WorldWideScience

Sample records for j-3 spokane wa

  1. Testing the metals hypothesis in Spokane, Washington.

    OpenAIRE

    Claiborn, Candis S.; Larson, Timothy; Sheppard, Lianne

    2002-01-01

    A >7-year, time-series, epidemiologic study is ongoing in Spokane, Washington, to examine the associations between ambient particulate constituents or sources and health outcomes such as emergency department (ED) visits for asthma or respiratory problems. One of the hypotheses being tested is that particulate toxic metals are associated with these health outcomes. Spokane is a desirable city in which to conduct this study because of its relatively high concentrations of particulate matter, lo...

  2. WA18

    CERN Multimedia

    1977-01-01

    Front view. The target plates are cut from marble (3x3 m slabs surrounded by magnetized iron) and allow the use of the calorimeter as a muon polarimeter. WA18 was CHARM, the experiment of the CERN-Hamburg-Amsterdam-Rome(INFN)-Moskow(ITEP) Collaboration

  3. Spokane Tribal Hatchery, 2005 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Peone, Tim L. (Spokane Tribe of Indians, Wellpinit, WA)

    2006-03-01

    Due to the construction and operation of Grand Coulee Dam (1939), anadromous salmon have been eradicated and resident fish populations permanently altered in the upper Columbia River region. Federal and private hydropower dam operations throughout the Columbia River system severely limits indigenous fish populations in the upper Columbia. Artificial production has been determined appropriate for supporting harvestable fisheries for kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) in Lake Roosevelt and Banks Lake (Grand Coulee Dam impoundments). The Spokane Tribe, Washington Department of Fish and Wildlife, Colville Confederated Tribes and Lake Roosevelt Development Association/Lake Roosevelt Volunteer Net Pen Project are cooperating in a comprehensive artificial production program to produce kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) for annual releases into the project area. The program consists of the Spokane Tribal Hatchery, Sherman Creek Hatchery, Ford Trout Hatchery and Lake Roosevelt Rainbow Trout Net Pen Rearing Projects. The Lake Roosevelt and Banks Lake Fisheries Evaluation Program monitor and evaluates release strategies and production methods for the aforementioned projects. Between 1985 and 2005 the projects have collectively produced up to 800,000 rainbow trout and 4 million kokanee salmon for release into Lake Roosevelt and 1.4 million kokanee fry for Banks Lake annually. In 2005, the annual release goal included 3.3 million kokanee fry, 475,000 kokanee yearlings and 500,000 rainbow trout yearlings. Fish produced by this project in 2005 to meet collective fish production and release goals included: 3,446,438 kokanee fingerlings, 347,730 rainbow trout fingerlings and 525,721 kokanee yearlings. Kokanee yearlings were adipose fin clipped before release. Stock composition consisted of Meadow Creek and Lake Whatcom kokanee, diploid-triploid Spokane Trout Hatchery (McCloud River) rainbow trout and Phalon Lake red-band rainbow trout. All kokanee were marked with either thermal, oxytetracyline or fin clips prior to release. Preliminary 2004 Lake Roosevelt fisheries investigations indicate hatchery/net pen stocking significantly contributed to rainbow trout catch and harvest rates while the impact on the kokanee fishery was minimal. Success of the Lake Roosevelt kokanee artificial production program appears to be limited primarily owing to predation, precocity and high entrainment rates through Grand Coulee Dam. Recommendations for future hatchery/net pen operations include use of stocks compatible or native to the upper Columbia River, continue kokanee fry and post-smolt releases, 100% triploid hatchery stock rainbow trout used and adipose fin clip hatchery stock rainbow trout prior to release. The Spokane Tribal Hatchery is funded by the Bonneville Power Administration under directives by the Northwest Power Conservation Council Columbia River Basin Fish & Wildlife Program, Resident Fish Substitution Measures, 1987 to current (Subbasin Plan), as partial mitigation for anadromous and resident fish losses in the blocked areas above Chief Joseph and Grand Coulee Dams.

  4. Spokane Tribal Hatchery, 2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Peone, Tim L. (Spokane Tribe of Indians, Wellpinit, WA)

    2005-03-01

    Due to the construction and operation of Grand Coulee Dam (1939), anadromous salmon have been eradicated and resident fish populations permanently altered in the upper Columbia River region. Federal and private hydropower dam operations throughout the Columbia River system severely limits indigenous fish populations in the upper Columbia. Artificial production has been determined appropriate for supporting a harvestable fishery for kokanee salmon (Oncorhynchus nerka) and rainbow trout (Oncorhynchus mykiss) in Lake Roosevelt and Banks Lake (Grand Coulee Dam impoundments). A collaborative multi-agency artificial production program for the Lake Roosevelt and Banks Lake fisheries exists consisting of the Spokane Tribal Hatchery, Sherman Creek Hatchery, Ford Trout Hatchery and the Lake Roosevelt Kokanee and Rainbow Trout Net Pen Rearing Projects. These projects operate complementary of one another to target an annual release of 1 million yearling kokanee and 500,000 yearling rainbow trout for Lake Roosevelt and 1.4 million kokanee fry/fingerlings for Banks Lake. Fish produced by this project in 2004 to meet collective fish production and release goals included: 1,655,722 kokanee fingerlings, 537,783 rainbow trout fingerlings and 507,660 kokanee yearlings. Kokanee yearlings were adipose fin clipped before release. Stock composition consisted of Lake Whatcom kokanee, 50:50 diploid-triploid Spokane Trout Hatchery (McCloud River) rainbow trout and Phalon Lake red-band rainbow trout. All kokanee were marked with either thermal, oxytetracyline or fin clips prior to release. Preliminary 2004 Lake Roosevelt fisheries investigations indicate hatchery/net pen stocking significantly contributed to harvestable rainbow trout and kokanee salmon fisheries. An increase in kokanee harvest was primarily owing to new release strategies. Walleye predation, early maturity and entrainment through Grand Coulee Dam continues to have a negative impact on adult kokanee returns and limits the success of hatchery/net pen stocking on the number of harvestable fish. Recommendations for future hatchery/net pen operations include use of stocks compatible or native to the upper Columbia River, continue hatchery-rearing practices to reduce precocity rates of kokanee and continue new kokanee stocking strategies associated with increased kokanee harvest rates.

  5. J3 turbojet engine; J3 engine

    Energy Technology Data Exchange (ETDEWEB)

    Murashima, K. [Ishikawajima-Harima Heavy Industries Co. Ltd., Tokyo (Japan)

    1999-11-20

    Operational duties are almost over for the J3-7 engine installed aboard the T-1B and P-2J aircraft. Although it is not an engine endowed with any remarkable features, it enjoys high evaluation as an engine that has operated with stability throughout its service life without any serious accident attributable to itself. It is a turbojet engine that has an 8-stage axial flow compressor, annular combustor, and a 1-stage axial flow turbine. The compressor outer diameter is constant except at the inlet section where it is tapered outward, and all the blades are fixed. The rotor is of the disk structure, and the static vanes have shrouds on the inner side, arranged in 6 sectors in the direction of circumference. The combustor is of the evaporation type, which was rarely employed those days. The starter is of the starter-generator type connected directly to the main shaft, and the fuel control system is of the hydromechanical type. It is the first jet engine that Japan succeeded in putting to practical application, and the experience of J3 construction is believed to constitute the very foundation on which the research and development of later aeroengines is based. (NEDO)

  6. 76 FR 27668 - ASC Machine Tools, Inc., Spokane Valley, WA; Notice of Negative Determination on Reconsideration

    Science.gov (United States)

    2011-05-12

    ...DEPARTMENT OF LABOR Employment and Training...2010, the Department of Labor issued an Affirmative...misinterpretation of facts or of the law justified reconsideration...Machinery Corporation in Taiwan and Metform International...Machinery Corporation in Taiwan and Metform...

  7. 77 FR 25742 - Notice of Inventory Completion: Northwest Museum of Arts & Culture, Spokane, WA; Correction

    Science.gov (United States)

    2012-05-01

    ...Representatives of any other Indian tribe that believes itself...Northwest Museum of Arts & Culture, 2316 West First Ave...Tribes of the Colville Indian Reservation, Washington...Northwest Museum of Arts & Culture is responsible for notifying...Tribes of the Colville Indian Reservation,...

  8. 75 FR 58429 - Notice of Inventory Completion: Northwest Museum of Arts & Culture, Spokane, WA

    Science.gov (United States)

    2010-09-24

    ...Museum of Arts & Culture professional staff...Tribes of the Colville Indian Reservation, Washington...Tribes of the Colville Indian Reservation, Washington...Museum of Arts & Culture have determined that...Museum of Arts & Culture is responsible for...Tribes of the Colville Indian Reservation,...

  9. At WA18

    CERN Multimedia

    1977-01-01

    The target calorimeter of the WA18 neutrino counter experiment as installed in the West Area of the SPS. On the background, right the CDHS set-up. Jim Allaby stands at centre, bottom. WA18 was set-up by the CERN- Hamburg-Amsterdam-Rome(INFN)-Moscow(ITEP) Collaboration.

  10. Top view of WA3

    CERN Multimedia

    1977-01-01

    The WA3 experiment by the Amsterdam-CERN-Cracow-Munich-Oxford-Rutherford (ACCMORE)Collaboration aimed to study exclusive pion and kaon interactions with protons. WA7 is seen on the backgound (top). The hut on the right is WA3, the hut on the left is WA2.

  11. At WA11

    CERN Multimedia

    1977-01-01

    Starting with february 1977 the WA5 spectrometer of the Indiana-Saclay Collaboration originally designed to study hadron backward scattering on protons, and later modified by the Indiana-Imperial College (London)-Saclay-Southampton Collaboration, was used (experiment WA11) to search for high mass states produced with the J/psi. On the left, Tom Marshall moves in a beam hodoscope. On the right, at the entrance of the Goliath magnet, one sees the 1 m long hydrogen target. (Later the set-up was reshuffled, and the hydrogen target was replaced by a set of Be targets located upstream of the magnet.)

  12. At WA7

    CERN Multimedia

    1977-01-01

    The CERN-Genoa-Annecy(LAPP)- Niels Bohr Institute, Copenhagen-Oslo-University College,London Collaboration set-up the experiment WA7 to study two-body reactions at large transverse momentum. Here, Michel Yvert, Alberto Santronico, Per Carlson

  13. At WA3

    CERN Multimedia

    1977-01-01

    Installation of one half of the photon calorimeter as a part of the multiparticle spectrometer of the ACCMOR Collaboration (WA3). The calorimeter was 28 radiation lengths deep and consisted of two identical blocks of 40 scintillator planes with 2 cm wide elements, interleaved with layers of lead 4 mm thick. Robert Klanner stands on the right (see photo 7710073).

  14. Preparing for WA34

    CERN Multimedia

    1977-01-01

    Following a proposal by a CERN-Florence-Genova Collaboration to study charmed particles photoproduced in emulsion plates tagged by the Omega apparatus triggers, WA34 was a test exposure to demonstrate the validity of the experimental method. Here (centre) Giordano Diambrini-Palazzi inside the Omega magnet. the validity of the experimental method.

  15. The WA98 experiment

    International Nuclear Information System (INIS)

    The WA98 collaboration has as an objective the study of the hadron and photon production in Pb + Pb collisions. In these interactions in which hot hadronic matter is produced in a large volume, one can investigate a phase transition to the quark-gluon plasma. In order to identify anomalous events or class of events, a particular attention is given to the reaction characterization. The space phase evolution of the reaction volume is studied by the Bose-Einstein correlations of the charged hadrons while the thermal evolution of the system is determined by the direct photons. The WA98 experimental setup is a highly segmented photon-multiplicity detector placed at 21.5 m away from the target. The photon multiplicity is measured by a PMD detector while the negative particle tracking is realized by six avalanche chamber readout by CCD cameras. A second tracking branch made of two avalanche chambers and two streamer tube planes is associated to a time-of-flight measurement system. The two tracking branches determine the two-particle correlations. A silicon-drift and a silicon-pad detectors are designed for measurements of charged particle multiplicity within the 2.0-3.8 rapidity interval. The collision centrality is determined by means of the transverse energy measured by a calorimeter located at the mean rapidity and the spectator energy evaluated by a 0o calorimeter. The DST production is under way at Lyon Computer Center as well as the preparation of final analysis

  16. Solar-energy-system performance evaluation, General Electric Spokane operational test site, Spokane, Washington, October 1980 - March 1981

    Science.gov (United States)

    Welch, K. M.

    1981-09-01

    The General Electric-Spokane site is a YWCA building in Washington. The active solar energy system is designed to supply 45% of the heating load, 20% of the hot water load, and 60% of the pool heating load. It is equipped with 5,222 square feet of evacuated tube collectors, 6,700 gallons of water for heat storage, and an auxiliary natural gas-fired boiler. The solar fraction, solar savings ratio, conventional fuel savings, system performance factor, and solar savings ratio, conventional fuel savings, system performance factor, and solar system coefficient of performance is given, as well as performance data for the collector, storage, domestic hot water, space heating and pool heating subsystems, operating energy, energy savings, and weather conditions.

  17. 77 FR 25736 - Notice of Intent To Repatriate Cultural Items: Northwest Museum of Arts & Culture, Spokane, WA...

    Science.gov (United States)

    2012-05-01

    ...or leather fragments, 3 antler digging sticks, 1 abalone shell pendant, 5 scrapers...1 small box of dentalia beads, 1 bone needle, 1 copper pendant, 18 rolled copper...mussel shell, 1 antler wedge, 1 slate needle, 1 slate pendant, 1 pipe...

  18. Shock waves in condensed matter; Proceedings of the fourth topical conference, Spokane, WA, July 22-25, 1985

    International Nuclear Information System (INIS)

    In these proceedings concerned with shock waves, topics on the equation of state, optical studies, mechanical properties, dynamic fracture and fragmentation, experimental developments, geophysical materials and applications, hydrodynamics, material synthesis, and energetic materials are discussed. Papers are presented on the theory of the high-temperature shocked metallic state, shock-induced radiation from minerals, a micromechanical model of porous-brittle solids, and strain rate dependence in steady plastic shock waves. Consideration is given to an application of geometric statistics to dynamic fragmentation, shock temperature measurements in ammonia, the shock loading and release behavior of X-cut quartz, and the calculation of the dimensions of the steady Mach wave. Additional papers are on chemical synthesis under high-pressure shock loading and rate-determining steps for ingnition of shocked nitromethane. Special attention is given to computer simulation of nonequilibrium processes

  19. 75 FR 58424 - Notice of Intent to Repatriate Cultural Items: Northwest Museum of Arts & Culture, Spokane, WA

    Science.gov (United States)

    2010-09-24

    ...eastern Washington State. Furthermore, accession numbers, as well as field notes and journal entries, indicate that the cultural...cultural items were removed from sites that are within the aboriginal territory of the bands of Indians that now make up the...

  20. 78 FR 2428 - Notice of Intent To Repatriate Cultural Items: Northwest Museum of Arts & Culture, Spokane, WA

    Science.gov (United States)

    2013-01-11

    ...eastern Washington State. Furthermore, accession numbers, as well as field notes and journal entries, indicate that the cultural...cultural items were removed from sites that are within the aboriginal territory of the bands of Indians now known as the...

  1. Direct photons in WA98

    CERN Document Server

    Aggarwal, M M; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bock, R; Bohne, E M; Böröcz, Z K; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Ganti, M S; Garpman, S; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kees, S; Klein-Bösing, C; Knoche, S; Kolb, B W; Kosarev, I G; Kucheryaev, I; Krümpel, T; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mgebrishvili, G; Miake, Y; Mir, M F; Mishra, G C; Miyamoto, Y; Mohanty, B; Morrison, D; Mukhopadhyay, D S; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Pavlyuk, S; Peitzmann, Thomas; Petracek, V; Pinganaud, W; Plasil, F; Von Poblotzki, U; Purschke, M L; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Solomey, Nickolas; Sood, G; Sørensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Stüken, D; Sumbera, M; Svensson, S; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Yagi, K; Yokota, Y; Young, G R

    2002-01-01

    A measurement of direct photon production in /sup 208/Pb+/sup 208/Pb collisions at 158 A GeV has been carried out in the CERN WA98 experiment. The invariant yield of direct photons was extracted as a function of transverse momentum in the interval 0.51.5 GeV/c. the result constitutes the first observation of direct photons in ultrarelativistic heavy-ion collisions. (19 refs).

  2. Ecological indicators of water quality in the Spokane River, Idaho and Washington, 1998 and 1999

    Science.gov (United States)

    MacCoy, Dorene E.; Maret, Terry R.

    2003-01-01

    A water-quality investigation of the Spokane River was completed during summer low-flow conditions in 1998 and 1999 as part of the USGS NAWQA Program, in cooperation with the WDOE. (Abbreviations used in this report are defined on the last page.) Samples for analyses of water chemistry; bed sediment; aquatic communities (fish, macroinvertebrates, and algae); contaminants in tissue (fish and macroinvertebrates); and associated measures of habitat were collected at six sites downstream from Coeur d’Alene Lake between river miles 63 and 100. These data provided baseline information to evaluate the water-quality status of the Spokane River and can be used to determine the ecological risk to aquatic organisms from contaminants.

