatment measurement change (delta Δ) was applied to statistical analyses. A multivariate analysis of variance revealed significant group differences in pre-to-post changes on measures of VHI, maximum phonation time, and cepstral peak prominence (CPP) in connected speech and vowels (P = 0.003, 0.013, 0.025, and 0.017 respectively), with a significant reduction of VHI (Cohen's d = 1.6), increase in maximum phonation time (Cohen's d = 1.2), increase of CPP in connected speech (Cohen's d = 1.2), and increase of CPP in vowels (Cohen's d = 1.1) in the experimental group compared to the control group. This preliminary small sample randomized controlled trial found significantly greater improvement in vocal handicap, maximum phonation time, and acoustic measures of vocal function after participants received stretch-and-flow voice therapy compared to participants receiving vocal hygiene education alone. Additional research incorporating larger samples will be needed to confirm and further investigate these findings. 1b. © 2015 The American Laryngological, Rhinological and Otological Society, Inc.
Directory of Open Access Journals (Sweden)
Arroyo C
2017-08-01
Full Text Available César Arroyo HM Montepríncipe University Hospital Laser Unit, Madrid, Spain Background: This study investigated a novel fractional carbon dioxide (CO2 laser for treatment of symptoms associated with vulvovaginal atrophy (VVA in perimenopausal women.Methods: The study included 21 perimenopausal women (mean age 45±7 years treated three times by CO2 laser resurfacing and coagulation of the vaginal canal tissue and mucosal tissue of the introitus. Vaginal health index (VHI scores were computed by the investigator at baseline and follow-ups. Subjects reported on sexual function, satisfaction, and improvement with treatment. A visual analog scale was used to measure discomfort with treatment.Results: Vaginal health and subject assessment of vaginal symptoms improved with successive treatments. At 12 weeks following the third treatment, 82% of the patients showed a statistically significant improvement in VHI (P<0.05. Additionally, 81% of subjects reported improvement in sexual gratification, 94% reported improvement in vaginal rejuvenation, and 100% reported satisfaction with treatment. VHI improvement remained significant at 6–8 months after treatments (P<0.01. Most patients (97% reported no to mild discomfort with treatment. Responses were mild and transient following treatment, with itching being the most commonly reported (20% side effect.Conclusion: In this study, fractional CO2 laser treatment was associated with improvement of vaginal health and amelioration of symptoms of VVA, resulting in improved sexual function in perimenopausal women. Treatment time was quick, and there was minimal discomfort associated with treatment. Investigation of clinical outcome in a larger study population is warranted. Keywords: genitourinary syndrome of menopause, vaginal rejuvenation, stress urinary incontinence, collagen remodeling, sexual dysfunction, vulvovaginal atrophy
Acoustic Analysis of Soccer Fans in Acute Phonotrauma After the Match.
Pinarbasli, Mehmet Ozgur; Kaya, Ercan; Ozudogru, Erkan; Gurbuz, Melek Kezban; Colak, Ertugrul; Aksoy, Mehmet Akif; Birdane, Leman; Guney, Fatma Ozgur
2017-11-13
Acute phonotrauma is the result of sound production by shouting or straining one's voice. In this study, we aimed to investigate the acute changes in the vocal folds and voices of soccer fans who voluntarily applied to our clinic after the soccer match where they engaged in acute phonotrauma. There are no other studies in the literature conducted on a similar sample group. This is a case-control study. Videolaryngostroboscopic (VLS) examination, acoustic voice analysis, and Voice Handicap Index (VHI) questionnaire were performed on 29 voluntary soccer fans included to the study before the match and at the first hour after the match. The values obtained were compared statistically with each other and with 29 control groups without voice pathology. The jitter, shimmer, and normalized noise energy values measured after the match increased significantly statistically compared with the pre-match level, but harmonic noise ratio value decreased significantly (P < 0.05). VHI scores increased significantly after the match according to the pre-match scores (P < 0.05). In the VLS examinations, there was no difference in the images before and after the match. It has been concluded that people who are using their voices loudly and intensely by shouting during the match are exposed to sound changes after the match, and if this situation becomes persistent, it may cause permanent voice pathologies. It is thought that VHI and acoustic voice analysis should be done together with VLS for diagnosis and follow-up of voice changes for which the VLS examination alone is not sufficient. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Illuminati, Giulio; Pizzardi, Giulia; Minni, Antonio; Masci, Federica; Ciamberlano, Bernardo; Pasqua, Rocco; Calio, Francesco G; Vietri, Francesco
2016-05-01
Schwannoma of the cervical vagus nerve is rare. Treatment options include intracapsular enucleation and en bloc resection. The purpose of this study was to compare the outcomes of enucleation and resection in terms of postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence, quality-adjusted life-year (QALY) and vocal handicap index (VHI). Twentytwo consecutive patients were divided into two groups. Patients in group A (n = 9) underwent intracapsular enucleation, whereas patients in Group B (n = 13) underwent en bloc resection. Main endpoints of the study were postoperative mortality and morbidity, freedom from vocal cord palsy, freedom from local recurrence and quality of life. The quality of life after surgery was assessed according to the quality-adjusted life-year (QALY) EQ-5D-5L methodology, and calculation of the voice handicap index (VHI). Postoperative mortality was nil. Morbidity included 1 wound dehiscence in group A and 2 transitory dysphagias in group B. Freedom from vocal cord palsy was 22% in group A and zero in group B (p = 0.15). Operation-specific local recurrence rate was 33% (3/9 patients) in group A and nil in group B (0/23 patients) (p = 0.05). QALYs was 0.55 in group A and 0.54 in group B (p = 1.0). VHI was 23.77 in group A and 26.15 in group B (p = 1.00). Resection is superior to enucleation in terms of freedom from local recurrence. Functional results are comparable for both techniques. Copyright © 2016 IJS Publishing Group Ltd. Published by Elsevier Ltd. All rights reserved.