  3. The WA98 experiment; L`experience WA98

    Energy Technology Data Exchange (ETDEWEB)

    Bernier, T.; Gutbrod, H.H.; Jouault, B.; Nayak, S.; Luquin, L.; Pinganaud, W.; Sebille, F.; Roy, C.; Retiere, F. [Laboratoire de Physique Subatomique et des Technologies Associees - SUBATECH, Centre National de la Recherche Scientifique, 44 - Nantes (France); WA98 Collaboration

    1997-10-01

    The WA98 collaboration has as an objective the study of the hadron and photon production in Pb + Pb collisions. In these interactions in which hot hadronic matter is produced in a large volume, one can investigate a phase transition to the quark-gluon plasma. In order to identify anomalous events or class of events, a particular attention is given to the reaction characterization. The space phase evolution of the reaction volume is studied by the Bose-Einstein correlations of the charged hadrons while the thermal evolution of the system is determined by the direct photons. The WA98 experimental setup is a highly segmented photon-multiplicity detector placed at 21.5 m away from the target. The photon multiplicity is measured by a PMD detector while the negative particle tracking is realized by six avalanche chamber readout by CCD cameras. A second tracking branch made of two avalanche chambers and two streamer tube planes is associated to a time-of-flight measurement system. The two tracking branches determine the two-particle correlations. A silicon-drift and a silicon-pad detectors are designed for measurements of charged particle multiplicity within the 2.0-3.8 rapidity interval. The collision centrality is determined by means of the transverse energy measured by a calorimeter located at the mean rapidity and the spectator energy evaluated by a 0{sup o} calorimeter. The DST production is under way at Lyon Computer Center as well as the preparation of final analysis

  4. Exploration systems approach to the Spokane Mountain area uranium deposits, Northeastern Washington

    International Nuclear Information System (INIS)

    Within the gross context of economic exploration techniques developed through case studies of known mineralization, this report of research into the Spokane Mountain uranium deposit integrates the results of numerous field surveys and the application of proven scientific methods with the effects of all tasks weighed against those of similar activities and the costs of alternative methods. An exploration systems approach to the problem required a synthesis of information derived mainly from a small mining district in Stevens County, Washington. Data were obtained by utilizing sources of information available to the mineral industry and state-of-the-art uranim exploration techniques, including geological, geophysical, geochemical, and emanometric procedures. The Spokane Mountain mineralization exemplifies classical conditions of uranium deposits that form in the contact zone developed between metasediments and uraniferous intrusive rocks. Geological studies for this report include assessments of subsurface conditions; interpretations of detailed petrographic examinations that emphasize depositional environments, metamorphic effects, alteration, paragenesis, mineralogy, and origin; and overviews of regional stratigraphy, structure, metamorphism, plutonium, and metallogeny. Elements and minerals associated with uranium were detected along the contact zone, Midnite Trend, using geochemical techniques applied to both soils and stream surveys. The coincidence of molybdenum am surveys. The coincidence of molybdenum and uranium in the sediments and water of streams in the Spokane Mountain area indicates a nearby source of uranium. The abundance of multielements such as U, As, and F in the soils, checked at various densities and scales, are indicators of uranium mineralization; also, two targets with uranium potential apparently exist in areas peripheral to Spokane Mountain

  5. WA80 BGO calorimetry electronics

    International Nuclear Information System (INIS)

    This paper describes instrumentation designed for BGO scintillator-based calorimetry of particles covering a very wide range of energies (from less than 50 MeV to 50 GeV). The instrumentation was designed to have a measurement accuracy of 0.1% over as much of the energy range as possible so the energy resolution of BGO would be the limiting factor. Two 1.5-cm2 photodiodes were used per 2.5 cm x 2.5 cm x 25 cm BGO crystal. Both a charge-sensitive preamplifier and a pulse processor were developed specifically for the needs of the WA80 experiment. The preamplifier was designed for high detector capacitance (100 to 700 pF), low integral and differential non-linearity and low power consumption (200 mW). The pulse processor is a time-invariant shaping amplifier with integral peak-detect-and-hold and automatic gain selection circuits. The amplifier use quasi-triangular shaping with 4 ?s peaking time, and the hold circuit is gated with a fast first level trigger. The system has more than 20 bits of effective resolution when used with an external 12-bit ADC. Results from beam tests at CERN are presented. 6 refs., 5 figs., 1 tab

  6. Experiment WA1 (CDHS Neutrino Experiment)

    CERN Multimedia

    1977-01-01

    Experiment WA1, also known under CDHS (CERN, Dortmund, Heidelberg, Saclay; spokesman Jack Steinberger), was the first neutrino experiment on the SPS, in its West Area. Magnetized iron (with a toroidal field) forms the core of the detector. On its outside we see drift chambers and photomultipliers (detecting the light from the plastic scintillators further in). Peter Schilly is wearing a white coat. See also CERN Annual Report 1976, p.57.

  7. Recent results from the WA98 experiment

    Science.gov (United States)

    Peitzmann, T.; Aggarwal, M. M.; Agnihotri, A.; Ahammed, Z.; Angelis, A. L. S.; Antonenko, V.; Arefiev, V.; Astakhov, V.; Avdeitchikov, V.; Awes, T. C.; Baba, P. V. K. S.; Badyal, S. K.; Baldine, A.; Barabach, L.; Barlag, C.; Bathe, S.; Batiounia, B.; Bernier, T.; Bhalla, K. B.; Bhatia, V. S.; Blume, C.; Bohne, E.-M.; Bucher, D.; Buijs, A.; Büsching, H.; Carlen, L.; Chalyshev, V.; Chattopadhyay, S.; Cherbatchev, R.; Chujo, T.; Claussen, A.; Das, A. C.; Decowski, M. P.; Delagrange, H.; Djordjadze, V.; Donni, P.; Doubovik, I.; Dutt, S.; Dutta Majumdar, M. R.; El Chenawi, K.; Eliseev, S.; Enosawa, K.; Foka, P.; Fokin, S.; Frolov, V.; Ganti, M. S.; Garpman, S.; Gavrishchuk, O.; Geurts, F. J. M.; Ghosh, T. K.; Glasow, R.; Gupta, S. K.; Guskov, B.; Gustafsson, H. Å.; Gutbrod, H. H.; Higuchi, R.; Hrivnacova, I.; Ippolitov, M.; Kalechofsky, H.; Kamermans, R.; Kampert, K.-H.; Karadjev, K.; Karpio, K.; Kato, S.; Kim, H.; Kolb, B. W.; Kosarev, I.; Koutcheryaev, I.; Kugler, A.; Kulinich, P.; Kurata, M.; Kurita, K.; Kuzmin, N.; Langbein, I.; Lebedev, A.; Lee, Y. Y.; Löhner, H.; Luquin, L.; Mahapatra, D. P.; Manko, V.; Martin, M.; Martínez, G.; Maximov, A.; Mehdiyev, R.; Mgebrichvili, G.; Miake, Y.; Mikhalev, D.; Mir, Md. F.; Mishra, G. C.; Miyamoto, Y.; Mohanty, B.; Morrison, D.; Mukhopadhyay, D. S.; Myalkovski, V.; Naef, H.; Nandi, B. K.; Nayak, S. K.; Nayak, T. K.; Neumaier, S.; Nianine, A.; Nikitine, V.; Nikolaev, S.; Nilsson, P.; Nishimura, S.; Nomokonov, P.; Nystrand, J.; Obenshain, F. E.; Oskarsson, A.; Otterlund, I.; Pachr, M.; Parfenov, A.; Pavliouk, S.; Petracek, V.; Plasil, F.; Pinganaud, W.; Purschke, M. L.; Raeven, B.; Rak, J.; Raniwala, R.; Raniwala, S.; Ramamurthy, V. S.; Rao, N. K.; Retiere, F.; Reygers, K.; Roland, G.; Rosselet, L.; Roufanov, I.; Roy, C.; Rubio, J. M.; Sako, H.; Sambyal, S. S.; Santo, R.; Sato, S.; Schlagheck, H.; Schmidt, H.-R.; Schutz, Y.; Shabratova, G.; Shah, T. H.; Sibiriak, I.; Siemiarczuk, T.; Silvermyr, D.; Sinha, B. C.; Slavine, N.; Söderström, K.; Solomey, N.; Sørensen, S. P.; Stankus, P.; Stefanek, G.; Steinberg, P.; Stenlund, E.; Sumbera, M.; Svensson, T.; Trivedi, M. D.; Tsvetkov, A.; Tykarski, L.; Urbahn, J.; Pijll, E. C. v. d.; Eijndhoven, N. v.; Nieuwenhuizen, G. J. v.; Vinogradov, A.; Viyogi, Y. P.; Vodopianov, A.; Vörös, S.; Wys?ouch, B.; Yagi, K.; Yokota, Y.; Young, G. R.; WA98 Collaboration

    1999-12-01

    Recent results of the WA98 experiment with Pb induced reactions at 158. A GeV are presented. The scaling properties of the transverse energy and the charged particle multiplicity at midrapidity with the number of participants is studied. Neutral pion spectra are compared to hydrodynamical parameterizations. The analysis of collective flow at target rapidity and at midrapidity is presented. The status of the study of direct photons and the search for isospin fluctuations is discussed.

  8. Recent results from the WA98 experiment

    CERN Document Server

    Peitzmann, Thomas; Agnihotri, A; Ahammed, Z; Angelis, Aris L S; Antonenko, V G; Arefev, V; Astakhov, V A; Avdeichikov, V; Awes, T C; Baba, P V K S; Badyal, S K; Baldin, A; Barabash, L; Barlag, C; Bathe, S; Batyunya, B; Bernier, T; Bhalla, K B; Bhatia, V S; Blume, C; Bohne, E M; Bucher, D; Buijs, A; Büsching, H; Carlén, L; Chalyshev, V; Chattopadhyay, S; Cherbachev, R; Chujo, T; Claussen, A; Das, A C; Decowski, M P; Delagrange, H; Dzhordzhadze, V; Dönni, P; Dubovik, I; Dutt, S K; Dutta-Majumdar, M R; El-Chenawi, K F; Eliseev, S; Enosawa, K; Foka, P Y; Fokin, S L; Frolov, V; Ganti, M S; Garpman, S I A; Gavrishchuk, O P; Geurts, F J M; Ghosh, T K; Glasow, R; Sen-Gupta, S K; Guskov, B; Gustafsson, Hans Åke; Gutbrod, H H; Higuchi, R; Hrivnacova, I; Ippolitov, M S; Kalechofsky, H; Kamermans, R; Kampert, K H; Karadzhev, K; Karpio, K; Kato, S; Kim, H; Kolb, B W; Kosarev, I G; Kucheryaev, I; Kugler, A; Kulinich, P A; Kurata, M; Kurita, K; Kuzmin, N A; Langbein, I; Lebedev, A; Lee, Y Y; Löhner, H; Luquin, Lionel; Mahapatra, D P; Man'ko, V I; Martin, M; Martínez, G; Maksimov, A; Mehdiyev, R; Mgebrishvili, G; Miake, Y; Mikhalev, D; Mir, M F; Mishra, G C; Miyamoto, Y; Mohanty, B; Morrison, D; Mukhopadhyay, D S; Myalkovskii, V; Naef, H; Nandi, B K; Nayak, S K; Nayak, T K; Neumaier, S; Nyanin, A; Nikitin, V A; Nikolaev, S; Nilsson, P O; Nishimura, S; Nomokonov, V P; Nystrand, J; Obenshain, F E; Oskarsson, A; Otterlund, I; Pachr, M; Parfenov, A; Pavlyuk, S; Petracek, V; Plasil, F; Pinganaud, W; Purschke, M L; Räven, B; Rak, J; Raniwala, R; Raniwala, S; Ramamurthy, V S; Rao, N K; Retière, F; Reygers, K; Roland, G; Rosselet, L; Rufanov, I A; Roy, C; Rubio, J M; Sako, H; Sambyal, S S; Santo, R; Sato, S; Schlagheck, H; Schmidt, H R; Schutz, Y; Shabratova, G; Shah, T H; Sibiryak, Yu; Siemiarczuk, T; Silvermyr, D; Sinha, B C; Slavin, N V; Söderström, K; Solomey, Nickolas; Sørensen, S P; Stankus, P; Stefanek, G; Steinberg, P; Stenlund, E; Sumbera, M; Svensson, T; Trivedi, M D; Tsvetkov, A A; Tykarski, L; Urbahn, J; Van den Pijll, E C; van Eijndhoven, N; van Nieuwenhuizen, G J; Vinogradov, A; Viyogi, Y P; Vodopyanov, A S; Vörös, S; Wyslouch, B; Yagi, K; Yokota, Y; Young, G R

    1999-01-01

    Recent results of the WA98 experiment with Pb induced reactions at 158.A GeV are presented. The scaling properties of the transverse energy and the charged particle multiplicity at midrapidity with the number of participants is studied. Neutral pion spectra are compared to hydrodynamical parameterizations. The analysis of collective flow at target rapidity and at midrapidity is presented. The status of the study of direct photons and the search for isospin fluctuations is discussed. (30 refs).

  9. Radon and remedial action in Spokane River Valley residences: an interim report

    International Nuclear Information System (INIS)

    Fifty-six percent of 46 residences monitored in the Spokane River Valley in eastern Washington/northern Idaho have indoor radon concentrations above the National Council for Radiation Protection (NCRP) guidelines of 8 pCi/1. Indoor levels were over 20 pCi/1 in eight homes, and ranged up to 132 pCi/1 in one house. Radon concentrations declined by factors of 4 to 38 during summer months. Measurements of soil emanation rates, domestic water supply concentrations, and building material flux rates indicate that diffusion of radon does not significantly contribute to the high concentrations observed. Rather, radon entry is dominated by pressure-driven bulk soil gas transport, aggravated by the local subsurface soil composition and structure. A variety of radon control strategies are being evaluated in 14 of these homes. Sub-surface ventilation by depressurization and overpressurization, basement overpressurization, and crawlspace ventilation are capable of successfully reducing radon levels below 5 pCi/1 in these homes. House ventilation is appropriate in buildings with low-moderate concentrations, while sealing of cracks has been relatively ineffective

  10. Results from CERN experiment WA80

    International Nuclear Information System (INIS)

    As in the case of most of the experiments discussed at this conference, the primary goal of WA80 is a search for evidence that a quark-gluon plasma (QGP) has been formed, or that some similar phase transition has taken place. A number of signatures for QGP formation have been suggested, and most experiments have been designed so as to obtain data that pertain to one or more of these signatures. In the case of WA80, the primary probe for the investigation of the QGP is the measurement of photons that may be emitted from the plasma phase. An understanding of the various QGP signatures, however, requires an understanding of the background created by reaction products that do not relate directly to QGP production and thus requires a thorough understanding of the reaction mechanism governing nucleus-nucleus collisions at these extreme energies. Consequently, another important goal of WA80 is to survey nucleus-nucleus collisions at 60 and 200 GeV/nucleon and to compare the results to those obtained from proton-nucleus interactions. We have pursued this second goal by measuring forward and transverse energies, by studying the multiplicities of produced charged particles over a large range of pseudorapidity, by investigating transverse momentum spectra of neutral products, and by examining target fragmentation products. In this paper we review all of our results obtained with 60- and 200-GeV/nucleon /sup 16/O projectiles, with the exception of charged-particle multiplicity data, which are discussed in a separate presentation at this conference. We also present the first preliminary calorimeter results from /sup 32/S bombardments at 6.4 TeV. 22 refs., 13 figs., 2 tabs

  11. Some remarks on Kithaka wa Mberia's poetry

    OpenAIRE

    Zúbková-Bertoncini, Elena

    2012-01-01

    Kithaka wa Mberia (b.1956) is one of the most innovative Kenyan poets. Until now he has published four collections of poems and three plays. His poems contain a strong political and social criticism, sometimes in the form of animal allegories. He condemns various acts of violence done to women, like rapes of schoolgirls or prostitution caused by poverty. Some compositions seem life-stories of real persons, others are overtly didactic and moralizing, but in all the theme of social justice is a...

  12. The exploration and the U'wa

    International Nuclear Information System (INIS)

    The document analyzes the different actions taken to harmonize the oil development without impacting the customs of the indigenous communities; like it is the case of the community U'wa in Colombia, where conflicts were generated in the relationship that the oil companies, that which led during some years to the suspension of the activity and the postponement of exploratory projects until the achievement of an understanding that has looked for to harmonize the rights clearly based in the Colombian constitution, according to which the state has right to the property of the underground and its exploitation in benefit of the whole nation, and the indigenous towns that are entitled to the protection of its cultural, social and economic integrity

  13. AN EXAMINATION OF THE NUTRIENT AND HEAVY METALS BUDGET IN THE SPOKANE RIVER BETWEEN POST FALLS AND HANGMANS CREEK, IDAHO. 1979-1981

    Science.gov (United States)

    High concentrations of heavy metals and the nutrients nitrogen and phosphorus are major water quality problems in the Spokane River, Idaho (17010305) and its tributaries. Heavy metals are in quantity sufficiently high to exceed the 24-hour average criterion given by the USEPA (1...

  14. Raimo Pullat kohtus Lech Wa?esaga / Harda Roosna

    Index Scriptorium Estoniae

    Roosna, Harda, 1956-

    2014-01-01

    Tallinna Ülikooli emeriitprofessor Raimo Pullat kohtus Poola ekspresidendi Lech Wa?esaga Gdanski tehnikakõrgkooli 110. aastapäeva pidustustel, kuhu ta oli kutsutud kui peatselt valmiva teose "Värav tulevikku. Ganzigi Tehnikakõrgkool Eesti haritlaskonna kujunemisloos 1904-1939" autor

  15. Diet (Recolonization of the Cedar River, WA by Pacific salmon)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of this study is to quantify population, community, and ecosystem level changes as a result of salmon recolonization of the Cedar River, WA above...

  16. Isotopes (Recolonization of the Cedar River, WA by Pacific salmon)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of this study is to quantify population, community, and ecosystem level changes as a result of salmon recolonization of the Cedar River, WA above...

  17. The J3 SCR model applied to resonant converter simulation

    Science.gov (United States)

    Avant, R. L.; Lee, F. C. Y.

    1985-01-01

    The J3 SCR model is a continuous topology computer model for the SCR. Its circuit analog and parameter estimation procedure are uniformly applicable to popular computer-aided design and analysis programs such as SPICE2 and SCEPTRE. The circuit analog is based on the intrinsic three pn junction structure of the SCR. The parameter estimation procedure requires only manufacturer's specification sheet quantities as a data base.

  18. 75 FR 14463 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2010-03-25

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, Seattle, WA. The human remains...University of Washington, Department of Anthropology and Burke Museum staff in...

  19. 76 FR 73664 - Notice of Inventory Completion: Washington State University, Museum of Anthropology, Pullman, WA

    Science.gov (United States)

    2011-11-29

    ...Washington State University, Museum of Anthropology, Pullman, WA AGENCY: National Park...Washington State University, Museum of Anthropology (WSU) has completed an inventory...Washington State University, Museum of Anthropology, Pullman, WA 99164-4910,...

  20. 75 FR 14467 - Notice of Inventory Completion: Pierce College District, Lakewood, WA, and Thomas Burke Memorial...

    Science.gov (United States)

    2010-03-25

    ...College District, Lakewood, WA, and Thomas Burke Memorial Washington State Museum, University...WA, and in the physical custody of the Thomas Burke Memorial Washington State Museum (Burke Museum), University of Washington,...

  1. 76 FR 48177 - Notice of Inventory Completion: Washington State Department of Natural Resources, Olympia, WA...

    Science.gov (United States)

    2011-08-08

    ...Washington, Department of Anthropology, Seattle, WA AGENCY...Washington, Department of Anthropology have completed an inventory...determined that there is a cultural affiliation between...ADDRESSES: Maurice Major, Cultural Resource Specialist...Washington, Department of Anthropology, Seattle, WA....

  2. WA104 - NESSiE R&D Plan

    CERN Document Server

    Stanco, L

    2014-01-01

    The WA104-NESSiE Collaboration operating at the CERN Neutrino Facility aims at developing innovative solutions for the determination of the momentum and charge state of low energy muons. The ultimate goal is to provide high efficiency detectors and analysis tools for the study of neutrino interactions in the 1-10 GeV energy range.

  3. View of the WA10 set-up

    CERN Multimedia

    1977-01-01

    The WA10 experiment by the Geneva-Lausanne Collaboration was set-up in the H5 beam (unseparated, up to 50 GeV/c) to study K+-p --> K0pi+-p and other reactions of similar topology, and the energy dependence of resonance production.

  4. Korean WA-DGNSS User Segment Software Design

    OpenAIRE

    Sayed Chhattan Shah; Wan Sik Choi; Woo Yong Han; Yun, H.; Changdon Kee

    2013-01-01

    Korean WA-DGNSS is a large scale research project funded by Ministry of Land, Transport and Maritime Affairs Korea. It aims to augment the Global Navigation Satellite System by broadcasting additional signals from geostationary satellites and providing differential correction messages and integrity data for the GNSS satellites. The project is being carried out by a consortium of universities and research institutes. The research team at Electronics and Telecommunications Research Institute is...

  5. Korean WA-DGNSS User Segment Software Design

    Directory of Open Access Journals (Sweden)

    Sayed Chhattan Shah

    2013-03-01

    Full Text Available Korean WA-DGNSS is a large scale research project funded by Ministry of Land, Transport and Maritime Affairs Korea. It aims to augment the Global Navigation Satellite System by broadcasting additional signals from geostationary satellites and providing differential correction messages and integrity data for the GNSS satellites. The project is being carried out by a consortium of universities and research institutes. The research team at Electronics and Telecommunications Research Institute is involved in design and development of data processing softwares for wide area reference station and user segment. This paper focuses on user segment software design. Korean WA-DGNSS user segment software is designed to perform several functions such as calculation of pseudorange, ionosphere and troposphere delays, application of fast and slow correction messages, and data verification. It is based on a layered architecture that provides a model to develop flexible and reusable software and is divided into several independent, interchangeable and reusable components to reduce complexity and maintenance cost. The current version is designed to collect and process GPS and WA-DGNSS data however it is flexible to accommodate future GNSS systems such as GLONASS and Galileo.

  6. Infectivity and antigenicity reduction rates of human rotavirus strain Wa in fresh waters.

    OpenAIRE

    Pancorbo, O C; Evanshen, B G; Campbell, W F; Lambert, S.; Curtis, S K; Woolley, T W

    1987-01-01

    The rates of inactivation of human rotavirus type 2 (strain Wa) (HRV-Wa) and poliovirus type 1 (strain CHAT) were compared in polluted waters (creek water and secondary effluent before chlorination) and nonpolluted waters (lake water, groundwater, and chlorinated tap water). Viral infectivity titers were determined by plaque assays, while HRV-Wa antigenicity also was monitored by an enzyme-linked immunosorbent assay. Both viruses persisted longest in lake water and shortest in tap water. The ...

  7. Draft Genome Sequence of a Xylanase-Producing Bacterial Strain, Cellvibrio mixtus J3-8

    OpenAIRE

    Wu, Yi-rui; Lin, Bokun; Yu, Yuli

    2014-01-01

    The xylanase-producing bacterial strain Cellvibrio mixtus J3-8 was isolated from grassland giant snails. The draft genome of strain J3-8 comprises 5,171,890 bp in 152 contigs with a G+C content of 46.66%. This is the first genome report about this bacterial species.

  8. W.A. SAXS facility at Curtin university

    International Nuclear Information System (INIS)

    Full text: This talk will describe some of the research that has been conducted during the past 12 months at the W.A SAXS Facility at Curtin University. This research includes SAXS studies of mesoporous materials, iron oxyhdroxide in mammalian tissue, calcium oxalates, ferritin and apoferritin samples, exfoliated layered double hydroxides, non-exfoliated gibbsite, kaolins, iron oxide powders, magnesium powders, inorganic polymers, various concentrations of magnetite with different polymer coatings in fluids and cross linked polymer systems. This talk will concentrate on the results of SAXS from iron oxyhydroxide particles in rat livers and spleens, and the details of modelling the particle size distributions

  9. Flexible Software Design for Korean WA-DGNSS Reference Station

    Directory of Open Access Journals (Sweden)

    Wan Sik Choi

    2013-03-01

    Full Text Available In this paper, we describe the software design results of WA-DGNSS reference station that will be constructed in Korea in the near future. Software design of the WRS (Wide area Reference Station is carried out by applying object oriented software methodology in order to provide flexibilities: easy of model change (namely ionospheric delay model etc and system addition (Galileo, GLONASS in addition to GPS etc. Software design results include the use case diagrams for the functions to be executed, the architecture diagram showing components and their relationships, the activity diagrams of behaviors and models among them, and class diagrams describing the attribute and operation.

  10. Yeast Interacting Proteins Database: YDR261W-A, YDR261W-A [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR261W-A - Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-T ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this b ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this p ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this b ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this p ...

  11. 78 FR 50099 - Notice of Inventory Completion: Washington State Parks and Recreation Commission, Olympia, WA

    Science.gov (United States)

    2013-08-16

    ...and were transferred from a storage facility in Seattle, WA...and were transferred from a storage facility in Seattle, WA...remains were discovered in a storage building located adjacent to...as well as shared linguistic heritage, overlapping trade...

  12. STATE/EPA WATER QUALITY-LIMITED WATERBODIES (CWA SECT 303(D)) FOR WA, ID, OR

    Science.gov (United States)

    Major Attributes: Causes of impairment, & extent of waterbodies listed Water Quality Limited/TMDL designations (303(d)). Easily incorporated into maps at the region, county, & basin level. Scale: 1:100,000, via the digital stream reach files. Extent: WA, ID, OR. Source: WA...

  13. 33 CFR 165.1302 - Bangor Naval Submarine Base, Bangor, WA.

    Science.gov (United States)

    2010-07-01

    ...2010-07-01 false Bangor Naval Submarine Base, Bangor, WA. 165.1302 Section...District § 165.1302 Bangor Naval Submarine Base, Bangor, WA. (a) Location...Vessels that are performing work at Naval Submarine Base Bangor pursuant to a...

  14. Contemporary "Hoisan-wa" Language Maintenance in Northern California: Evidence from Fourteen Frog Story Narratives

    Science.gov (United States)

    Leung, Genevieve

    2012-01-01

    This article explores uninvestigated issues in Cantonese and "Hoisan-wa" language maintenance from an ethnic Chinese diaspora point of view. Data come from a larger study looking at Frog Story narratives from 140 Cantonese-English bilingual children in California. Fourteen of these children were found to display uniquely "Hoisan-wa" phonology and…

  15. 'National Consciousness' in Ngugi Wa Thiango's “A Grain of Wheat”

    Directory of Open Access Journals (Sweden)

    Mr.Pankaj Ganpat Kolhe

    2012-04-01

    Full Text Available The basic objective of this paper is to focus on the rise of nationalist writing is one way of furthering this revolution in African writers like Chinua Achebe, Ayi-Kwei- Armah, Frantz Fanon, Sylvia Plath, etc. Postcolonial literature is a branch of postmodern literature concerned with the political and cultural independence of peoples formerly subjugated in colonial empires. Indian literature in English which is accessible to us in the west stills its roots in colonial literature and the tensions between East and West. A European naturalism is often present a concern to posit Africa as an arena within which Western readers can identify realities, is inherent within much oh this writing. First part of this paper consists a brief note on nationalism and other aspects of post-colonial theory, key terms and philosophers. In the second part, I made an attempt to explain the concept of national consciousness in Ngugi Wa Thiango's “A Grain of Wheat”

  16. FSXLIB-J3: MCNP continuous energy cross section library based on JENDL-3

    International Nuclear Information System (INIS)

    The general purpose evaluated nuclear data file, JENDL-3, which was newly evaluated at Japan was released to apply the fusion reactor area and so on. The MCNP continuous energy cross section library, FSXLIB-J3, has been prepared from JENDL-3 for the fusion neutronics application. The FSXLIB-J3 library was produced by the nuclear data processing system, NJOY, and the library compiling and confirming code for the MCNP library, MACROS. The confidence of this library was established by the comparison and comfirmation between original JENDL-3 and the cross section data in library. This report describes the format of MCNP cross section library, the production procedure of FSXLIB-J3, the usage of the MACROS code and the confirmation of FSXLIB-J3. (author)

  17. WaVPeak: Picking NMR peaks through wavelet-based smoothing and volume-based filtering

    KAUST Repository

    Liu, Zhi

    2012-02-10

    Motivation: Nuclear magnetic resonance (NMR) has been widely used as a powerful tool to determine the 3D structures of proteins in vivo. However, the post-spectra processing stage of NMR structure determination usually involves a tremendous amount of time and expert knowledge, which includes peak picking, chemical shift assignment and structure calculation steps. Detecting accurate peaks from the NMR spectra is a prerequisite for all following steps, and thus remains a key problem in automatic NMR structure determination. Results: We introduce WaVPeak, a fully automatic peak detection method. WaVPeak first smoothes the given NMR spectrum by wavelets. The peaks are then identified as the local maxima. The false positive peaks are filtered out efficiently by considering the volume of the peaks. WaVPeak has two major advantages over the state-of-the-art peak-picking methods. First, through wavelet-based smoothing, WaVPeak does not eliminate any data point in the spectra. Therefore, WaVPeak is able to detect weak peaks that are embedded in the noise level. NMR spectroscopists need the most help isolating these weak peaks. Second, WaVPeak estimates the volume of the peaks to filter the false positives. This is more reliable than intensity-based filters that are widely used in existing methods. We evaluate the performance of WaVPeak on the benchmark set proposed by PICKY (Alipanahi et al., 2009), one of the most accurate methods in the literature. The dataset comprises 32 2D and 3D spectra from eight different proteins. Experimental results demonstrate that WaVPeak achieves an average of 96%, 91%, 88%, 76% and 85% recall on 15N-HSQC, HNCO, HNCA, HNCACB and CBCA(CO)NH, respectively. When the same number of peaks are considered, WaVPeak significantly outperforms PICKY. The Author(s) 2012. Published by Oxford University Press.

  18. Pra Na Wa Ka: The Development of Training Course for Continuing Buddhism

    Directory of Open Access Journals (Sweden)

    Phra M.P. Romphothanthong

    2012-01-01

    Full Text Available Problem statement: Buddhism is a religion that requires meditation, practice, intellectual precepts of the threefold-training such as morality, concentration and wisdom. The purpose of practicing Buddhism is the goal of deliverance through attaining knowledge and wisdom. The Pra Na Wa Ka are newly ordained monks and needed to study both of the scriptures and the practice for appreciating understanding in morality, concentration and wisdom. A training model and guidelines are needed to improve the quality and efficiency of Pra Na Wa Ka because currently most of the monks who are the teachers lacked knowledge and are not ready to act as the Pra Na Wa Ka teacher, because lack of the teaching media, lack of the proper knowledge of the teacher vocational, the lesson plan arrangement, the psychology of teaching, lack of technique variety of teaching methods. Most of the temple had no education administration of the Pra Na Wa Ka who ordained in short-term, within 3 days 7 days 15 days or to one month, lack of the short period course to study about Buddhism, the Pra Na Wa Ka cannot accurately recite the Pali words, the Pra Na Wa Ka who were ordained were not motivated and faithful in learning and low morality. Approach: This research intended to study the history of the education administration of the Pra Na Wa Ka (Newly ordained monk and to study about the problems and need of the Pra Na Wa Ka in knowledge about Buddhism and to develop the curriculum and the training package of the Pra Na Wa Ka in Buddhism. Results: The Pra Na Wa Ka traing course is a curriculum to study Buddhism through 3 training courses; (1 Basic Course: 3 days for initiation 7 days, (2 Intermediate course 7 days for initiation 15 days and (3 Long period course 15 days for initiation more than 30 days. The training courses were accompanied by a training kit to understand the main precepts of morality, concentration and wisdom. The curriculum was successful in providing Pra Na Wa Ka with knowledge and learning tools in order to understand the teachings from senior monks and Buddhist teachers. Conclusion: The effectiveness of the developed training course and success of the examination results of the Pra Na Wa Ka will ensure that Buddhism will continue to be propagated to society in its purest form and will benefit the community and society as a whole, bringing peace and prosperity.

  19. The Use of Wa’Dan in Islamic Contract FX Forward: Weighting between Maslahah and Mafsadah

    OpenAIRE

    Azlin Alisa Ahmad; Salmy Edawati Yaacob; Mat Noor Mat Zain

    2014-01-01

    Islamic foreign exchange forward contract widely use the principle of wa’d in order to fulfil the need of hedging. The contract is an alternative solution to conventional forward contract, whereby one party will promise to the other party to exchange currency at an agreed rate for a future date. The adaptation of wa’d (unilateral promise) or wa’dan (two unilateral promise) is seen as an exit mechanism or makharij to the impermissible conventional derivatives contract. Some opined that i...

  20. Calendario reproductivo en mujeres indígenas u'wa (tunebo) de Boyacá, Colombia / Reproductive schedule (timing) of u'wa (tunebo) indian women of Boyacá, Colombia

    Scientific Electronic Library Online (English)

    María Mercedes, Arias-Valencia.

    2013-03-01

    Full Text Available El objetivo de este estudio es presentar los resultados de un proyecto de investigación realizado en comunidades u'wa (tunebo), en Boyacá, Colombia. Específicamente se buscó caracterizar aspectos de la fecundidad de las mujeres u'wa en lo concerniente al calendario reproductivo (timing), cuáles son [...] las edades de la menarquía de entrada a la unión conyugal, de la primera gestación, del primer parto, así como los intervalos intergenésicos y la lactancia. La metodología incluyó el levantamiento de 115 historias reproductivas y de nacimientos, obtenidas a través de visitas en los domicilios en aldeas representativas de los pueblos indígenas u'wa, en 2003, 2004, 2005 y 2006; 50 días en campo en total. Los datos censales fueron dispuestos por el Hospital del municipio de Cubará que atiende a los u'wa. En cuanto a los resultados, las edades medias fueron, de la menarquía 13 años, de la entrada en la primera unión y del nacimiento del primer hijo, respectivamente, 16.4 e 18.1 años. Las mujeres u'wa presentan un intervalo intergenésico medio de 20.6 meses, la media de amamantación fue 24.3 meses, 78.1 por ciento de las mujeres amamantaron a los hijos de 12 a 35 meses, lo cual favorece la salud de los niños. El nivel de escolaridad es bajo en las mujeres, la mayoría no tiene estudio. Se caracterizó el calendario reproductivo y se comparó con resultados de otros estudios en pueblos indígenas. Los resultados se discuten a la luz de los determinantes próximos de la fecundidad y de la etnología u'wa. Abstract in english The purpose of this study is to present the result of a research project performed in u'wa (Tunebo) communities in Boyaca, Colombia. Specifically, we tried to characterize some fertility aspects of u'wa women relating to their reproductive schedule (timing), their menarche ages, their conjugal ages, [...] their first pregnancy ages, their first birth ages, as well as the interval between pregnancies and breastfeeding times. The methodology included the survey of 115 reproductive and birth histories obtained through domiciliary visits of small u'wa villages in 2003, 2004, 2005 and 2006 (50 days of field work total). The census was provided by Cubara's Municipal Hospital, which attends U'wa people. In connection with the results, the measured ages were: menarche, 13 years old, first union or conjugal union and first child birth, 16.4 and 18.1 respectively. The average time between pregnancies was 20,6 months, and the average for breastfeeding was 24.3 months; 78.1 per cent of u'wa women breastfeeding from 12 to 35 months, which benefits children's health. The education level in women is low; most of them did not attend school. The reproductive schedule (timing) was characterized and compared to other studies of indian communities. The results are discussed in light of the fertility next determinants and U'wa ethnology indicators.

  1. 76 FR 41286 - Conboy Lake and Toppenish National Wildlife Refuges, WA; Comprehensive Conservation Plan and...

    Science.gov (United States)

    2011-07-13

    ...Toppenish National Wildlife Refuges, WA; Comprehensive Conservation Plan and Environmental...principles of fish and wildlife management, conservation, legal mandates...possible approach to wildlife, plant, and habitat conservation, while...