Clinical experience with patients with spasmodic dysphonia and primary Meige syndrome.
Pedrero-Escalas, María Fernanda; García-López, Isabel; Santiago-Pérez, Susana; Vivancos, Francisco; Gavilán, Javier
2018-04-28
Meige syndrome (MS) is part of the group of segmental cranial dystonias, which affect more than two cranial muscle groups. Specifically, blepharospasm is associated with another cranial dystonia (oromandibular, cervical or laryngeal). The aim of this paper was to report our experience in patients with spasmodic dysphonia (SD) associated with primary MS. A retrospective study involving 8 patients between May 2010 and June 2015. Variables recorded were: age, sex, associated dystonia, electromyographic pattern in laryngeal muscles and treatment given. Outcomes after treatment were assessed using GRBAS(i) scale and VHI-30 questionnaire, always provided by the same examiner. Fifty-six patients with MS were treated in the Neurology Department. Eight patients of 56 were diagnosed with SD (prevalence of 14%). All of our patients had adductor SD. The median age was 71years. All the patients were treated with intralaryngeal botulinum toxin under electromyographic control. Clinically relevant improvements were found after treatment on both the GRBAS(i) scale and the VHI-30 questionnaire. In the study of SD, we should always rule out an association with MS. From the point of view of otorhinolaryngology, the joint use of the GRBAS(i) scale and the VHI-30 questionnaire are useful, reliable and efficient methods for assessing progress and response to treatment. Laryngeal infiltration under electromyographic control with botulinum toxin is the therapeutic alternative that provides better results. The management of SD associated with MS does not differ from isolated SD. Copyright © 2018 Sociedad Española de Otorrinolaringología y Cirugía de Cabeza y Cuello. Publicado por Elsevier España, S.L.U. All rights reserved.
Awan, Shaheen N; Roy, Nelson; Zhang, Dong; Cohen, Seth M
2016-03-01
The purposes of this study were to (1) evaluate the performance of the Cepstral Spectral Index of Dysphonia (CSID--a multivariate estimate of dysphonia severity) as a potential screening tool for voice disorder identification and (2) identify potential clinical cutoff scores to classify voice-disordered cases versus controls. Subjects were 332 men and women (116 men, 216 women) comprised of subjects who presented to a physician with a voice-related complaint and a group of non-voice-related control subjects. Voice-disordered cases versus controls were initially defined via three reference standards: (1) auditory-perceptual judgment (dysphonia +/-); (2) Voice Handicap Index (VHI) score (VHI +/-); and (3) laryngoscopic description (laryngoscopic +/-). Speech samples were analyzed using the Analysis of Dysphonia in Speech and Voice program. Cepstral and spectral measures were combined into a CSID multivariate formula which estimated dysphonia severity for Rainbow Passage samples (i.e., the CSIDR). The ability of the CSIDR to accurately classify cases versus controls in relation to each reference standard was evaluated via a combination of logistic regression and receiver operating characteristic (ROC) analyses. The ability of the CSIDR to discriminate between cases and controls was represented by the "area under the ROC curve" (AUC). ROC classification of dysphonia-positive cases versus controls resulted in a strong AUC = 0.85. A CSIDR cutoff of ≈24 achieved the best balance between sensitivity and specificity, whereas a more liberal cutoff score of ≈19 resulted in higher sensitivity while maintaining respectable specificity which may be preferred for screening purposes. Weaker but adequate AUCs = 0.75 and 0.73 were observed for the classification of VHI-positive and laryngoscopic-positive cases versus controls, respectively. Logistic regression analyses indicated that subject age may be a significant covariate in the discrimination of dysphonia-positive and VHI
Suitability Assessment of Satellite-Derived Drought Indices for Mongolian Grassland
Directory of Open Access Journals (Sweden)
Sheng Chang
2017-06-01
Full Text Available In Mongolia, drought is a major natural disaster that can influence and devastate large regions, reduce livestock production, cause economic damage, and accelerate desertification in association with destructive human activities. The objective of this article is to determine the optimal satellite-derived drought indices for accurate and real-time expression of grassland drought in Mongolia. Firstly, an adaptability analysis was performed by comparing nine remote sensing-derived drought indices with reference indicators obtained from field observations using several methods (correlation, consistency percentage (CP, and time-space analysis. The reference information included environmental data, vegetation growth status, and region drought-affected (RDA information at diverse scales (pixel, county, and region for three types of land cover (forest steppe, steppe, and desert steppe. Second, a meteorological index (PED, a normalized biomass (NorBio reference indicator, and the RDA-based drought CP method were adopted for describing Mongolian drought. Our results show that in forest steppe regions the normalized difference water index (NDWI is most sensitive to NorBio (maximum correlation coefficient (MAX_R: up to 0.92 and RDA (maximum CP is 87%, and is most consistent with RDA spatial distribution. The vegetation health index (VHI and temperature condition index (TCI are most correlated with the PED index (MAX_R: 0.75 and soil moisture (MAX_R: 0.58, respectively. In steppe regions, the NDWI is most closely related to soil moisture (MAX_R: 0.69 and the VHI is most related to the PED (MAX_R: 0.76, NorBio (MCC: 0.95, and RDA data (maximum CP is 89%, exhibiting the most consistency with RDA spatial distribution. In desert steppe areas, the vegetation condition index (VCI correlates best with NorBio (MAX_R: 0.92, soil moisture (MAX_R: 0.61, and RDA spatial distribution, while TCI correlates best with the PED (MAX_R: 0.75 and the RDA data (maximum CP is 79
Risk identification of agricultural drought for sustainable Agroecosystems
Dalezios, N. R.; Blanta, A.; Spyropoulos, N. V.; Tarquis, A. M.
2014-09-01
Drought is considered as one of the major natural hazards with a significant impact on agriculture, environment, society and economy. Droughts affect sustainability of agriculture and may result in environmental degradation of a region, which is one of the factors contributing to the vulnerability of agriculture. This paper addresses agrometeorological or agricultural drought within the risk management framework. Risk management consists of risk assessment, as well as a feedback on the adopted risk reduction measures. And risk assessment comprises three distinct steps, namely risk identification, risk estimation and risk evaluation. This paper deals with risk identification of agricultural drought, which involves drought quantification and monitoring, as well as statistical inference. For the quantitative assessment of agricultural drought, as well as the computation of spatiotemporal features, one of the most reliable and widely used indices is applied, namely the vegetation health index (VHI). The computation of VHI is based on satellite data of temperature and the normalized difference vegetation index (NDVI). The spatiotemporal features of drought, which are extracted from VHI, are areal extent, onset and end time, duration and severity. In this paper, a 20-year (1981-2001) time series of the National Oceanic and Atmospheric Administration/advanced very high resolution radiometer (NOAA/AVHRR) satellite data is used, where monthly images of VHI are extracted. Application is implemented in Thessaly, which is the major agricultural drought-prone region of Greece, characterized by vulnerable agriculture. The results show that agricultural drought appears every year during the warm season in the region. The severity of drought is increasing from mild to extreme throughout the warm season, with peaks appearing in the summer. Similarly, the areal extent of drought is also increasing during the warm season, whereas the number of extreme drought pixels is much less than
[A study on vowel duration and word length of adductor spasmodic dysphonia].
Chen, Zhipeng; Ge, Pingjiang
2016-03-01
To understand the vowel duration and statement reading of the adductor spasmodic dysphonia (ADSD) patients compared with their normal controls, and provide ideas for clinical diagnosis and treatment. Twenty-nine ADSD patients were included in the research, with 31 normal controls. All subjects filled in form voice handicap index (VHI) by themselves. Maximum phonetic time (MPT) and maximum loudness phonetic time(MLPT) were tested on /a/ sound for all patients. Also, all the patients were required to read aloud a standard mandarin assay named , duration were measured with Praat5. 0 software after sounds were collected. A one-way t-test was performed to compare spasmodic group with control group on VHI, MPT, MLPT and duration for reading standard sentences. Pearson/Spearman correlation was tested. Result: The VHI of the 29 ADSD patients is 89±12, and their normal controls 15±16, indicating that the VHI in ADSD group is significantly higher than in the control group(P<0. 01). The MPT of the ADSD group is(16. 9±9. 8 s), and the control group is (25. 3±10.0)s, indicating that MPT in the ADSD group is significantly shorter than the control group(P<0. 01). The MLPT of the ADSD group is (15.7±7. 6)s, and the control group is (26. 5±11. 4)s, indicating that MLPT in the ADSD group is significantly shorter than the control group (P<0. 01). The duration of standard sentence reading of the ADSD group is (55.0±14. 2)s, and the control group is (37. 8±4. 8)s, indicating that the duration of standard sentence reading in the ADSD group is significantly longer than the control group (P<0. 01). Correlation analysis showed that MPT and MLPT are related within the ADSD group(r=0. 697,P< 0.01), other indexes being tested have no significant correlations. The voice disorder condition of the ADSD patients is significantly worse than normal people. Their pronunciations on continuous vowels are not lasting compared with normal people. In the meantime, their ability to read sentences
Directory of Open Access Journals (Sweden)
Rinaldo Aparecido Galete
2011-01-01
Full Text Available O artigo analisa a estrutura produtiva da indústria de transformação na Microrregião de Maringá – MRM- (PR frente à economia paranaense, no período de 1994 a 2002, através da aplicação do Método Estutural-Diferencial (Shift-Share modificado. Os resultados indicaram que a MRM apresentou variação líquida total (VLT positiva. Existem elementos dinâmicos internos e/ou externos atuando na região. O efeito estrutural da região foi positivo, indicando que a região se especializou em setores mais dinâmicos os quais tendem a crescer mais do que média. O efeito diferencial foi positivo, indicando que na MRM há setores da indústria de transformação local que cresceram a taxas superiores ao crescimento dessa indústria em nível estadual, seja ela dinâmica ou não. A aplicação das modificações de Esteban-Marquillas indicou que quatro setores da indústria de transformação da MRM apresentaram efeito alocação positivo, apesar de que, no conjunto da indústria regional, a mesma apresenta vantagem competitiva com mesma estrutura estadual.Abstract This paper analysis the production structure of transformation industry in Microrregião de Maringá – MRM (PR in relation with the economics of Paraná at 1994-2008 by application of Shift-Share Metod. The results got show MRM presented VLT positive. There are internal and/or external forces working in the region. The structural effect of the region it was positive, indicating that the region specializes in the sectors most dynamics which tend to grow more that mean. The differential effect was positive, indicating that in MRM there are sectors of transformation industry that grew at rates higher than the growth of this industry in state level, be it dynamic or no. The Esteban-Marquillas changes´ indicated that four sectors of MRM industry transformation´ presented allocates effects positive, although the whole of regional industry, it displays the same competitive edge with
Cloning, high-level expression, purification and characterization of a ...