  2. 78 FR 11673 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-02-19

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  3. 78 FR 19298 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-03-29

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  4. 78 FR 5200 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-01-24

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  5. 77 FR 51563 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2012-08-24

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  6. 78 FR 5201 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-01-24

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  7. 78 FR 19297 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-03-29

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  8. 78 FR 5198 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-01-24

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  9. 78 FR 25471 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-05-01

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. Disposition of the human...

  10. 78 FR 22286 - Notice of Inventory Completion: University of Washington, Department of Anthropology, Seattle, WA

    Science.gov (United States)

    2013-04-15

    ...University of Washington, Department of Anthropology, Seattle, WA AGENCY: National Park...University of Washington, Department of Anthropology, has completed an inventory of human...University of Washington, Department of Anthropology. If no additional requestors...

  11. Growth, movement and survival (Recolonization of the Cedar River, WA by Pacific salmon)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of this study is to quantify population, community, and ecosystem level changes as a result of salmon recolonization of the Cedar River, WA above...

  12. Fish abundance, composition, distribution (Recolonization of the Cedar River, WA by Pacific salmon)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of this study is to quantify population, community, and ecosystem level changes as a result of salmon recolonization of the Cedar River, WA above...

  13. Experimental streams (Recolonization of the Cedar River, WA by Pacific salmon)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of this study is to quantify population, community, and ecosystem level changes as a result of salmon recolonization of the Cedar River, WA above...

  14. Characterization of Rhodococcus wratislaviensis strain J3 that degrades 4-nitrocatechol and other nitroaromatic compounds.

    Science.gov (United States)

    Navrátilová, Jitka; Tvrzová, Ludmila; Durnová, Eva; Spröer, Cathrin; Sedlácek, Ivo; Neca, Jirí; Nemec, Miroslav

    2005-02-01

    The bacterial strain J3 was isolated from soil by selective enrichment on mineral medium containing 4-nitrocatechol as the sole carbon and energy source. This strain was identified as Rhodococcus wratislaviensis on the basis of morphology, biochemical, physiological and chemotaxonomic characterization and complete sequencing of the 16S rDNA gene. The isolated bacterium could utilize 4-nitrocatechol, 3-nitrophenol and 5-nitroguaiacol as sole carbon and energy sources. Stoichiometric release of nitrites was measured during degradation of 4-nitrocatechol both in growing cultures and for stationary phase cells. The J3 strain was unable to degrade 4-nitroguaiacol, 2-nitrophenol, 4-nitrophenol, 2,4-dinitrobenzoic acid, 4,5-dimethoxy-2-nitrobenzoic acid and 2,3-difluoro-6-nitrophenol. The J3 strain is deposited in the Czech Collection of Microorganisms as CCM 4930. PMID:15723176

  15. Detection of (C-13)O J = 3-2 in IC 342 - Warm, clumpy molecular gas

    International Nuclear Information System (INIS)

    The detection of the (C-13)O J = 3-2 line is reported, and a 15-arcsec-resolution, seven-point map of the (C-12)O J = 3-2 line in IC 342 is presented. The (C-13)O line strength, when compared to the lower-J line strengths at similar spatial resolution, suggests that the (C-13)O lines are optically thick in the inner 200 pc of IC 342. The physical conditions in the molecular gas in the inner region of IC 342 are similar to the conditions in the inner 200 pc of the Galaxy. 38 refs

  16. A study of Ca 4p1/2,3/2nd (J = 3) autoionizing states

    International Nuclear Information System (INIS)

    The spectral properties of Ca 4pnd (J = 3) autoionizing states have been studied by employing the combination of multichannel quantum defect theory (MQDT) with the K-matrix method. The cross section of 4p3/215d excited from 4s15d and energy levels of 4pnd (J = 3) are calculated by using a theoretical model with more complete channels, and the configuration interaction is analysed in detail between 4p1/2nd, 4p3/2nd3/2,5/2 and 4p1/2,3/2ng of five Rydberg series

  17. North Cascades, WA: The Collapse of a Continental Magmatic Arc

    Science.gov (United States)

    McLean, N. M.; Bowring, S. A.; Miller, R.; Whitney, D.; Gordon, S.

    2006-12-01

    The North Cascades metamorphic core represents an exhumed Cretaceous to Paleogene continental magmatic arc at the southern terminus of the Coast Plutonic Complex. The core is predominantly accreted oceanic and arc terranes variably metamorphosed at amphibolite to granulite facies and intruded by 96 to 45 Ma arc-related plutons. The region underwent Late Cretaceous contraction and crustal thickening, dextral transpression from 73 to 55 Ma, and finally transtension after 55 Ma. Geochronology, thermochronology, and detailed structural mapping reveal the Skagit Gneiss core of the North Cascades resembles a metamorphic core complex. Rapid rates of exhumation, abundant indicators of ductile lower crustal movement, bounding faults with oblique-normal slip histories, and roughly coeval adjacent basins are comparable to classic core complexes. The domal structure of the Skagit Gneiss, as well as its migmatite core and the high-grade meta- sediments it includes, also highlight its similarity to gneiss domes. East of the North Cascades, a belt of core complexes and gneiss domes including the Shuswap Complex, Southern BC, and the Okanogan-Kettle Complex, eastern WA, has received extensive study, but until now the Cascades themselves have not been considered as such. New U-Pb zircon dates from orthogneiss sheets and the youngest deformed arc plutons suggest protracted residence and ductile strain in the middle crust until ca 50 Ma, followed by rapid tectonic denudation and the subsidence of two proximal, in part contemporaneous continental basins. In order to accurately characterize the Skagit Gneiss complex, three E-W transects were chosen to represent the full spectrum of lithologies and chronologies. We are characterizing the nature and timing of strain and juxtaposition with higher structural levels in each. Precise dates of abundant air fall tuffs in the basins will constrain the time of basin initiation and subsidence rates, as well as calibrate the rich fossil record of continental flora and fauna. Collectively, these data will be integrated to develop and test tectonic models of arc magmatism and extensional collapse.

  18. On the Super Field Realization of Super Casimir Wa(n)-Algebras

    OpenAIRE

    Ozer, H. T.

    2001-01-01

    We give an explicit quantum super field construction of the N=2 super Casimir WA(n)-algebras, which is obtained from supersymmetric Miura transformation for the Lie superalgebra A(n,n-1). And also we give an extension of this algebra including a super vertex operator which depends on simple root system of A(n,n-1).

  19. CONTROL: the run control program used on the WA62 VAX data acquisition system at CERN

    International Nuclear Information System (INIS)

    The criteria are described which have been used in the design of CONTROL, a program in the WA62 VAX Native mode data acquisition system which serves the triple purpose of driving a status display, an operator's console and a message reporter. (U.K.)

  20. The Utility of the Lambert Function W[a exp(a - bt)] in Chemical Kinetics

    Science.gov (United States)

    Williams, Brian Wesley

    2010-01-01

    The mathematical Lambert function W[a exp(a - bt)] is used to find integrated rate laws for several examples, including simple enzyme and Lindemann-Christiansen-Hinshelwood (LCH) unimolecular decay kinetics. The results derived here for the well-known LCH mechanism as well as for a dimer-monomer reaction mechanism appear to be novel. A nonlinear…

  1. Qi-Wa, a problem that has plagued Chinese scrolls for millenniums

    CERN Document Server

    Chou, Ming-Han; Wang, Yi-Ping; Hong, Sun-Hsin; Hong, Tzay-Ming

    2013-01-01

    Qi-Wa refers to the up curl on the lengths of handscrolls and hanging scrolls, which has troubled Chinese artisans and emperors for as long as the art of painting and calligraphy exists. This warp is unwelcomed not only for aesthetic reasons, but its potential damage to the fiber and ink. Although it is generally treated as a part of the cockling and curling due to climate, mounting procedures, and conservation conditions, we emphasize that the intrinsic curvature incurred from the storage is in fact the main cause of Qi-Wa. The Qi-Wa height is determined by experiments to obey scaling relations with the length, width, curvature, and thickness of the scroll, which are supported by Molecular Dynamics Simulation and theoretic derivations. This understanding helps us come up with plausible remedies to mitigate Qi-Wa. All proposals are tested on real mounted paper and in simulations. Due to the general nature of this warp, we believe the lessons learnt from studying ancient Chinese scrolls can be applied to moder...

  2. Kitaev-Heisenberg-J2-J3 model for the iridates A2IrO3

    OpenAIRE

    Kimchi, Itamar; You, Yi-Zhuang

    2011-01-01

    A Kitaev-Heisenberg-J2-J3 model is proposed to describe the Mott-insulating layered iridates A2IrO3 (A=Na,Li). The model is a combination of the Kitaev honeycomb model and the Heisenberg model with all three nearest neighbor couplings J1, J2 and J3. A rich phase diagram is obtained at the classical level, including the experimentally suggested zigzag ordered phase; as well as the stripy phase, which extends from the Kitaev-Heisenberg limit to the J1-J2-J3 one. Combining the ...

  3. Water Accounting Plus (WA+ – a water accounting procedure for complex river basins based on satellite measurements

    Directory of Open Access Journals (Sweden)

    D. Molden

    2012-11-01

    Full Text Available Coping with the issue of water scarcity and growing competition for water among different sectors requires proper water management strategies and decision processes. A pre-requisite is a clear understanding of the basin hydrological processes, manageable and unmanageable water flows, the interaction with land use and opportunities to mitigate the negative effects and increase the benefits of water depletion on society. Currently, water professionals do not have a common framework that links hydrological flows to user groups of water and their benefits. The absence of a standard hydrological and water management summary is causing confusion and wrong decisions. The non-availability of water flow data is one of the underpinning reasons for not having operational water accounting systems for river basins in place. In this paper we introduce Water Accounting Plus (WA+, which is a new framework designed to provide explicit spatial information on water depletion and net withdrawal processes in complex river basins. The influence of land use on the water cycle is described explicitly by defining land use groups with common characteristics. Analogous to financial accounting, WA+ presents four sheets including (i a resource base sheet, (ii a consumption sheet, (iii a productivity sheet, and (iv a withdrawal sheet. Every sheet encompasses a set of indicators that summarize the overall water resources situation. The impact of external (e.g. climate change and internal influences (e.g. infrastructure building can be estimated by studying the changes in these WA+ indicators. Satellite measurements can be used for 3 out of the 4 sheets, but is not a precondition for implementing WA+ framework. Data from hydrological models and water allocation models can also be used as inputs to WA+.

  4. Water Accounting Plus (WA+) - a water accounting procedure for complex river basins based on satellite measurements

    Science.gov (United States)

    Karimi, P.; Bastiaanssen, W. G. M.; Molden, D.

    2012-11-01

    Coping with the issue of water scarcity and growing competition for water among different sectors requires proper water management strategies and decision processes. A pre-requisite is a clear understanding of the basin hydrological processes, manageable and unmanageable water flows, the interaction with land use and opportunities to mitigate the negative effects and increase the benefits of water depletion on society. Currently, water professionals do not have a common framework that links hydrological flows to user groups of water and their benefits. The absence of a standard hydrological and water management summary is causing confusion and wrong decisions. The non-availability of water flow data is one of the underpinning reasons for not having operational water accounting systems for river basins in place. In this paper we introduce Water Accounting Plus (WA+), which is a new framework designed to provide explicit spatial information on water depletion and net withdrawal processes in complex river basins. The influence of land use on the water cycle is described explicitly by defining land use groups with common characteristics. Analogous to financial accounting, WA+ presents four sheets including (i) a resource base sheet, (ii) a consumption sheet, (iii) a productivity sheet, and (iv) a withdrawal sheet. Every sheet encompasses a set of indicators that summarize the overall water resources situation. The impact of external (e.g. climate change) and internal influences (e.g. infrastructure building) can be estimated by studying the changes in these WA+ indicators. Satellite measurements can be used for 3 out of the 4 sheets, but is not a precondition for implementing WA+ framework. Data from hydrological models and water allocation models can also be used as inputs to WA+.

  5. The Use of Wa’Dan in Islamic Contract FX Forward: Weighting between Maslahah and Mafsadah

    Directory of Open Access Journals (Sweden)

    Azlin Alisa Ahmad

    2014-10-01

    Full Text Available Islamic foreign exchange forward contract widely use the principle of wa’d in order to fulfil the need of hedging. The contract is an alternative solution to conventional forward contract, whereby one party will promise to the other party to exchange currency at an agreed rate for a future date. The adaptation of wa’d (unilateral promise or wa’dan (two unilateral promise is seen as an exit mechanism or makharij to the impermissible conventional derivatives contract. Some opined that it is merely mimicking conventional products and labelling them as 'Islamic' in form alone. As a subsequence, it gives the same effect as conventional derivative contract and would create some economic problems. Hence, the objective of this paper is to examine the Islamic foreign exchange forward contract based on wa’dan in shariah perspectives, whether it will attain maslahah or mafsadah to the people. This study took the form of a qualitative study using the approach of content analysis method as a research design. Documents analysed in this study are al-Quran and some related maxims of jurisprudence. This study found that Islamic foreign exchange forward contract give some maslahah to the parties involved, including investors, financial institutions, corporate sectors, and Islamic economy at large. This is due to the urgent need of the Islamic economy to the Islamic hedging to solve the problem of price volatility in the market. Nevertheless, the adaptation of wa’dan principle in the Islamic foreign exchange forward contract would also lead to mafsadah as it would threaten the economy if the contract is misused for merely speculation purposes.

  6. Water Accounting Plus (WA+ – a water accounting procedure for complex river basins based on satellite measurements

    Directory of Open Access Journals (Sweden)

    P. Karimi

    2013-07-01

    Full Text Available Coping with water scarcity and growing competition for water among different sectors requires proper water management strategies and decision processes. A pre-requisite is a clear understanding of the basin hydrological processes, manageable and unmanageable water flows, the interaction with land use and opportunities to mitigate the negative effects and increase the benefits of water depletion on society. Currently, water professionals do not have a common framework that links depletion to user groups of water and their benefits. The absence of a standard hydrological and water management summary is causing confusion and wrong decisions. The non-availability of water flow data is one of the underpinning reasons for not having operational water accounting systems for river basins in place. In this paper, we introduce Water Accounting Plus (WA+, which is a new framework designed to provide explicit spatial information on water depletion and net withdrawal processes in complex river basins. The influence of land use and landscape evapotranspiration on the water cycle is described explicitly by defining land use groups with common characteristics. WA+ presents four sheets including (i a resource base sheet, (ii an evapotranspiration sheet, (iii a productivity sheet, and (iv a withdrawal sheet. Every sheet encompasses a set of indicators that summarise the overall water resources situation. The impact of external (e.g., climate change and internal influences (e.g., infrastructure building can be estimated by studying the changes in these WA+ indicators. Satellite measurements can be used to acquire a vast amount of required data but is not a precondition for implementing WA+ framework. Data from hydrological models and water allocation models can also be used as inputs to WA+.

  7. CH3CN J = 8 - 7 and CS J = 3 - 2 emission in orion KL

    Science.gov (United States)

    Zeng, Q.; Pei, C. C.

    1995-07-01

    The data of the line series CH3CN 8(K) - 7(K) K = 0 - 7 and line CS J = 3 - 2 were taken simultaneously. At beam size of 16? the emissions of CH3CN and CS have a common center position located near IRc2 with deviations ?? ˜ -8? and ?? ˜ 5?. The observed data show that in Orion KL core the integrated intensities of the two species have double peaks separated by a space of 14?. The 2-dimension Gaussian fitting plots (FWHM) are ellipses ofD maj = 26? andD min = 22? for CH3CN 8(K) - 7(K) K = 3 - 6 andD'maj = 39? D'min = 31? for CS J = 3 - 2 at a distance about 450 pc. Towards the multiple line emission region of CH3CN 8(K) - 7(K) K = 3 - 6, using a simplified very large velocity gradient model to solve the statistical equilibrium and radiative transfer equations, we find to fit the observed results, the optimum physical parameters and kinetic temperatureT k˜ 120 K, densityn(H a) ˜ 1.2 × 105 cm-3, velocity gradientV gr˜ 92 km s-1 pc-1 and the local abundance of CH3CNF ab˜ 3 × 10-8. However towards the region of single line emission of CS J = 3 - 2 we have to use LTE and the optical thin approximation on the assumption ofT k= 120 K to obtain the lower limits of column density and then, an averaged abundance of CS of 6 × 10-8.

  8. The t-pebbling number of Jahangir graph J3,m

    Scientific Electronic Library Online (English)

    A., Lourdusamy; T., Mathivanan.

    2015-06-01

    Full Text Available The t-pebbling number, f t(G), of a connected graph G, is the smallest positive integer such that from every placement of f t(G) pebbles, t pebbles can be moved to any specified target vertex by a sequence of pebbling moves, each move removes two pebbles of a vertex and placing one on an adjacent ve [...] rtex. In this paper, we determine the t-pebbling number for Jahangir graph J3,m and finally we give a conjecture for the t-pebbling number of the graph Jn,m.

  9. HCO+ and HCN J=3-2 absorption toward the center of Centaurus A

    OpenAIRE

    Muller, Sebastien; Dinh-V-Trung,

    2009-01-01

    We have investigated the presence of dense gas toward the radio source Cen A by looking at the absorption of the HCO+ and HCN (3-2) lines in front of the bright continuum source with the Submillimeter Array. We detect narrow HCO+ (3-2) absorption, and tentatively HCN (3-2), close to the systemic velocity. For both molecules, the J=3-2 absorption is much weaker than for the J=1-0 line. From simple excitation analysis, we conclude that the gas density is on the order of a few ...

  10. The Discourse Marker wa in Standard Arabic—A Syntactic and Semantic Analysis

    Directory of Open Access Journals (Sweden)

    Abdulkhaliq Alazzawie

    2014-10-01

    Full Text Available Discourse markers are items (such as and, so, anyway, but, on the other hand, however that link spans of discourse and signal various semantic and pragmatic relations.  Thus, they play an important role in the cohesiveness, organization and interpretation of discourse.   Arabic has a number of devices which play a pivotal role in the cohesion and coherence of written and spoken discourse such as wa, aw, lakin, am, fa, thuma, bal, la, etc.  The present paper is limited in scope. It is an attempt to establish the constituency and identify the functions of the Arabic discourse connective device wa using resources of syntax, semantics and pragmatics.  Such resources include descriptive and analytical diagnostic tools of constituency tests, structural ambiguity and semantic roles.