African Journals Online (AJOL)
Yomi
2012-03-15
Mar 15, 2012 ... sequences from S. aureus strains deposited in GenBank (AF332619, ... Metal ions and detergents also showed an inhibitory effect on rSak, especially Zn2+ and Cu2+ which .... at 6000 rpm for 10 min at 4°C. Wet cells was used immediately for .... 42% of the total proteins (Figure 2A, lanes 3 to 5) using.
Shervais, John W.; Vetter, Scott K.
1993-05-01
Many current models for the origin of lunar highland rocks feature as an essential component the assimilation of KREEPy material by primitive magmas parental to the Mg-rich suite and alkali suite plutonic rocks. Similar models have also been proposed for the origin of various mare basalt suites. However, any model which considers assimilation of KREEP an important petrologic process must sooner-or-later deal with the question: what is KREEP? Because pristine KREEP basalts are rare, and most known samples are small (e.g., 15382/15386), the geochemical variability of KREEP basalts is poorly known. Other KREEP compositions which are commonly used in these models include the hypothetical 'high-K KREEP' component of Warren and Wasson, which is derived from Apollo 14 soil data, and the 'superKREEP' quartz-monzodiorite 15405. Lunar breccia 15205 is a polymict regolith breccia that consists of approximately 20% KREEP basalt clasts and 20% quartz-normative basalt clasts in a KREEP-rich matrix. Bulk rock mixing calculations show that this sample comprises about 84% KREEP. The clasts range up to 1 cm in size, but most are considerably smaller. The primary aim is to characterize pristine KREEP basalts petrographically, to establish the range in chemical compositions of KREEP basalts, and to test models that were proposed for their origin. In addition, we may be able to extend the compositional range recognized in the quartz-normative basalt suite and cast some light on its origin as well. Preliminary whole rock geochemical data on the KREEP basalts are presented in a companion paper by M.M. Lindstrom and co-workers. Concentration is on petrography and mineral chemistry of these clasts, and the implications these data have for the origin of the different melt rock suites.
Directory of Open Access Journals (Sweden)
Márcia L. Paludo
2007-12-01
Full Text Available The lack of specific laboratorial diagnosis methods and precise symptoms makes the toxocariasis a neglected disease in Public Health Services. This study aims to determine the frequency of Toxocara spp. infection in children attended by the Health Public Service of Hospital Municipal de Maringá, South Brazil. To evaluate the association of epidemiological and clinical data, an observational and cross-section study was carried out. From 14,690 attended children/year aged from seven month to 12 years old, 450 serum samples were randomly collected from September/2004 to September/2005. A questionnaire was used to evaluate epidemiological, clinical and hematological data. An ELISA using Toxocara canis larval excretory-secretory products as antigen detected 130 (28.8% positive sera, mainly between children from seven month to five years old (p = 0.0016. Significant correlation was observed between positive serology for Toxocara, and frequent playing in sandbox at school or daycare center (p = 0.011 and the presence of a cat at home (p = 0.056. From the families, 50% were dog owners which exposed soil backyards. Eosinophilia (p = 0.776, and signs and symptoms analyzed (fever p = 0.992, pneumonia p = 0.289, cold-like symptoms p = 0.277, cough p = 0.783, gastrointestinal problems p = 0.877, migraine p = 0.979, abdominal pain p = 0.965, joint pain p = 0.686 and skin rash p = 0.105 could not be related to the presence of anti-Toxocara antibodies. Therefore, two asthmatics children showed titles of 1:10,240 and accentuated eosinophilia (p = 0.0001. The authors emphasize the needs of prevention activities.A falta de métodos de diagnóstico laboratorial específico e sintomas específicos fazem da toxocaríase uma doença negligenciada nos serviços públicos de saúde. Este estudo teve por objetivo determinar a freqüência de infecção por Toxocara spp. em crianças atendidas no serviço público do Hospital Municipal de Maringá, sul do Brasil, e
Scientific Creativity and High Ability: Gender and academic level differences
Directory of Open Access Journals (Sweden)
Fernando Javier ESPARZA MOLINA
2015-10-01
Full Text Available The purpose of this study was to investigate the influence of gender and educational level on scientific creativity among gifted/talented students. A cohort of creatividad científica y alta habilidad: diferencias de género y nivel educativo 78 secondary school students from 12 to 16 years old participated in this research. The scientific creativity was measured using the Creative Scientific Ability Test (Sak & Ayas, 2011 designed for secondary school students from 11 to 14 years old. Its theoretical framework sets up the measurement of a three dimensional structure: general creative abilities (fluency, flexibility and creativity, scientific creative abilities (hypothesis generation, hypothesis testing and evidence evaluation and scientific knowledge. This test has the right adequate psychometric properties with a Cronbach’s alpha coefficient of 0.848 (Sak & Ayas, 2013. Results indicated that male students scored significantly higher in a task named Interaction Graph which measures hypothesis generation in interdisciplinary science. The analysis also showed that students involved in upper education levels scores significantly higher in general fluency and in the task called The Food Chain which measures evidence evaluation in the area of ecology.