  11. Wa Wa We Wa! / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2006-01-01

    Briti koomik Sacha Baron Cohen ja tema loodud peategelasega film "Borat - kultuurialased õppetunnid Ameerikast abiks suursuguse Kasahstani riigi ülesehitamisel", režissöör Larry Charles : Ameerika Ühendriigid 2006. Lisaks "Seigad Coheni elust"

  12. 77 FR 74634 - Okanogan-Wenatchee National Forest, Okanogan County, WA Bannon, Aeneas, Revis, and Tunk Grazing...

    Science.gov (United States)

    2012-12-17

    ...Forest, Okanogan County, WA Bannon, Aeneas, Revis, and Tunk Grazing Allotments Environmental Impact Statement; Correction AGENCY...27, 2012, concerning requests for comments on the proposed grazing allotments and dates of document availability. The...

  13. 77 FR 70137 - Okanogan-Wenatchee National Forest, Okanogan County, WA; Bannon, Aeneas, Revis, and Tunk Grazing...

    Science.gov (United States)

    2012-11-23

    ...WA; Bannon, Aeneas, Revis, and Tunk Grazing Allotments Environmental Impact Statement...the environmental effects of issuing Term Grazing Permits to continue authorizing cattle grazing on all or portions of four existing...

  14. WA-circumflex(n - 1 modul n - 1)(1) Miura transformation: Analysis and applications

    International Nuclear Information System (INIS)

    We introduce the concept of conformal spin gradation of the untwisted affine Lie superalgebra A-circumflex(n -1 modul n - 1)(1) to study the WA-circumflex(n - 1 modul n - 1)(1) Miura transformation. We show that the essential of A-circumflex(n - 1 modul n - 1)(1) may be read from the conformal spin gradation of the canonical vector basis of the SL(n modul n) vector representation space V2n and a spectral parameter ?. We give the generic formula of their conformal spin weights. Then, we set up the fundamentals of a manifestly N = 2 U(1) Lax formalism leading to a manifestly N = 2 WA-circumflex(n - 1 modul n - 1)(1) Miura transformation. Its explicit form is obtained and is shown to have a similar structure as in the N = 0 case. Both N = 0 WA-circumflex(n - 1)(1) and N = 2 WA-circumflex(n - 1 modul n - 1)(1) Miura transformations involve (n - 1) N = 0 and N = 2 conserved currents with integer conformal spins. The leading cases are discussed. Using the U(1) charge of the N = 2 algebra, we develop also a new method of constructing N = 2 superfield realizations of the N = 2 higher spin supercurrents. Among other results, we find that in general there are three series of (n - 1) higher conformal spin N = 2 supercurrents. The usual N = 2 super W currents are the only hermitian ones. At the n = 3 level, we find a new Feigin Fuchs type extension of the conformal spin one N = 2 supercurrent. Such a feature, which has no analogue at the n = 2 level, is also present for n>3. Finally, we give the N = 2 superfield formulation of the N = 2 Boussinesq equation and its generalization involving complex N = 2 supercurrents. (author). 27 refs

  15. Prospective prediction of viral suppression and immune response nine months after ART initiation in Seattle, WA

    OpenAIRE

    Simoni, Jane M.; Yard, Samantha S.; Huh, David

    2012-01-01

    Knowing at antiretroviral therapy (ART) initiation which patients might be at greatest risk for failure to achieve viral suppression would enable providers to target patients most in need and tailor their care appropriately. This study involved multilevel modeling of data from a randomized controlled trial among outpatients in Seattle, WA, USA. The 224 participants initiating or switching ART at baseline were 24% female, 34% heterosexual, and 47% Caucasian. Of 24 baseline demographic and psyc...

  16. In-vitro ANTIOXIDANT ACTIVITY OF Zanthoxylum tetraspermum W.A. STEM BARK

    OpenAIRE

    K. Narayanasamy; Ragavan, B.

    2012-01-01

    Zanthoxylum tetraspermum W.A. (Rutaceae) is a medicinal plant traditionally used by the tribals.The present investigation deals with antioxidant activity of stem bark extract and was evaluated in a series of In-vitro assays involving free radicals and reactive oxygen species (ROS).The hydroethanolic plant extract exhibited itsscavenging effect in concentration dependent manner on superoxide anion radicals, hydroxyl radicals, hydrogen peroxide and DPPH radical scavenging activity. The results ...

  17. Relativistic ab initio calculations of the P-odd interaction constant W_A in diatomic molecules

    CERN Document Server

    Borschevsky, A; Dzuba, V A; Beloy, K; Flambaum, V V; Schwerdtfeger, P

    2012-01-01

    We present ab initio calculations of the W_A parameter of the P-odd spin-rotational Hamiltonian for a variety of diatomic molecules, including group-2 and -12 halides. The results were obtained by the relativistic Dirac-Hartree-Fock approach and corrected for electron correlation. Strong enhancement of the W_A parameter is found for the group-12 diatomic halides, which will be helpful in future determination of the nuclear anapole moment from rotational hyperfine measurements.

  18. Characterization of a xylanase-producing Cellvibrio mixtus strain J3-8 and its genome analysis.

    Science.gov (United States)

    Wu, Yi-Rui; He, Jianzhong

    2015-01-01

    Cellvibrio mixtus strain J3-8 is a gram-negative, xylanase-producing aerobic soil bacterium isolated from giant snails in Singapore. It is able to produce up to 10.1?U?ml(-1) of xylanase, which is comparable to xylanase production from known bacterial and fungal strains. Genome sequence analysis of strain J3-8 reveals that the assembled draft genome contains 5,171,890?bp with a G?+?C content of 46.66%, while open reading frame (ORF) annotations indicate a high density of genes encoding glycoside hydrolase (GH) families involved in (hemi)cellulose hydrolysis. On the basis of 15 identified putative xylanolytic genes, one metabolic pathway in strain J3-8 is constructed for utilization of xylan. In addition, a 1,083?bp xylanase gene from strain J3-8 represents a new member of GH11 family. This gene is verified to be novel via phylogenetic analysis. To utilize this novel gene for hydrolysis of xylan to xylose, it is expressed in recombinant E. coli and characterized for its hydrolytic activity. This study shows that strain J3-8 is a potential candidate for hydrolysis of lignocellulosic materials. PMID:25994900

  19. Spiral correlations in frustrated one-dimensional spin-1/2 Heisenberg J1-J2-J3 ferromagnets

    International Nuclear Information System (INIS)

    We use the coupled cluster method for infinite chains complemented by exact diagonalization of finite periodic chains to discuss the influence of a third-neighbor exchange J3 on the ground state of the spin- 1/2 Heisenberg chain with ferromagnetic nearest-neighbor interaction J1 and frustrating antiferromagnetic next-nearest-neighbor interaction J2. A third-neighbor exchange J3 might be relevant to describe the magnetic properties of the quasi-one-dimensional edge-shared cuprates, such as LiVCuO4 or LiCu2O2. In particular, we calculate the critical point J2c as a function of J3, where the ferromagnetic ground state gives way for a ground state with incommensurate spiral correlations. For antiferromagnetic J3 the ferro-spiral transition is always continuous and the critical values J2c of the classical and the quantum model coincide. On the other hand, for ferromagnetic J3?1| the critical value J2c of the quantum model is smaller than that of the classical model. Moreover, the transition becomes discontinuous, i.e. the model exhibits a quantum tricritical point. We also calculate the height of the jump of the spiral pitch angle at the discontinuous ferro-spiral transition.

  20. CO J = 3 ? 2 and J = 2 ? 1 observations of the Kleinmann-Low nebula

    International Nuclear Information System (INIS)

    An area of sky centred on the Kleinmann-Low nebula has been mapped in the J = 3 ? 2 and J = 2 ? 1 lines of CO. There appears evidence for asymmetry of the 'pedestal' emission to the west of the source centre, probably indicative of an irregular mass distribution. This is discussed in the context of two models of the high-velocity gas, namely high-velocity nonisotropic outflow, and rotation within a compact cloud. Although the present observations do not enable us to discriminate between these, the presence of optically thin CO emission in this source is shown to lead to severe structural constraints on any rotational model. The suggestion that such a model may also lead to an over-abundance of high-velocity stars is not verified by the present analyses. (author)

  1. Phase diagram of the anisotropic frustrated spin-one J1-J2-J3 ferromagnet

    Science.gov (United States)

    Pires, A. S. T.

    2015-05-01

    I study the spin one J1-J2-J3 Heisenberg model with easy plane single- ion anisotropy on the square lattice with ferromagnetic 1st neighbor and antiferromagnetic 2nd and 3rd neighbor interactions by means of the SU(3) Schwinger boson formalism. I show that quantum fluctuations lead to a strong modification of the classical phase diagram. A nematic phase was found at T=0. Although the system behaves like an XY model, in the nematic phase the single ion anisotropy term leads to strong quantum fluctuations and induces a net nematic component. As a consequence the quadrupole structure factor has a strong peak at the wave vector q =(0,0).

  2. Hot gas in the nucleus of M82 - (C-12)O and (C-13)O J = 3-2 observations

    International Nuclear Information System (INIS)

    Observations of the J = 3-2 transitions of (C-12)O and (C-13)O in the starburst galaxy M82 are reported. The (C-12)O J = 3-2 transition in the nuclear region is detected and mapped at 22-arcsec resolution. The high main beam brightness temperature of the line, 6.4 K, when compared to the J = 1-0 and J = 2-1 intensities, requires a hot moderately optically thin gas. There are about 10 to the 8th solar masses of warm molecular gas within a radius of 360 pc of M82. The low optical depths and high densities required to excite the J = 3-2 transition may imply sheetlike or filamentary clumping. 31 refs

  3. Mechanism of Al-Wa’Ad (Promise: Teory and Application in Islamic Banking in Malaysia

    Directory of Open Access Journals (Sweden)

    Nor Adila bt. Mohd Noor

    2010-03-01

    Full Text Available Contract according to Syariah Law can be defined as being “an expression of the matching between a positive proposal made by one of the contractors and the acceptance of the other contractor in a way which has an impact on the subject of the contract” . There are standard requirements provides by the law in order to constitute a valid binding contract namely offer, acceptance, consideration, and intention to create legal relation. This requirement is more or less the same with the Islamic ‘aqad’ however it comes together with the package the prohibition of any element of uncertainty, interest, etc to make sure it complies with the syariah standard. Most of the conventional contract has ignored few aspects of the Islamic contract such as non-spot in the exchange of ribawi item, unjustified increase of premium, and conditional aqad which are totally prohibited. Therefore Islamic Banking in Malaysia has put strong effort to curb these problems and provides a way out by introducing many syariah compliance products and concepts and one of them is al- wa’ad which is the main concern on this article. As a result, by doing this research, it can help people to discover how far the concept of al-wa’ad had been applied in Islamic Banking in Malaysia by comparing its application among few banks including Islamic Bank as well as conventional banks with Islamic Banking window.
    Key words: Al-Wa’ad (promise; Islamic Banking; Teory and application; Islamic transaction

    Résumé: Contrat selon la syariah peut être définie comme étant «une expression de l'adéquation entre une proposition positive faite par l'un des contractants et l'acceptation de l'autre contractant d'une manière qui a une incidence sur l'objet du contrat». Il ya des exigences standard fournit par la loi afin de constituer un contrat valable à savoir offre, l'acceptation, la considération, et l'intention de créer des relations juridiques. Cette exigence est plus ou moins la même chose avec l'Organisation islamique pour «AQAD 'quoi qu'il arrive avec le paquet de l'interdiction de tout élément d'incertitude, intérêts, etc pour s'assurer qu'elle est conforme à la norme de la charia. La plupart du contrat conventionnel a ignoré quelques aspects du contrat islamique comme la non-lieu dans l'échange de point ribawi, l'augmentation injustifiée de la prime, et AQAD conditionnel, qui sont totalement interdites. Par conséquent, les banques islamiques en Malaisie a mis effort sérieux pour mettre fin à ces problèmes et fournit un moyen de sortir par l'introduction de nombreux produits de la charia et le respect des concepts et l'un d'eux est Al-Wa'ad qui est la principale préoccupation de cet article. En conséquence, en effectuant cette recherche, il peut aider les gens à découvrir dans quelle mesure la notion d'al-Wa'ad avait été appliquée dans les banques islamiques en Malaisie, en comparant son application entre quelques banques dont la Banque islamique ainsi que les banques classiques.
    Mots-Clés: AL-Wa'ad (promesse; baques islamiques, théorie et applications, transaction islamique

  4. Linkage disequilibrium analysis of D12S391 and vWA in U.S. population and paternity samples.

    Science.gov (United States)

    O'Connor, Kristen Lewis; Hill, Carolyn R; Vallone, Peter M; Butler, John M

    2011-11-01

    Recently, the European Network of Forensic Science Institutes voted to adopt five additional STR loci (D12S391, D1S1656, D2S441, D10S1248, and D22S1045) to their existing European Standard Set of seven STRs (TH01, vWA, FGA, D8S1179, D18S51, D21S11, and D3S1358). The D12S391 and vWA loci are located 6.3megabases (Mb) apart on chromosome 12. Ideally for use in forensic analyses, genetic markers on the same chromosome should be more than 50Mb in physical distance in order to ensure full recombination and thus independent inheritance. The purpose of this study was to evaluate if the closely located D12S391 and vWA loci are independent and, consequently, if these loci can be included in the product rule calculation for forensic and kinship analyses. Departures from Hardy-Weinberg equilibrium and linkage disequilibrium between the D12S391 and vWA loci were tested using n=654 unrelated U.S. African American, Caucasian, and Hispanic samples, and n=764 father/son paternity samples. In the unrelated U.S. population samples, no significant departures from HWE were detected for D12S391 or vWA. No significant evidence of linkage disequilibrium was observed between the loci in the population samples. However, significant linkage disequilibrium was detected in U.S. African American, Caucasian, and Asian father/son samples with phased genotypes. No significant linkage disequilibrium was detected for U.S. Hispanic paternity samples. The use of phased father/son pairs allowed for robust detection of linkage disequilibrium between D12S391 and vWA. In unrelated population samples, linkage disequilibrium is present but more difficult to detect due to the large number of possible haplotype combinations and unknown allelic phase. For casework analyses that involve unrelated or related individuals, the single-locus genotype probabilities for D12S391 and vWA should not be multiplied to determine the match probability of an autosomal STR profile. Since the D12S391 and vWA loci are not independent, it is recommended that the observed combination of alleles at D12S391 and vWA should be treated as a non-independent diplotype for profile probability calculations. The observed haplotype frequencies for U.S. African American, Caucasian, Hispanic, and Asian populations are provided for match probability calculations. PMID:21067983

  5. Gigabit Access Passive Optical Network Using Wavelength Division Multiplexing-GigaWaM

    OpenAIRE

    Iglesias Olmedo, Miguel; Suhr, Lau; Prince, Kamau; Rodes, Roberto; Mikkelsen, Christian; Hviid, Erling; Neumeyr, Christian; Vollrath, Gunther; Goobar, Edgard; Ohlen, Peter; Monroy, Idelfonso Tafur

    2014-01-01

    This paper summarizes the research and technical achievements done under the EU project GigaWaM. The goal of this project was to develop a cost-effective solution that can meet the increasing bandwidth demands in access networks. The approach was to use a novel wavelength division multiplexing passive optical network (WDM-PON) architecture that can deliver symmetric 1 Gb/s to 64 users over 20 km standard single mode fiber using the L and C bands for down and upstream, respectively. During the...

  6. Classification of dark energy models in the (w_0,w_a) plane

    OpenAIRE

    Barger, V.; Guarnaccia, E.; Marfatia, D

    2005-01-01

    We classify dark energy models in a plane of observables that correspond to the common parameterization of a non-constant equation of state, w(a)=w_0 + w_a(1-a), where $a$ is the scale factor of the universe. The models fall into four classes and only two of these classes have a region of overlap in the observable plane. We perform a joint analysis of all Type Ia supernova (SNIa) data compiled by the High-Z SN Search Team (HZT) and the Supernova Legacy Survey (SNLS) and find...

  7. In-vitro ANTIOXIDANT ACTIVITY OF Zanthoxylum tetraspermum W.A. STEM BARK

    Directory of Open Access Journals (Sweden)

    K. NARAYANASAMY

    2012-01-01

    Full Text Available Zanthoxylum tetraspermum W.A. (Rutaceae is a medicinal plant traditionally used by the tribals.The present investigation deals with antioxidant activity of stem bark extract and was evaluated in a series of In-vitro assays involving free radicals and reactive oxygen species (ROS.The hydroethanolic plant extract exhibited itsscavenging effect in concentration dependent manner on superoxide anion radicals, hydroxyl radicals, hydrogen peroxide and DPPH radical scavenging activity. The results clearly indicate that the stem bark extract of Z.tetraspermum can be a potential source of natural antioxidant.

  8. Development of the fast reactor group constant set JFS-3-J3.2R based on the JENDL-3.2

    CERN Document Server

    Chiba, G

    2002-01-01

    It is reported that the fast reactor group constant set JFS-3-J3.2 based on the newest evaluated nuclear data library JENDL3.2 has a serious error in the process of applying the weighting function. As the error affects greatly nuclear characteristics, and a corrected version of the reactor constant set, JFS-3-J3.2R, was developed, as well as lumped FP cross sections. The use of JFS-3-J3.2R improves the results of analyses especially on sample Doppler reactivity and reaction rate in the blanket region in comparison with those obtained using the JFS-3-J3.2.

  9. An altered v-raf is required in addition to v-myc in J3V1 virus for acceleration of murine plasmacytomagenesis.

    OpenAIRE

    Troppmair, J.; Potter, M.; Wax, J. S.; Rapp, U. R.