Purification and characterization of the three Snf1-activating kinases of Saccharomyces cerevisiae.
Elbing, Karin; McCartney, Rhonda R; Schmidt, Martin C
2006-02-01
Members of the Snf1/AMPK family of protein kinases are activated by distinct upstream kinases that phosphorylate a conserved threonine residue in the Snf1/AMPK activation loop. Recently, the identities of the Snf1- and AMPK-activating kinases have been determined. Here we describe the purification and characterization of the three Snf1-activating kinases of Saccharomyces cerevisiae. The identities of proteins associated with the Snf1-activating kinases were determined by peptide mass fingerprinting. These kinases, Sak1, Tos3 and Elm2 do not appear to require the presence of additional subunits for activity. Sak1 and Snf1 co-purify and co-elute in size exclusion chromatography, demonstrating that these two proteins form a stable complex. The Snf1-activating kinases phosphorylate the activation loop threonine of Snf1 in vitro with great specificity and are able to do so in the absence of beta and gamma subunits of the Snf1 heterotrimer. Finally, we showed that the Snf1 kinase domain isolated from bacteria as a GST fusion protein can be activated in vitro and shows substrate specificity in the absence of its beta and gamma subunits.
Directory of Open Access Journals (Sweden)
Graciette Matioli
2005-03-01
Full Text Available O número de pessoas que se alimenta fora de suas residências é cada vez maior, devido a vários fatores como crescimento das cidades, inserção da mulher no mercado de trabalho e tempo indisponível para o preparo das refeições. Para garantir a segurança dos alimentos oferecidos, é necessária a implantação das Boas Práticas, procedimentos padronizados que devem ser adotados com o objetivo de evitar as Doenças Transmitidas por Alimentos. O objetivo da presente pesquisa foi avaliar as condições de higiene no preparo de alimentos em restaurantes do tipo self-service da região central do município de Maringá. Foi aplicado um check-list (guia de verificação baseado na legislação vigente no país, de forma a verificar o nível de Não-conformidades apresentadas pelos estabelecimentos. Os resultados mostraram uma variação de 10,8 a 60,9% de Não-conformidade. Conclui-se que a maioria dos restaurantes pesquisados possui condições de higiene insatisfatórias e não atendem a legislação vigente no país no que diz respeito às Boas Práticas para a produção de alimentos segurosThe number of people who eat out of their residences is becoming bigger, due to several factors: the growth of the cities, the woman's insert in the job market and the unavailable time for meals preparation. To guarantee the safety of the supplied foods, it is necessary to adopt the Good Practices, that are, standardized procedures followed with the objective of avoiding the Diseases Transmitted by Foods. This work aimed to evaluate the hygienic-sanitary conditions in the foods preparation provided by restaurants of the type self-service to the downtown population of Maringá. A check-list was applied (verification guide based on the current legislation in the country, in order to verify the Non-Conformities level presented by the establishments. The results showed a variation from 10.8 to 60.9% of Non-Conformities and that most of the researched
Lin, R Jun; Munin, Michael C; Rosen, Clark A; Smith, Libby J
2017-07-01
Intralaryngeal muscle synkinesis associated with unilateral vocal fold paralysis (UVFP) is thought to preserve thyroarytenoid-lateral cricoarytenoid muscle complex tone, resulting in a better voice despite the presence of vocal fold paralysis (VFP). This study compares voice handicap in patients with unilateral VFP (UVFP) with and without evidence of adductory synkinesis on laryngeal electromyography (LEMG). Retrospective review of LEMG data and Voice Handicap Index-10 (VHI-10) scores of patients diagnosed with permanent UVFP. LEMG was performed within 1 to 6 months post onset of UVFP. Patients were stratified into two groups: 1) recurrent laryngeal nerve (RLN) neuropathy with synkinesis and 2) RLN neuropathy without synkinesis. Synkinesis was diagnosed when the sniff to phonation maximum amplitude ratio was ≥0.65. VHI-10 scores at 6-month follow-up were recorded. Four hundred forty-nine patients with UVFP and who had an LEMG were reviewed. Eighty-three patients met the inclusion criteria, with 16 in group 1 and 67 in group 2. There was no significant difference between the groups with regard to age, timing of LEMG from onset of VFP, number of patients undergoing temporary vocal fold injection or use of off-label nimodipine. Average VHI-10 scores at 6 months post onset of VFP were 14.4 ± 10.6 for patients with LEMG-identified synkinesis (group 1) and 21.0 ± 10.1 for patients with no LEMG evidence of synkinesis (group 2). This was statistically significant (P = .02). Patients with unilateral vocal fold paralysis and LEMG evidence of laryngeal synkinesis are more likely to have less perceived voice handicap than those without synkinesis. 4. Laryngoscope, 127:1628-1632, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.
Caffier, Philipp P; Salmen, Tatjana; Ermakova, Tatiana; Forbes, Eleanor; Ko, Seo-Rin; Song, Wen; Gross, Manfred; Nawka, Tadeus
2017-12-01
There are few data demonstrating the specific extent to which surgical intervention for vocal fold nodules (VFN) improves vocal function in professional (PVU) and non-professional voice users (NVU). The objective of this study was to compare and quantify results after phonomicrosurgery for VFN in these patient groups. In a prospective clinical study, surgery was performed via microlaryngoscopy in 37 female patients with chronic VFN manifestations (38±12 yrs, mean±SD). Pre- and postoperative evaluations of treatment efficacy comprised videolaryngostroboscopy, auditory-perceptual voice assessment, voice range profile (VRP), acoustic-aerodynamic analysis, and voice handicap index (VHI-9i). The dysphonia severity index (DSI) was compared with the vocal extent measure (VEM). PVU (n=24) and NVU (n=13) showed comparable laryngeal findings and levels of suffering (VHI-9i 16±7 vs 17±8), but PVU had a better pretherapeutic vocal range (26.8±7.4 vs 17.7±5.1 semitones, p<0.001) and vocal capacity (VEM 106±18 vs 74±29, p<0.01). Three months postoperatively, all patients had straight vocal fold edges, complete glottal closure, and recovered mucosal wave propagation. The mean VHI-9i score decreased by 8±6 points. DSI increased from 4.0±2.4 to 5.5±2.4, and VEM from 95±27 to 108±23 (p<0.001). Both parameters correlated significantly (rs=0.82). The average vocal range increased by 4.1±5.3 semitones, and the mean speaking pitch lowered by 0.5±1.4 semitones. These results confirm that phonomicrosurgery for VFN is a safe therapy for voice improvement in both PVU and NVU who do not respond to voice therapy alone. Top-level artistic capabilities in PVU were restored, but numeric changes of most vocal parameters were considerably larger in NVU.
Kooijman, P G C; de Jong, F I C R S; Oudes, M J; Huinck, W; van Acht, H; Graamans, K
2005-01-01
The aim of this study was to investigate the relationship between extrinsic laryngeal muscular hypertonicity and deviant body posture on the one hand and voice handicap and voice quality on the other hand in teachers with persistent voice complaints and a history of voice-related absenteeism. The study group consisted of 25 female teachers. A voice therapist assessed extrinsic laryngeal muscular tension and a physical therapist assessed body posture. The assessed parameters were clustered in categories. The parameters in the different categories represent the same function. Further a tension/posture index was created, which is the summation of the different parameters. The different parameters and the index were related to the Voice Handicap Index (VHI) and the Dysphonia Severity Index (DSI). The scores of the VHI and the individual parameters differ significantly except for the posterior weight bearing and tension of the sternocleidomastoid muscle. There was also a significant difference between the individual parameters and the DSI, except for tension of the cricothyroid muscle and posterior weight bearing. The score of the tension/posture index correlates significantly with both the VHI and the DSI. In a linear regression analysis, the combination of hypertonicity of the sternocleidomastoid, the geniohyoid muscles and posterior weight bearing is the most important predictor for a high voice handicap. The combination of hypertonicity of the geniohyoid muscle, posterior weight bearing, high position of the hyoid bone, hypertonicity of the cricothyroid muscle and anteroposition of the head is the most important predictor for a low DSI score. The results of this study show the higher the score of the index, the higher the score of the voice handicap and the worse the voice quality is. Moreover, the results are indicative for the importance of assessment of muscular tension and body posture in the diagnosis of voice disorders.
Disease-specific self-efficacy in spasmodic dysphonia patients.
Hu, Amanda; Isetti, Derek; Hillel, Allen D; Waugh, Patricia; Comstock, Bryan; Meyer, Tanya K
2013-03-01
Self-efficacy (SE) is an optimistic self-belief that one can perform a novel task. This concept involves empowerment, self-esteem, and adaptation to a stressful situation. SE is a strong predictor of health behaviors. Our objectives were to study SE in spasmodic dysphonia (SD) and to develop a disease-specific SE-SD scale. Prospective study. Academic hospital. Disease-specific SE-SD items were developed with laryngologists, speech pathologists, and SD patients. These items, General SE Scale, Voice Handicap Index-10 (VHI-10), Consensus Auditory Perceptual Evaluation of Voice (CAPE-V), and Hospital Anxiety and Depression Scale (HADS), were administered to SD patients who presented for botulinum toxin injections. One hundred forty-five SD patients (mean age 59.5 ± 13.6 years) had a general SE score (Cronbach's α = 0.894) of 33.4 ± 5.2 out of 40. This was negatively correlated with HADS-A (r = -0.42, P < 0.001) and HADS-D (r = -0.42, P < .001), but not correlated with VHI-10 (r = -0.098, P = .243) and CAPE-V (r = -0.047, P = .57). Factor analysis selected 8 items from the general SE scale and 5 disease-specific SE-SD items to generate a 13-item disease-specific SE-SD scale (Cronbach's α = 0.907). Disease-specific SE-SD score was 42.1 ± 6.9 out of 52 and was negatively correlated with VHI-10 (r = -0.19, P = .005), HADS-A (r = -0.43, P < .001), and HADS-D (r = -0.57, P < .001), but not correlated with CAPE-V (r = -0.024, P = .60). SD patients established on botulinum toxin injections have high degrees of general and disease-specific SE. Patients with higher SE-SD demonstrate lower vocal handicap and lower levels of anxiety and depression. A 13-item disease-specific SE-SD scale has been developed.