    1989-01-01

    We have isolated and molecularly cloned a highly pathogenic virus variant, J3V1, from murine plasmacytomas induced by a combination of pristane and the weakly transforming recombinant retrovirus J3. J3 virus is a derivative of the v-raf/v-myc-carrying J2 virus that was generated by a frameshifting deletion inactivating v-raf in J2. J3V1 contains an additional deletion of 334 base paris in gag, which restores the correct reading frame for v-raf and results in the expression of a p57 gag-raf fu...

  10. Wide field CO J = 3¿2 mapping of the Serpens Cloud Core

    DEFF Research Database (Denmark)

    Dionatos, Odyssefs; Nisini, Brunella

    2010-01-01

    Context. Outflows provide indirect means to get an insight on diverse star formation associated phenomena. On scales of individual protostellar cores, outflows combined with intrinsic core properties can be used to study the mass accretion/ejection process of heavily embedded protostellar sources. Aims. The main objective of the paper is to study the overall outflow distribution and association with the young population of the Serpens Core cluster. In addition, the paper addresses the correlation of the outflow momentum flux with the bolometric luminosity of their driving sources using this homogeneous dataset for a single star forming site. Methods. An area comprising 460''×230'' of the Serpens cloud core has been mapped in 12CO J = 3¿2 with the HARP-B heterodyne array at the James Clerk Maxwell Telescope; J = 3¿2 observations are more sensitive tracers of hot outflow gas than lower J CO transitions; combined with the high sensitivity of the HARP-B receptors outflows are sharply outlined, enabling their association with individual protostellar cores. Results. Most of ~20 observed outflows are found to be associated with known protostellar sources in bipolar or unipolar config- urations. All but two outflow/core pairs in our sample tend to have a projected orientation spanning roughly NW-SE. The overall momentum driven by outflows in Serpens lies between 3.2 and 5.1 × 10-1 M¿km s-1, the kinetic energy from 4.3 to 6.7 × 1043 erg and momentum flux is between 2.8 and 4.4 × 10-4 M¿ km s-1 yr-1. Bolometric luminosities of protostellar cores based on Spitzer photometry are found up to an order of magnitude lower than previous estimations derived with IRAS/ISO data. Conclusions. We confirm the validity of the existing correlations between the momentum flux and bolometric luminosity of Class I sources for the homogenous sample of Serpens, though we suggest that they should be revised by a shift to lower luminosities. All protostars classified as Class 0 sources stand well above the known Class I correlations, indicating a decline in momentum flux between the two classes.

  11. Development of creep strain equations for ka-SUS410J3 (Grade 122)

    International Nuclear Information System (INIS)

    Evaluation of the failure under creep deformation is essential in design and life management of high-temperature components constituting power generation plants. Deformation model as well as life evaluation rule plays an important role in such a evaluation and their accuracy needs to be qualified. In order to estimate variation of stress distribution with time due to creep deformation, creep strain equations are required to be used and their accuracy is important for the reliability of the assessment of creep damage. Creep strain equations for ka-SUS410J3 (ASME Grade 122) steel which is widely used in ultra-super critical thermal power plants were developed in this study. Expressions for the primary and the tertiary creep deformations were developed as well as those for the secondary creep deformation with special attentions to the difference between short-term and long-term behavior as well as dependency of the starting point of the tertiary creep phase on temperature and rupture time. (author)

  12. Health promotion in cervical cancer prevention among the Yakama Indian women of the Wa'Shat Longhouse.

    Science.gov (United States)

    Strickland, C J; Squeoch, M D; Chrisman, N J

    1999-07-01

    The purpose of this 3-year study was to gain a greater understanding of the importance of the Wa'Shat Longhouse religion to the design of a culturally appropriate health promotion (cervical cancer prevention) program with the Yakama Indian people of eastern Washington. This descriptive study involved interviews with 10 Wa'Shat members, observations, and participant observations of 30 community ceremonial activities. The framework of health promotion planning guided the investigation. We found that (a) program goals needed to be holistic and wellness oriented, (b) teaching methods needed to include circular symbols, and (c) intervention strategies needed to be linked to the natural patterns of communication of the Wa'Shat Longhouse and to involve elders. Storytelling, talking circles, and use of role models were all found to be important teaching methods. We confirm previous perspectives on the importance of religion, provide greater depth in this understanding and outline implications for transcultural nursing practice. PMID:10693405

  13. Wa re o Bona e Hlotša, wa e Nametša Thaba! Bibele, Basadi ba Maafrika ba Afrika-Borwa le HIV le AIDS

    Directory of Open Access Journals (Sweden)

    Madipoane Masenya(ngwan’a Mphahlele

    2010-03-01

    Full Text Available The question of the history of the reception of the Christian Bible in South Africa particularly by African- South Africans has not been a smooth ride. It was part of a bigger package that included among others, the importation of European patriarchy onto African soil, the land grabbing exercise which resulted in among others, the impoverishment of African peoples and, the emasculation of the African man. The latter in turn led to the intensification of patriarchy within the average African family. The preceding situation, was not helpful to the context and/or situation of African women who were already then, at the bottom of the patriarchal ladder, because, as can be expected, within the context of the Black church and theology then, little if any except for a handful of liberation theologians and members of some ecumenical bodies, was done to make the theology propagated then, relevant to pertinent issues which affected the lives of Black people.Given the historical marginalisation of women in the Bible and Theology, not only in South Africa, but also globally, it becomes obvious that even in our context, mainstream theology and biblical hermeneutics left issues pertaining to gender justice basically untouched. It is no wonder, as we will argue in this paper, that given that already vulnerable situation into which African women have been thrown into by the preceding factors as well as by how the Bible continues to be used in our HIV and AIDS contexts, their situation may be succinctly captured as that of a limping animal that has been made to climb the mountain! The Northern Sotho proverb or saying: Wa re o bona e hlotša, wa e nametša thaba (while limping, you let it climb the mountain simply means that a certain situation is being aggravated (by an external factor. The present article will use the preceding proverb as a hermeneutical lens through which to analyse the reception of the Bible by African women in the HIV and AIDS context of South Africa.

  14. Wa re o Bona e Hlotša, wa e Nametša Thaba! Bibele, Basadi ba MaAfrika ba Afrika-Borwa le HIV le AIDS

    Scientific Electronic Library Online (English)

    Madipoane, Masenya.

    Full Text Available The question of the history of the reception of the Christian Bible in South Africa particularly by African- South Africans has not been a smooth ride. It was part of a bigger package that included among others, the importation of European patriarchy onto African soil, the land grabbing exercise whi [...] ch resulted in among others, the impoverishment of African peoples and, the emasculation of the African man. The latter in turn led to the intensification of patriarchy within the average African family. The preceding situation, was not helpful to the context and/or situation of African women who were already then, at the bottom of the patriarchal ladder, because, as can be expected, within the context of the Black church and theology then, little if any except for a handful of liberation theologians and members of some ecumenical bodies, was done to make the theology propagated then, relevant to pertinent issues which affected the lives of Black people. Given the historical marginalisation of women in the Bible and Theology, not only in South Africa, but also globally, it becomes obvious that even in our context, mainstream theology and biblical hermeneutics left issues pertaining to gender justice basically untouched. It is no wonder, as we will argue in this paper, that given that already vulnerable situation into which African women have been thrown into by the preceding factors as well as by how the Bible continues to be used in our HIV and AIDS contexts, their situation may be succinctly captured as that of a limping animal that has been made to climb the mountain! The Northern Sotho proverb or saying: Wa re o bona e hlotša, wa e nametša thaba (while limping, you let it climb the mountain) simply means that a certain situation is being aggravated (by an external factor). The present article will use the preceding proverb as a hermeneutical lens through which to analyse the reception of the Bible by African women in the HIV and AIDS context of South Africa.

  15. Contribution to the experimental study of charmed hadrons produced with hyperon beams (WA89 experiment)

    International Nuclear Information System (INIS)

    Since 1989 the author has been involved in the CERN WA89 experiment that is dedicated to the production of charmed hadrons with hyperon beams. The features and the experimental setting of WA89 are presented in the first chapter. The second chapter is dedicated to the on-line and off-line identification of ?0 particles produced in charmed particles decay. The former is made through an adequate trigger and the latter is an event filter based on a fast identification criterion of a likely decay of ?0. The identification of ?0 has required the development of algorithms to test the validity of the track reconstruction in the decay area between the target and the spectrometer and to check the validity of the identification of the decay vertex of ?0. The last chapter is dedicated to data analysis. The identification of DS mesons in K+K-? final state is detailed. An accurate determination of the DS production cross-section is not yet possible because of the low statistics but it was possible to make a preliminary assessment that has given: ? = (1.5 ± 0.7) ?b/nucleon with xF > 0. (A.C.)

  16. Flow analysis with WaSiM-ETH – model parameter sensitivity at different scales

    Directory of Open Access Journals (Sweden)

    J. Cullmann

    2006-01-01

    Full Text Available WaSiM-ETH (Gurtz et al., 2001, a widely used water balance simulation model, is tested for its suitability to serve for flow analysis in the context of rainfall runoff modelling and flood forecasting. In this paper, special focus is on the resolution of the process domain in space as well as in time. We try to couple model runs with different calculation time steps in order to reduce the effort arising from calculating the whole flow hydrograph at the hourly time step. We aim at modelling on the daily time step for water balance purposes, switching to the hourly time step whenever high-resolution information is necessary (flood forecasting. WaSiM-ETH is used at different grid resolutions, thus we try to become clear about being able to transfer the model in spatial resolution. We further use two different approaches for the overland flow time calculation within the sub-basins of the test watershed to gain insights about the process dynamics portrayed by the model. Our findings indicate that the model is very sensitive to time and space resolution and cannot be transferred across scales without recalibration.

  17. Strong decays of ?cJ(2P) and ?cJ(3P)

    International Nuclear Information System (INIS)

    In the framework of the chiral quark model, the mass spectrum of ?cJ(J = 0, 1, 2, n = 1, 2, 3) is studied with the Gaussian expansion method. Using the wave functions obtained in the study of mass spectrum, the open charm two-body strong decay widths of these states are calculated by using the 3P0 model. The results show that the masses of ?cJ(1P) and ?c2(2P) are consistent with the experimental data. But the strong decay width of ?c2(2P) is three times that of the experimental value. The decay width of ?c1(2P) is sensitive to its mass. In the quark-antiquark picture, the width is about 385 MeV. However, if the channel coupling effects shift its mass to 3872 MeV, its decay width will be around 1 MeV. The possibility of assigning the state X(3872) as ?c1(2P) cannot be excluded. To assign X(3915) as ?c0(2P) is disfavored, due to the unmatching of decay channel. For the ?cJ(3P) states, no states have been assigned. The possible candidates of ?c0(3P) are X(4160) and X(4140). Their masses are close to the theoretical ones. The experimental branching ratio of X(4160), ? (X(4160) ? D anti D)/? (X(4160) ? D* anti D*) c0(3P), 0.07. However the broad decay width of X(4160) cannot be explained by the open charm two-body decay. To assign X(4140) as ?c0(3P) is also possible, due to the compatibility of the total decay width, the further measurement of decay modes of X(4140) are expected to justify the assignment. (orig.)

  18. FSXLIB-J3R2 : A continuous energy cross section library for MCNP based on JENDL-3.2

    International Nuclear Information System (INIS)

    The continuous energy cross section library for the Monte Carlo transport code MCNP, FSXLIB-J3R2, has been generated from the latest version of Japanese Evaluated Nuclear Data Library Version 3 Revision 2 (JENDL-3.2) released in June, 1994. The nuclear data processing system, NJOY, and the compilation and verification code for MCNP libraries, MACROS, have been employed to produce the library after necessary modifications. Validity of the generated library has been confirmed by comparing it with JENDL-3.2. The FSXLIB-J3R2 library contains all the 340 nuclides stored in JENDL-3.2, and it is expected that the library will widely contribute to the field of nuclear energy. (author)

  19. JNES's Activities in the Extra-budgetary Programme of the International Seismic Safety Centre: WA1 Seismic Hazard

    International Nuclear Information System (INIS)

    Issues in design basis ground motion development, the study items of Work Area 1 of IAEA/ISSC/EBP, and JNES's contributions were explained. It was also noted that the discussions and resolutions of this WS would be summarized in a technical document as task 1.4 of WA1. (author)

  20. Measurements of Turbulence at Two Tidal Energy Sites in Puget Sound, WA

    Energy Technology Data Exchange (ETDEWEB)

    Thomson, Jim; Polagye, Brian; Durgesh, Vibhav; Richmond, Marshall C.

    2012-06-05

    Field measurements of turbulence are pre- sented from two sites in Puget Sound, WA (USA) that are proposed for electrical power generation using tidal current turbines. Rapidly sampled data from multiple acoustic Doppler instruments are analyzed to obtain statistical mea- sures of fluctuations in both the magnitude and direction of the tidal currents. The resulting turbulence intensities (i.e., the turbulent velocity fluctuations normalized by the harmonic tidal currents) are typically 10% at the hub- heights (i.e., the relevant depth bin) of the proposed turbines. Length and time scales of the turbulence are also analyzed. Large-scale, anisotropic eddies dominate the energy spectra, which may be the result of proximity to headlands at each site. At small scales, an isotropic turbulent cascade is observed and used to estimate the dissipation rate of turbulent kinetic energy. Data quality and sampling parameters are discussed, with an emphasis on the removal of Doppler noise from turbulence statistics.

  1. Therapeutic potential of capillary morphogenesis gene 2 extracellular vWA domain in tumour?related angiogenesis.

    Science.gov (United States)

    Ye, Lin; Sun, Ping-Hui; Sanders, Andrew J; Martin, Tracey A; Lane, Jane; Mason, Malcolm D; Jiang, Wen G

    2014-10-01

    Capillary morphogenesis gene 2 (CMG2) is a receptor of anthrax toxin and plays an important role in angiogenesis. It has been shown to be involved in the cell adhesion and motility of various cell types, including epithelia and endothelia. The present study aimed to examine the therapeutic potential of targeting CMG2 to prevent tumour?related new vasculature. The full-length coding sequence of the human CMG2 gene and different fragments of the CMG2 vWA domain were amplified and constructed into a mammalian expression plasmid vector. The effect of CMG2 and its vWA domain on endothelial cells and angiogenesis was assessed using relevant in vitro, ex vivo and in vivo models. The overexpression of CMG2 enhanced the adhesion of endothelial cells to extracellular matrix, but was negatively associated with cell migration. Overexpression of CMG2 and the vWA domain fragments inhibited the tubule formation and migration of endothelial cells. Small peptides based on the amino acid sequence of the CMG2 vWA domain fragments potently inhibited in vitro tubule formation and ex vivo angiogenesis. One of the polypeptides, LG20, showed an inhibitory effect on in vivo tumour growth of cancer cells which were co-inoculated with the vascular endothelial cells. CMG2 is a potential target for treating tumour?related angiogenesis. The polypeptides based on the CMG2 vWA domain can potently inhibit in vitro and ex vivo angiogenesis, which may contribute to the inhibitory effect on in vivo tumour growth. Further investigations are required to shed light on the machinery and may provide a novel therapeutic approach for inhibition of angiogenesis in cancer management. PMID:24993339

  2. Inactivation of Adenovirus Type 5, Rotavirus WA and Male Specific Coliphage (MS2 in Biosolids by Lime Stabilization

    Directory of Open Access Journals (Sweden)

    Aaron B. Margolin

    2007-03-01

    Full Text Available The use of lime to reduce or eliminate pathogen content is a cost-effective treatment currently employed in many Class B biosolids production plants in the United States. A bench scale model of lime stabilization was designed to evaluate the survival of adenovirus type 5, rotavirus Wa, and the male specific bacteriophage, MS2, in various matrices. Each virus was initially evaluated independently in a reverse osmosis treated water matrix limed with an aqueous solution of calcium hydroxide for 24-hr at 22 ± 5°C. In all R/O water trials, adenovirus type 5, rotavirus Wa and MS2 were below detectable levels (<100.5 TCID50/mL and <1 PFU/mL respectively following 0.1-hr of liming. Adenovirus type 5, rotavirus Wa, and MS2, were inoculated into composted, raw and previously limed matrices, representative of sludge and biosolids, to achieve a final concentration of approximately 104 PFU or TCID50/mL. Each matrix was limed for 24-hr at 22 ± 5°C and 4 ± 2°C. In all trials virus was below detectable levels following a 24-hr incubation. The time required for viral inactivation varied depending on the temperature and sample matrix. This research demonstrates reduction of adenovirus type 5, rotavirus Wa, and male-specific bacteriophage, in water, sludge and biosolids matrices following addition of an 8% calcium hydroxide slurry to achieve a pH of 12 for 2-hr reduced to 11.5 for 22-hr by addition of 0.1 N HCl. In these trials, MS2 was a conservative indicator of the efficacy of lime stabilization of adenovirus Type 5 and rotavirus Wa and therefore is proposed as a useful indicator organism.