Long-term consequences of vocal fold hemorrhage.
Kerwin, Lewis J; Estes, Christine; Oromendia, Clara; Christos, Paul; Sulica, Lucian
2017-04-01
To assess the long-term impact of vocal fold hemorrhage (VFH) on vocal function and health, and compare these parameters to those in similar patients who have not had VFH. Retrospective cohort study. Patients with a history of VFH (N = 41) were characterized through a review of records and assessed by means of a survey for vocal health and professional functioning as well as the Voice Handicap Index-10 (VHI-10) and, if appropriate (n = 30, 73.2%), the Singing Voice Handicap Index (SVHI-10). They were compared to a group of demographically and occupationally similar patients without VFH (N = 25, 60.9%). Patients with multiple episodes of VFH (n = 9, 22.0%) were compared to patients with a single event. After a median of 41 months follow-up, patients with VFH had favorable vocal function assessment and low median VHI-10 and SVHI-10 scores (4 and 6, respectively), substantially similar to patients without VFH (VHI-10, P = .905 and SVHI 10, P =.991). The two groups showed similarly low rates of change in occupation (7.3%vs. 8.0%, P =.999). Patients with VFH were more likely to have missed days of work due to a voice problem. Analysis of patients with one versus multiple VFH episodes showed no differences, except patients with multiple episodes had significantly greater confidence in their ability to address future VFH. Contrary to commonly held belief, VFH appears to have no significant long-term impact on vocational stability, subjective voice quality, or perceptions of vocal function. Moreover, among those with VFH, recurrence seems only to diminish anxiety over this transient injury. 4 Laryngoscope, 127:900-906, 2017. © 2016 The American Laryngological, Rhinological and Otological Society, Inc.
Ikuma, Takeshi; Kunduk, Melda; McWhorter, Andrew J.
2014-01-01
Purpose: The model-based quantitative analysis of high-speed videoendoscopy (HSV) data at a low frame rate of 2,000 frames per second was assessed for its clinical adequacy. Stepwise regression was employed to evaluate the HSV parameters using harmonic models and their relationships to the Voice Handicap Index (VHI). Also, the model-based HSV…
Predictors of Choral Directors' Voice Handicap
Schwartz, Sandra
2013-01-01
Vocal demands of teaching are considerable and these challenges are greater for choral directors who depend on the voice as a musical and instructive instrument. The purpose of this study was to (1) examine choral directors' vocal condition using a modified Voice Handicap Index (VHI), and (2) determine the extent to which the major variables…
Peasant struggles and social change: migration, households and gender in a rural Turkish society.
Ilcan, S M
1994-01-01
"This article sheds light on the interrelationship of seasonal migration, subsistence production and peasant relations in a community (Sakli) located in Turkey's northwestern countryside.... While migrant labor is understood by local villagers as forming part of a continual battle to preserve local tradition and kinship ties, this article shows how it reduces the dominion of landlords while creating internal household differentiation and gendered hierarchies." excerpt
Pärmann, Silvia
2014-01-01
Ahti Grünbergi ja Tõnis Kalve mööbliseeria Derelict. Maile Grünbergi disainitud toolid ja laud Madis. Taniel Kolpakovi kaubamärgile Rough Bloom disainitud köögimööbel. Kaubamärgi Varm Country uus kollektsioon Basic no 2. Kersti Laanmaa keraamilised teekannud Kiviaeg ja Jänes kapsas. Tiina Mangi kavandatud diivan Sik-Sak. Tõnis Vellama valgustimudel AET27
Utility approach to decision-making in extended T1 and limited T2 glottic carcinoma.
van Loon, Yda; Stiggelbout, Anne M; Hakkesteegt, Marieke M; Langeveld, Ton P M; de Jong, Rob J Baatenburg; Sjögren, Elisabeth V
2017-04-01
It is still undecided if endoscopic laser surgery or radiotherapy is the preferable treatment in extended T1 and limited T2 glottic tumors. Health utilities assessed from patients can aid in decision-making. Patients treated for extended T1 or limited T2 glottic carcinoma by laser surgery (n = 12) or radiotherapy (n = 14) assigned health utilities using a visual analog scale (VAS), time tradeoff (TTO) technique and scored their voice handicap using the Voice Handicap Index (VHI). VAS and TTO scores were slightly lower for the laser group compared to the radiotherapy group, however, not significantly so. The VHI showed a correlation with the VAS score, which was very low in both groups and can be considered (near) normal. Patients show no clear preference for the outcomes of laser surgery or radiotherapy from a quality of life (QOL) or voice handicap point of view. These data can now be incorporated into decision-making models. © 2017 Wiley Periodicals, Inc. Head Neck, 2017 © 2016 Wiley Periodicals, Inc. Head Neck 39: 779-785, 2017. © 2017 Wiley Periodicals, Inc.