  3. Calibration of agriculture WA gamma cell using TLD and GAF chromic film

    International Nuclear Information System (INIS)

    Full text: A project at the WA department of agriculture (Agriculture WA) involved irradiating male fruit fly pupae with a Co-60 gamma cell. The aim was to render the fruit fly infertile for the purposes of population control. Since the dose needed to be large enough to sterilise the pupae but not so great as to deliver a lethal dose, accurate knowledge of the dose rate was extremely important. The Medical Physics Department at Royal Perth Hospital was asked to calibrate the unit. Thermoluminescence dosimetry (TLD) was used for the initial dose measurement. LiF:Mg,Ti (TLD-700. Harshaw) rods were loaded into plastic tubes and placed at varying depths inside the jig used to hold the pupae during irradiation. The jig was exposed for 15 s, in which time it was expected the rods would receive about 3 to 5 Gy. Calibration rods were exposed to doses ranging from 3 to 7 Gy. The doses measured were slightly higher than expected so another measurement was performed, this time using GAF chromic film. Two strips of film were placed inside the jig, which was irradiated for 1 minute. The response of the TLD calibration rods appeared linear, a line fitted to the data had an R2 value of 0.997. The dose rate measured with TLD varied from 29.3 Gy/min at the inside edge of the jig to 21.3 Gy/min at the centre, with a mean dose rate of 24.9 Gy/min. The GAF chromic film results were 27.5 Gy/min at the edge, 22.8 Gy/min at the centre, and a mean dose of 22.2 Gy/min. The higher Td a mean dose of 22.2 Gy/min. The higher TLD readings may be explained by the fact that the nominal exposure time did not include the period of lowering the jig into the gamma cell, which means that the actual exposure time was slightly longer than the nominal. Since the TLDs were exposed for 15 s and the film for 1 minute, this would introduce a greater error for the TLDs. Both dosimetry methods were successfully applied in the situation described, and the two sets of results were in good agreement. The TLD material demonstrated a linear response at doses from 3 to 7 Gy. Copyright (2001) Australasian College of Physical Scientists and Engineers in Medicine

  4. Arterial roads and area socioeconomic status are predictors of fast food restaurant density in King County, WA

    OpenAIRE

    Streichert Laura C; Rehm Colin D; Moudon Anne V; Hurvitz Philip M; Drewnowski Adam

    2009-01-01

    Abstract Background Fast food restaurants reportedly target specific populations by locating in lower-income and in minority neighborhoods. Physical proximity to fast food restaurants has been associated with higher obesity rates. Objective To examine possible associations, at the census tract level, between area demographics, arterial road density, and fast food restaurant density in King County, WA, USA. Methods Data on median household incomes, property values, and race/ethnicity were obta...

  5. Study of ?+c production and Pentaquark search in WA89 CERN experiment data

    International Nuclear Information System (INIS)

    This thesis is dedicated to the study of the ?c+ charmed baryon and to the ''Pentaquark'' search, within the framework of the CERN WA89 experiment. This fixed target experiment is using a 330 GeV/c hyperon beam. Its aim is the production and the study of baryons carrying charm and strangeness as well as the search of multiquarks. The experimental setup is built around the CERN Omega spectrometer. Production and decay vertices of charmed particles are reconstructed by means of microstrip detectors. Multiwire proportional chambers reconstruct the trajectories in the Omega magnetic field and particle identification is provided by a Ring Imaging Cherenkov detector. An invariant mass signal has been obtained for the ?c+ in the proton-kaon-pion decay channel. Distorsion effects occurring in the event reconstruction have been taken into account in the estimation of the ?c+ lifetime and production cross-section. Finally, the exotic multiquark state ''Pentaquark'' was investigated in the channel proton-phi-pion but no signal was observed. (author). 86 refs., 56 figs

  6. Língua, poder e identidade em Ngugi wa thiongo e Kanavillil Rajagopalan

    Directory of Open Access Journals (Sweden)

    Dernival Venâncio Ramos

    2012-06-01

    Full Text Available Nos últimos anos, os teóricos denominados póscoloniais, como Edward Said (1995, Homi Bhabha (2001 e Stuart Hall (2003, para citar os mais conhecidos, têm se preocupado em problematizar os binarismos que geralmente vem à tona, quando o tema de discussões são as relações entre colonizadores e colonizados. A Língua é um objeto apropriadoa essa tentativa de superar estes binarismos, pois tem sido vista como um dos instrumentos de dominação colonial. Linguistas e antropólogos consideram a língua um instrumento que revela a identidade de um povo e promove a integração cultural, no presente e no passado. Neste trabalho, nos pautamos pelos argumentos de dois intelectuais póscoloniais que tratam dessa temática, o queniano Ngugi WaThiongo e o indiano Kanavillil Rajagopalan, tentando ler seus argumentos como projetos identitários. O primeiro um projeto de identidade étnico e nacional; o segundo, um projeto pós-nacional e cosmopolita. Pensamos que seus textos e posicionamentos são fundamentais para entendermos as relações entre língua, poder e cultura na segunda metade do século XX. O cenário é o contexto das relações entre as potências europeias, os povos colonizados e aqueles em processo de descolonização.

  7. Gigabit Access Passive Optical Network Using Wavelength Division Multiplexing—GigaWaM

    DEFF Research Database (Denmark)

    Iglesias Olmedo, Miguel; Suhr, Lau

    2014-01-01

    This paper summarizes the research and technical achievements done under the EU project GigaWaM. The goal of this project was to develop a cost-effective solution that can meet the increasing bandwidth demands in access networks. The approach was to use a novel wavelength division multiplexing passive optical network (WDM-PON) architecture that can deliver symmetric 1 Gb/s to 64 users over 20 km standard single mode fiber using the L and C bands for down and upstream, respectively. During the course of the project, a number of key enabling technologies were developed including tunable transceivers, athermal 50 GHz spaced arrayed waveguide grating multiplexer devices, novel hybridization technologies for integration of passive and active electro-optic devices, and system-level algorithms that ensure the quality of service. The outcome of the project proved a reliable, cost-effective, flexible, and upgradable WDM-PON solution, achieving per-user datarates of 2.5 and 10 Gb/s for up and downstream, respectively. The proposed solution is not only suitable for access networks, but also for metro aggregation and mobile backhaul.

  8. KamiWaAi - Interactive 3D Sketching with Java Based on Cl(4,1) Conformal Model of Euclidean Space

    OpenAIRE

    Hitzer, Eckhard

    2013-01-01

    This paper introduces the new interactive Java sketching software KamiWaAi, recently developed at the University of Fukui. Its graphical user interface enables the user without any knowledge of both mathematics or computer science, to do full three dimensional "drawings" on the screen. The resulting constructions can be reshaped interactively by dragging its points over the screen. The programming approach is new. KamiWaAi implements geometric objects like points, lines, cir...

  9. WaFER: a tool to derive the focal surface of millimeter wave telescopes and characterize their optical response

    Science.gov (United States)

    Sandri, M.; Villa, F.; Valenziano, L.

    2012-09-01

    In the framework of the Italian Space Agency (ASI) Technological Developments aimed at the measurement of the Cosmic Microwave Background (CMB) polarization, a method to define and characterize focal surfaces of millimeter wave telescopes has been implemented in a software package named WaFER (Wave Front Error evaluatoR). The purpose of this tool is to rapidly optimize and characterize wide focal planes providing valuable information to study and optimize high performance telescope configurations. This method is based on the GRASP9 Multi-Reflector GTD for the computation of the weighted wave front error and the software output is the 3D focal surface as the region that minimizes this figure of merit, in terms of feed locations and orientations, for polarization measurements. In addition WaFER provides the main descriptive parameters of the main beams iteratively calculated with the GRASP9 Physical Optics, using the information derived for the evaluated focal surface. The method has been applied at several telescope configurations and WaFER could be used to define the focal surface of any reflector antenna system that can be studied with GRASP9. It can be used to characterize the main beam descriptive parameters also in terms of polarization properties and straylight. Finally, an estimate of the computational time is reported for each computational step (focal surface evaluation, main beam simulations, polarization alignment).

  10. Implementation of PWR steady state self-initialization feature into RELAP4/MOD6/U4/J3

    International Nuclear Information System (INIS)

    A PWR steady state self-initialization feature has been implemented into the RELAP4/MOD6/U4/J3 code which is an improved version of RELAP4/MOD6 and can analyze not only large break but also small break LOCA in LWRs. This feature is originated from RELAP4/MOD7 which is the most updated released version of RELAP4 from INEL. Several FORTRAN subroutines in MOD7 related to this feature were transplanted into MOD6/U4/J3 with some improvements, which were the modification of method to take a balance of heat transfer between primary and secondary side at SG-U tubes, and to make it possible to nodalize secondary side of SG as multi-node. Advantages realized by implementation of this option are saving of time in initializaing a new model and an assurance of steady state and self consistency of input data in a small break LOCA analysis of a PWR. (author)

  11. Interacting coastal based ecosystem services: recreation and water quality in Puget Sound, WA.

    Science.gov (United States)

    Kreitler, Jason; Papenfus, Michael; Byrd, Kristin; Labiosa, William

    2013-01-01

    Coastal recreation and water quality are major contributors to human well-being in coastal regions. They can also interact, creating opportunities for ecosystem based management, ecological restoration, and water quality improvement that can positively affect people and the environment. Yet the effect of environmental quality on human behavior is often poorly quantified, but commonly assumed in coastal ecosystem service studies. To clarify this effect we investigate a water quality dataset for evidence that environmental condition partially explains variation in recreational visitation, our indicator of human behavior. In Puget Sound, WA, we investigate variation in visitation in both visitation rate and fixed effects (FE) models. The visitation rate model relates the differences in annual recreational visitation among parks to environmental conditions, park characteristics, travel cost, and recreational demand. In our FE model we control for all time-invariant unobserved variables and compare monthly variation at the park level to determine how water quality affects visitation during the summer season. The results of our first model illustrate how visitation relates to various amenities and costs. In the FE analysis, monthly visitation was negatively related to water quality while controlling for monthly visitation trends. This indicates people are responding to changes in water quality, and an improvement would yield an increase in the value of recreation. Together, these results could help in prioritizing water quality improvements, could assist the creation of new parks or the modification of existing recreational infrastructure, and provide quantitative estimates for the expected benefits from potential changes in recreational visitation and water quality improvements. Our results also provide an example of how recreational visitation can be quantified and used in ecosystem service assessments. PMID:23451067

  12. Interacting coastal based ecosystem services: recreation and water quality in Puget Sound, WA

    Science.gov (United States)

    Kreitler, Jason; Papenfus, Michael; Byrd, Kristin; Labiosa, William

    2013-01-01

    Coastal recreation and water quality are major contributors to human well-being in coastal regions. They can also interact, creating opportunities for ecosystem based management, ecological restoration, and water quality improvement that can positively affect people and the environment. Yet the effect of environmental quality on human behavior is often poorly quantified, but commonly assumed in coastal ecosystem service studies. To clarify this effect we investigate a water quality dataset for evidence that environmental condition partially explains variation in recreational visitation, our indicator of human behavior. In Puget Sound, WA, we investigate variation in visitation in both visitation rate and fixed effects (FE) models. The visitation rate model relates the differences in annual recreational visitation among parks to environmental conditions, park characteristics, travel cost, and recreational demand. In our FE model we control for all time-invariant unobserved variables and compare monthly variation at the park level to determine how water quality affects visitation during the summer season. The results of our first model illustrate how visitation relates to various amenities and costs. In the FE analysis, monthly visitation was negatively related to water quality while controlling for monthly visitation trends. This indicates people are responding to changes in water quality, and an improvement would yield an increase in the value of recreation. Together, these results could help in prioritizing water quality improvements, could assist the creation of new parks or the modification of existing recreational infrastructure, and provide quantitative estimates for the expected benefits from potential changes in recreational visitation and water quality improvements. Our results also provide an example of how recreational visitation can be quantified and used in ecosystem service assessments.

  13. Observations of globules and dark clouds in the CO J = 3-2 and J = 2-1 lines

    International Nuclear Information System (INIS)

    In a search for embedded molecular outflows, nine globules and compact dark clouds, including the known outflow sources B335 and L723, were observed in the (C-12)O J = 2-1 and J = 3-2 lines, and a Monte Carlo radiative transfer code utilizing a combination of microturbulent and velocity gradient line broadening was used to model the flows. Both the known sources are found to be of relatively low density and modest energy. It is found that n(H2) = 3000/cu cm in B335 and 1000/cu cm in the L723 high-velocity gas. None of the other seven clouds show clear evidence of bipolar outflows. Models of the globules B68 and B361 suggest efficient carbon isotope fractionation, with the (C-12)O and (C-13)O abundance ratios being 14 and 25, respectively. 24 references

  14. Detection of 13CO(J = 3--2) emission from the molecular clouds OMC-1 and NGC 2264

    International Nuclear Information System (INIS)

    We have made the first measurements of the 330 GHz J = 3--2 lines of 13CO in the molecular clouds OMC-1 and NGC 2264. Simple velocity gradient calculations can give a consistent description of the intensities of these lines, together with the available CO (J = 2--1) isotopic lines and the equivalent J = 1--0 transitions. They indicate fractional 13CO abundances similar to those found in dark clouds, but low values of the molecular hydrogen density, n(H2)roughly-equal5 x 103 cm-3. The higher densities (approx.105 cm-3) indicated by other molecular observations of these clouds suggest either the presence of high density fragments within the clouds or that the simple analysis is not appropriate for the CO lines, and more complex models are required to explain all the observations

  15. Magnetic susceptibility and saturation magnetic field in the t-J2-J3-K model: 3He on graphite

    Science.gov (United States)

    Seki, K.; Ohta, Y.

    2010-01-01

    We consider dynamics of zero-point vacancies introduced in the two-dimensional (2D) solid 3He adsorbed on a graphite surface. In our previous paper, we calculated the temperature dependence of the heat capacity, single-particle spectra and effective mass, as well as the spin and density excitation spectra of the t-J-K model, and discussed their experimental implications. As an extension of this model, we here propose an improved model, i.e., the t-J2-J3-K model, which takes into account the proper cut of the ring-exchange paths by the zero-point vacancies, and we discuss doping dependence of the magnetic susceptibility and saturation magnetic field in the 2D 3He. We thus show that the improved model is essential in particular for considering the magnetic field dependence of the system.

  16. Yeast Interacting Proteins Database: YDR261W-A, YDR261W-B [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR261W-A - Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-T ... 3) YDR261W-B - Retrotransposon TYA Gag and TYB Pol genes ; transcribed/translated as one unit; polyprotein i ... se (PR), and integrase (IN); similar to retroviral genes ... Rows with this prey as prey (2) Rows with this pre ... ey description Retrotransposon TYA Gag and TYB Pol genes ; transcribed/translated as one unit; polyprotein i ... se (PR), and integrase (IN); similar to retroviral genes ... Rows with this prey as prey Rows with this prey as ...

  17. Mayai-waziri wa maradhi: magic realism in Euphrase Kezilahabi\\'s long time unpublished short story

    OpenAIRE

    Bertoncini-Zúbková, Elena

    2012-01-01

    This article will present a short story which appeared in the newspaper Mzalendo on the 15th January 1978, but it took twenty-six years before it was published in a book. Presumably it was written in the same period as both the play Kaputula la Marx and probably also as some of Kezilahabi’s poems from the second collection Karibu ndani (1988). It is a period of his most critical works. In Mayai – Waziri wa Maradhi the author blames, in a highly symbolic manner, the leading classes of his ...

  18. The Unguarded Use of Stylistic Features and the Arabic Discourse Marker ‘Wa’ in Media Translation of News Report

    Directory of Open Access Journals (Sweden)

    Reem Mansour Arabiat

    2015-05-01

    Full Text Available This research paper is a process-oriented study that essentially focuses on the psychology (Mapping Theory of the trainee translator by examining the use of some stylistic features and the interpretation of the Arabic discourse marker wa into English in news reports. The purpose of this study is to investigate the extent to which students of undergraduate translation courses at Princess Alia University College / Al-Balqaa' Applied University consult and are largely influenced by their SL native language (Arabic in translating news reports into English (TL. The random sample of the study consists of (46 female students with similar linguistic, socio-cultural and educational backgrounds. Trainee students underwent a task of pre-test and post-test translation of a news report during the summer semester of the academic year 2013-2014. A three-step analytical model was applied in this study. The first step of the model involved segmenting the target text into paragraphs and sentences. The second step was the description of the functional relations that connect units of the target text at each level. The last step involved identifying the discourse markers at the boundaries of units. Obtained results revealed that students showed conspicuous bias towards Arabic (SL in using some stylistic features and the discourse marker wa (and as a safe strategy for linking sentences in English (TT, even though done improperly.

  19. Nucleotide sequence of the gene encoding the serotype-specific antigen of human (Wa) rotavirus: comparison with the homologous genes from simian SA11 and UK bovine rotaviruses.

    OpenAIRE

    Richardson, M. A.; Iwamoto, A.; Ikegami, N.; Nomoto, A.; Furuichi, Y.

    1984-01-01

    The nucleotide sequence of human (Wa) rotavirus genome segment 9, which encodes the serotype-specific antigen VP7, has been determined. Comparison of the deduced amino acid sequence of Wa VP7 protein to the sequences of simian SA11 and UK bovine VP7 proteins shows that the majority of the amino acid differences are clustered between amino acid residues 37 through 49, 65 through 75, 87 through 105, 122 through 126, 146 through 149, 178 through 181, and 208 through 242. A hydrophilicity profile...

  20. DENSE CLUMPS IN GIANT MOLECULAR CLOUDS IN THE LARGE MAGELLANIC CLOUD: DENSITY AND TEMPERATURE DERIVED FROM 13CO(J = 3-2) OBSERVATIONS

    International Nuclear Information System (INIS)

    In order to precisely determine the temperature and density of molecular gas in the Large Magellanic Cloud, we made observations of the optically thin 13CO(J = 3-2) transition using the ASTE 10 m telescope toward nine peaks where 12CO(J = 3-2) clumps were previously detected with the same telescope. The molecular clumps include those in giant molecular cloud (GMC) Types I (with no signs of massive star formation), II (with H II regions only), and III (with H II regions and young star clusters). We detected 13CO(J = 3-2) emission toward all the peaks and found that their intensities are 3-12 times lower than those of 12CO(J = 3-2). We determined the intensity ratios of 12CO(J = 3-2) to 13CO(J = 3-2), R 12/133-2, and 13CO(J = 3-2) to 13CO(J = 1-0), R 133-2/1-0, at 45'' resolution. These ratios were used in radiative transfer calculations in order to estimate the temperature and density of the clumps. The clumps have a kinetic temperature range of Tkin = 15-200 K and a molecular hydrogen gas density range of n(H2) = 8 x 102-7 x 103 cm-3. We confirmed that the higher density clumps have higher kinetic temperature and that the lower density clumps have lower kinetic temperature to better accuracy than in previous work. The kinetic temperature and density increase generally from a Type I GMensity increase generally from a Type I GMC to a Type III GMC. We interpret that this difference reflects an evolutionary trend of star formation in molecular clumps. The R 133-2/1-0 and kinetic temperature of the clumps are well correlated with the H? flux, suggesting that the heating of molecular gas with density n(H2) = 103-104 cm-3 can be explained by stellar far-ultravoilet photons.