Rodgerson, D H; Belknap, J K; Wilson, D A
2001-01-01
To describe in horses and ponies a laparoscopic ovariectomy technique facilitated by electrosurgical instrumentation. Elective ovariectomy was performed in 23 mares using laparoscopic electrosurgical instrumentation. Twenty-three mares (13 horses, 10 ponies), aged from 2 to 21 years and weighing 90 to 545 kg. Food was withheld for a minimum of 12 hours. Mares were sedated with detomidine hydrochloride (0.02 to 0.03 mg/kg) or xylazine hydrochloride (0.5 to 1.0 mg/kg). Excluding the pony mares, all other mares were restrained in stocks. Portal sites in the paralumbar fossa region were desensitized with 2% mepivacaine. Abdominal insufflation was achieved through a teat cannula positioned in the ventral abdomen or a Verres-type needle placed through the paralumbar fossa. After trocar and laparoscope insertion, the ipsilateral ovary and mesovarium were identified, and the mesovarium, tubal membrane, and proper ligament were infiltrated with 2% mepivacaine. The mesovarium was coagulated using bipolar or monopolar electrosurgical forceps and transected sequentially from cranial to caudal until the ovary was completely freed and then removed. The contralateral ovary was removed in a similar fashion through the opposite paralumbar fossa. Bipolar and monopolar electrosurgical forceps were easy to use and provided adequate coagulation of vessels within the mesovarium. Two mares were euthanatized after the procedure for unrelated reasons. One mare had mild signs of colic 24 hours after ovariectomy. In 1 pony mare, the incision used to remove one ovary dehisced on the 5th postoperative day and was allowed to heal by second-intention. No long-term complications had occurred in 11 horses and 10 ponies, 6 to 24 months after surgery. Laparoscopic ovariectomy and hemostasis of the mesovarium can be easily accomplished using electrosurgical instrumentation. Standing laparoscopic ovariectomy, using electrosurgical instrumentation, is an effective and safe technique to provide
Ye, Tian; Elbing, Karin; Hohmann, Stefan
2008-09-01
It recently became apparent that the highly conserved Snf1p protein kinase plays roles in controlling different cellular processes in the yeast Saccharomyces cerevisiae, in addition to its well-known function in glucose repression/derepression. We have previously reported that Snf1p together with Gis4p controls ion homeostasis by regulating expression of ENA1, which encodes the Ena1p Na(+) extrusion system. In this study we found that Snf1p is rapidly phosphorylated when cells are exposed to NaCl and this phosphorylation is required for the role of Snf1p in Na(+) tolerance. In contrast to activation by low glucose levels, the salt-induced phosphorylation of Snf1p promoted neither phosphorylation nor nuclear export of the Mig1p repressor. The mechanism that prevents Mig1p phosphorylation by active Snf1p under salt stress does not involve either hexokinase PII or the Gis4p regulator. Instead, Snf1p may mediate upregulation of ENA1 expression via the repressor Nrg1p. Activation of Snf1p in response to glucose depletion requires any of the three upstream protein kinases Sak1p, Tos3p and Elm1p, with Sak1p playing the most prominent role. The same upstream kinases were required for salt-induced Snf1p phosphorylation, and also under these conditions Sak1p played the most prominent role. Unexpectedly, however, it appears that Elm1p plays a dual role in acquisition of salt tolerance by activating Snf1p and in a presently unknown parallel pathway. Together, these results indicate that under salt stress Snf1p takes part in a different pathway from that during glucose depletion and this role is performed together as well as in parallel with its upstream kinase Elm1p. Snf1p appears to be part of a wider functional network than previously anticipated and the full complexity of this network remains to be elucidated.
Directory of Open Access Journals (Sweden)
Shaimaa Selim
Full Text Available Obesity and insulin resistance have been shown to be risk factors for laminitis in horses. The objective of the study was to determine the effect of changes in body condition during the grazing season on insulin resistance and the expression of genes associated with obesity and insulin resistance in subcutaneous adipose tissue (SAT. Sixteen Finnhorse mares were grazing either on cultivated high-yielding pasture (CG or semi-natural grassland (NG from the end of May to the beginning of September. Body measurements, intravenous glucose tolerance test (IVGTT, and neck and tailhead SAT gene expressions were measured in May and September. At the end of grazing, CG had higher median body condition score (7 vs. 5.4, interquartile range 0.25 vs. 0.43; P=0.05 and body weight (618 kg vs. 572 kg ± 10.21 (mean ± SEM; P=0.02, and larger waist circumference (P=0.03 than NG. Neck fat thickness was not different between treatments. However, tailhead fat thickness was smaller in CG compared to NG in May (P=0.04, but this difference disappeared in September. Greater basal and peak insulin concentrations, and faster glucose clearance rate (P=0.03 during IVGTT were observed in CG compared to NG in September. A greater decrease in plasma non-esterified fatty acids during IVGTT (P<0.05 was noticed in CG compared to NG after grazing. There was down-regulation of insulin receptor, retinol binding protein 4, leptin, and monocyte chemoattractant protein-1, and up-regulation of adiponectin (ADIPOQ, adiponectin receptor 1 and stearoyl-CoA desaturase (SCD gene expressions in SAT of both groups during the grazing season (P<0.05. Positive correlations were observed between ADIPOQ and its receptors and between SCD and ADIPOQ in SAT (P<0.01. In conclusion, grazing on CG had a moderate effect on responses during IVGTT, but did not trigger insulin resistance. Significant temporal differences in gene expression profiles were observed during the grazing season.