  1. CO J=3-2 Emission from the "Water Fountain" Sources IRAS 16342-3814 and IRAS 18286-0959

    CERN Document Server

    Imai, Hiroshi; Nakashima, Jun-ichi; Ukita, Nobuharu; Deguchi, Shuji; Koning, Nico

    2009-01-01

    We observed CO J=3-2 emission from the "water fountain" sources, which exhibit high-velocity collimated stellar jets traced by water maser emission, with the Atacama Submillimeter Telescope Experiment (ASTE) 10 m telescope. We detected the CO emission from two sources, IRAS 16342-3814 and IRAS 18286-0959. The IRAS 16342-3814 CO emission exhibits a spectrum that is well fit to a Gaussian profile, rather than to a parabolic profile, with a velocity width (FWHM) of 158+/-6 km/s and an intensity peak at VLSR = 50+/-2 km/s. The mass loss rate of the star is estimated to be ~2.9x10^-5 M_sun/yr. Our morpho-kinematic models suggest that the CO emission is optically thin and associated with a bipolar outflow rather than with a (cold and relatively small) torus. The IRAS 18286-0959 CO emission has a velocity width (FWHM) of 3.0+/-0.2 km/s, smaller than typically seen in AGB envelopes. The narrow velocity width of the CO emission suggests that it originates from either an interstellar molecular cloud or a slowly-rotatin...

  2. Hydrological modelling of an artificial headwater catchment using the model system WaSiM-ETH

    Science.gov (United States)

    Hölzel, H.; Diekkrüger, B.

    2009-04-01

    The hydrological headwater catchment Chicken Creek (6.5 ha) was constructed in a lignite open-cast mine by Cottbus (Germany) to study initial processes of ecosystem development. The catchment has been intensively monitored for more than three years. Thereby, it is well suited to test and develop hydrological models. The construction of a clay layer in the basement simplifies the balancing of the water cycle since lateral inflows and vertical outflows can be neglected. For modelling purposes all basic input data were given, but neither discharge nor soil moisture measurements were provided. Hence, no high model quality can be feigned by fitting simulated results on observed output data. To compare the ability of different models and modellers to describe the hydrological behaviour of that catchment, a model competition was declared, on which several international scientists take part, all specialised in hydrological modelling. The contest is conducted in different levels, whereupon the knowledge of modellers concerning the investigated catchment will be increased stepwise. All modellers use the same database and results will be evaluated by an independent observer group. Thereby, the comparability between different model applications is guaranteed. We applied the process-based distributed Water balance Simulation Model (WaSiM-ETH) by Schulla & Jasper (2007) to simulate the first three years since the catchment construction was finished (Sep. 2005 - Aug. 2008). For the first modelling exercise important initial conditions (e.g. soil moisture) were unknown. Due to the lack of field experiences, effects of a constructed lake were disregarded. Therefore, the results of the first level were far away from being perfect, e.g. discharge was simulated from the beginning which was not observed because in reality soil water and lake storages were filled up first. The biggest differences occurred between simulated and observed surface runoff. In reality, surface runoff is the dominant runoff part responsible for approximately 70 % of the total runoff, but only half a percent was simulated. Hence, runoff dynamic and runoff peaks were underestimated. The simulated result is physically vindicated through the given data, because the sandy soils (sand content of 70 - 90 %) leads to high infiltration rates. During a first survey a compact and sealed layer was identified as the reason for high surface runoff, which could not be derived from the given date. For the second step of the modelling exercise the lake and the improved knowledge about the initial conditions were considered. Now, the simulated discharge shows the same delay as observed. Furthermore, effects of the sealed layer could be considered by a differentiated representation of soil conditions. Thereby, the simulated surface runoff increased up to 60 % of total runoff, which leads to an enforced runoff dynamic with higher peaks. Now, it is up to the observer group to evaluate whether or not the simulated results of the second modelling level has improved.

  3. Exploring Variability in Acidic Saline Playa Lakes in WA with HyMAP Hyperspectral Data

    Science.gov (United States)

    Baldridge, A. M.; Hook, S. J.; Souza Filho, C. R.; Thomson, B. J.; Bridges, N. T.; Crowley, J. K.

    2009-12-01

    Acid saline lakes in Western Australia have been recognized as useful chemical terrestrial analogs for aqueous mineral formation on Mars [e.g., 1]. In these lake systems, large pH and salinity differences are observed both laterally and vertically over scales of a few tens of meters[2, 3]. The variability in these lakes have been offered as an alternate formation mechanism for some of the phyllosilicates and sulfates on Mars, suggesting that these different mineral types may be separated by chemical gradients rather than by temporal boundaries[4]. To assess the ability to detect this variability remotely and to determine the extent of the surface variability, which may not be easily accessible in the field, spectral mapping for two of the acidic saline playa lakes was performed. HyMAP airborne data were acquired in December, 2008, of Lake Gilmore and Lake Chandler in WA. The HyMAP sensors have 126 bands that cover the wavelength range between 0.45 and 2.5 µm. Hyvista Corporation provided atmospherically corrected surface reflectance data at approximately 3m spatial resolution. Using the methodology described by [5] the HyMAP data were analyzed using ENVI to identify spectrally pure endmembers that can be used to distinguish mineralogy in the scene. Relevant (e.g. not roads, water or vegetation) spectral endmembers derived for each scene were identified visually using spectra from the ASTER spectral library[6]. The processing techniques were applied to all flight lines and ultimately a classification map mosaic was produced for selection of relevant and intriguing field sampling sites. The classification maps will be validated using field spectroscopy and visual inspection of representative samples collected from the field sites in October 2009, and laboratory spectroscopy and X-ray diffraction will be performed for further validation. The classification maps confirm variability in mineralogy across the lakes, validating geochemical modeling. There are also some unexpected intriguing results. For example, dune forms reveal interbedded sulfates and clays. These deposits may be indicative of the ephemeral nature of the lakes and are of particular interest to studies of similar martian deposits such as those in Gale Crater[7] and Columbus Crater[8]. The acid saline lakes in Australia therefore may provide an even more compelling analog to aqueous deposition on Mars. 1. K. C. Benison, D. A. LaClair, Astrobiology 3, 609 (November 1, 2003). 2. G. M. Marion et al., Geochimica Et Cosmochimica Acta 73, 3493 (June 1, 2009). 3. B. B. Bowen, K. C. Benison, Applied Geochemistry 24, 268 (2009). 4. A. Baldridge et al., Geophysical Research Letters (Accepted Manuscript, In Press). 5. J. W. Boardman, F. A. Kruse, paper presented at the Proceedings, Tenth Thematic Conference, Geologic Remote Sensing, San Antonio, TX, May 9-12, 1994. 6. A. M. Baldridge, S. J. Hook, C. I. Grove, G. Rivera, Remote Sensing of Environment 113, 711 (2009). 7. R. E. Milliken et al., paper presented at the Lunar and Planetary Institute Science Conference Abstracts, March 1, 2009. 8. J. J. Wray et al., paper presented at the Lunar and Planetary Institute Science Conference Abstracts, March 1, 2009.

  4. One year's experience of the WA medical cyclotron and radiopharmaceutical production facility

    International Nuclear Information System (INIS)

    Full text: The WA PET Centre Medical Cyclotron, a facility novel in Western Australia, produced its first bolus of FDG for patient injection for PET scanning in August 2003. This paper describes the methodology and practices employed during the past 12 months for ensuring that reliable routine provision of FDG is maintained, in parallel with facilitating the development and production of achievable new radiopharmaceuticals. An FDG production team of six staff and, a maintenance and development team of 4 staff were created from the 3.4 staff specifically recruited for this service and from incumbent staff. Teams were also set up to carry out development projects related to the service. Training procedures were created under the department's ISO9001:2000 accreditation system for the certification of production and maintenance staff. Practices and documentation systems were put in place in anticipation of a pending cGMP audit. Several unplanned major changes to equipment and infrastructure were necessary post commissioning. These changes included purchase of a different FDG synthesis module from that originally supplied, and modifications to engineering services, including changes to air conditioning, changes to supply of vacuum and upgrading of drainage in the laboratory area. A device for the measurement of end of bombardment yield was built, so that the efficiencies of the various synthesis modules could be accurately determined. Strict radiation protection proceduresed. Strict radiation protection procedures were put in place. All staff were provided with luxels and finger TLDs for monthly reporting of their radiation levels, as well as electronic monitors for real-time monitoring. From August 2003 to June 2004 (11 months) 2229 FDG patient doses were produced and dispensed by this facility. An average of 8.0 patient doses per available working day were dispensed during the 2003 period, rising to 11.1 patient doses per day in 2004. Several 11NH3 doses were also delivered. The cyclotron was unavailable for 9 days owing to scheduled maintenance, and a total of 35 (1.6%) patients were cancelled owing to unscheduled maintenance on 7 days. The following major initiatives are now in place for the further development of this facility: 1. Development of a solid targetry facility for the production of 123I, 124I, 64Cu, and other isotopes. Two prototype external beam lines have been developed and trialled. Experiments designed to measure the beam profile at the end of the external beam line are underway. 2. A synthesis module for the production of 18FMISO and 18FLT is being developed in-house in collaboration with the cyclotron manufacturer. 3. A module for the synthesis of 18F-Choline has been installed. 4. A prototype synthesis module is under development which will allow experimentation in the production of novel radiopharmaceuticals based on isotopes produced from liquid targetry. Normalised over 12 months, production staff received on average 3.28 mSv whole body effective dose, with the worst case being 8.46 mSv. Finger doses were 35.6 mSv on average, 70.6 mSv worst case. (Note that production staff also dispense patient doses into individual syringes). Similarly, maintenance staff received 1.41 mSv (avg), 2.56 mSv (max) whole body effective dose, and 33.0 mSv (avg), 124.3 mSv (max) finger dose. A facility for the production and development of short-lived PET radiopharmaceuticals has been created with a capacity that is expected to satisfy Western Australian demands for the next ten years. This facility reliably and routinely produces FDG, and incorporates a well supported and vigorous radiopharmaceutical development function. Copyright (2004) Australasian College of Physical Scientists and Engineers in Medicine

  5. Al-‘Adl wa-l-Ihsan in Spain: A National Project for an Islamic Transnational Movement?

    Directory of Open Access Journals (Sweden)

    Arigita, Elena

    2010-06-01

    Full Text Available The author examines recent developments in Muslim associations of Spain established by Moroccan immigrants linked to the Islamic movement al-‘Adl wa-l-Ihsan (Justice and Spirituality. By analyzing the discourse of an emerging leadership of this movement, she seeks to understand how the political commitment and spiritual bond of these activists with the Moroccan Guide both incorporate and rework elements from the dominant discourse on the necessary adaptation of Islam to Spain. Based on in-depth interviews with these leaders, she explores how the Movement’s commitment to Morocco as well as the ummah (Universal Community of Believers interact with the way these muslims perceive and position themselves in the national context of Spain.

    Se examina en este ensayo la evolución reciente de las asociaciones musulmanas en España creadas por inmigrantes marroquíes vinculados al movimiento islámico al-‘Adl wa-l-Ihsan (Justicia y Espiritualidad. Partiendo de las declaraciones de un liderazgo emergente de este movimiento en España, la autora trata de explicar cómo el compromiso político de estas personas y el vínculo espiritual con su Guía marroquí incorporan, al tiempo que reelaboran, elementos del discurso dominante sobre la necesaria adaptación del islam a España. Entrevistas en profundidad con estos activistas revelan cómo los lazos del Movimiento con Marruecos y con la umma (Comunidad universal de creyentes interactúan con el modo en el que estos musulmanes perciben y se posicionan en el contexto nacional de España.

  6. Neary simultaneous observations of vibrationally excited J = 1?0, J = 2?1, J = 3?2, and J = 4?3 SiO masers

    International Nuclear Information System (INIS)

    We have detected the SiO J = 3?2v = 2 and J = 4?3v = 1 and 2 masers and made nearly simultaneous observations of the strongest SiO maser transitions in a selection of late-type stars and Orion. These observations allow us to present a snapshot of the SiO maser phenomenon to aid in the construction of models of the physical phenomena involved

  7. Chiral spin liquid emerging between competing magnetic order states in the spin-1/2 J1-J2-J3 kagome Heisenberg model

    Science.gov (United States)

    Gong, Shoushu; Zhu, Wei; Balents, Leon; Sheng, Dongning

    2015-03-01

    We studied the extended spin- 1 / 2 kagome model with the first neighbor (J1), the second (J2) and third neighbor (J3) couplings using density matrix renormalization group. We established a quantum phase diagram for 0 transitions from the CSL to the magnetically ordered phases, and to the possible Z2 spin liquid of the Heisenberg kagome model. Interestingly, the exotic continuous topological phase transition might be realized in the system.

  8. Verification of LOCA/ECCS analysis codes ALARM-B2 and THYDE-B1 by comparison with RELAP4/MOD6/U4/J3

    International Nuclear Information System (INIS)

    For a verification study of ALARM-B2 code and THYDE-B1 code which are the component of the JAERI code system for evaluation of BWR ECCS performance, calculations for typical small and large break LOCA in BWR were done, and compared with those by RELAP4/MOD6/U4/J3 code. This report describes the influences of differences between the analytical models incorporated in the individual code and the problems identified by this verification study. (author)

  9. 10 CFR Appendix A to Subpart A of... - Metropolitan Statistical Areas/Consolidated Metropolitan Statistical Areas With 1980 Populations...

    Science.gov (United States)

    2010-01-01

    ...Barbara-Santa Maria-Lompoc MSA CA Scranton-Wilkes Barre-Hazleton MSA PA Seattle-Tacoma-Bremerton CMSA WA Shreveport-Bossier City MSA LA Spokane MSA WA Springfield MSA MA Stockton-Lodi MSA CA Syracuse MSA NY Tampa-St....

  10. Verification and Translation of "Risalat Latifa fi Bayan al-Iman Lughatan wa Shar'an inda Ahl al-Lisan" by Arslanzade

    Directory of Open Access Journals (Sweden)

    Hilmi Karaa?aç

    2012-10-01

    Full Text Available The available manuscript is composed of verification and Turkish tranlation of "Risalat Latifa fi Bayan al-Iman Lughatan wa Shar'an inda Ahl al-Lisan" which is related to Kalam in periodical entitled "Ta’lifat al-Marhum Arslanzade", which does consist of Arslanzade Mustafa Efendi’s tractates, and registered in Manisa Province Public Library 45 Hk. No. 5837.

  11. Meeting report: GSC M5 roundtable at the 13th International Society for Microbial Ecology meeting in Seattle, WA, USA August 22-27, 2010

    OpenAIRE

    Gilbert, Jack A; Meyer, Folker; Knight, Rob; Field, Dawn; Kyrpides, Nikos; Yilmaz, Pelin; Wooley, John

    2010-01-01

    This report summarizes the proceedings of the Metagenomics, Metadata, Metaanalysis, Models and Metainfrastructure (M5) Roundtable at the 13th International Society for Microbial Ecology Meeting in Seattle, WA, USA August 22-27, 2010. The Genomic Standards Consortium (GSC) hosted this meeting as a community engagement exercise to describe the GSC to the microbial ecology community during this important international meeting. The roundtable included five talks given by members of the GSC, and w...

  12. MARINE BIOLOGICAL REPORT IN THE NU?BAT AL-DAHR F? ?A?Â?IB AL-BARR WA-AL-BA?R

    DEFF Research Database (Denmark)

    Provencal, Philippe

    2014-01-01

    I det arabiske geografiske værk NU?BAT AL-DAHR F? ?A???IB AL-BARR WA-AL-BA?R (færdigskrevet mellem 1324 og 1327) fra omtales seks dyr fra Adenbugten. Det dreje sig om savrokke, kuglefisk, pilrokke, pindsvinefisk og hvalhaj. Det sidste dyr har ikke kunnet bestemmes. Artiklen bringer en oversættelse af optegnelsen til engelsk samt både en filologisk som en biologisk kommentar.

  13. ONGs, indios y petroléo: El caso U'wa a través de los mapas del territorio en disputa

    Directory of Open Access Journals (Sweden)

    2003-01-01

    Full Text Available ONGS, INDIENS ET PÉTROLE : LE DOSSIER U'WA À TRAVERS LES CARTES DE LA QUERELLE TERRITORIALE. Cet article explore les cartes du dossier U?wa. Cette confrontation est devenue célèbre suite à la menace de suicide d?un peuple indigène face à un projet pétrolier mené par deux grandes entreprises multinationales, OXY et SHELL, associées à l?État colombien. Le récit d?une ? tribu ? décidée à se suicider au nom de ce qu?elle considère sacré a attiré l?attention des médias du monde entier mais aussi de nombreuses organisations non gouvernementales (ONGs écologiques et des droits de l?homme. Ces dernières ont une participation active dans cette dispute qui se déroule dans le cadre du conflit armé colombien. L?objet de cet article est de mener une réflexion à propos des récits, des images et des représentations avec lesquelles les différents acteurs agissent dans la confrontation. À un certain moment de la controverse, toutes les parties ont préparé et même publié des cartes pour soutenir, souligner et illustrer leur argumentation. Elles montrent toutes le même ensemble de zones : celle de l?aire d?exploitation pétrolière et celles de la réserve indigène légalement reconnue et de l?aire réclamée comme territoire ancestral par les U?wa. Cependant chacun a choisi de montrer la relation entre ces surfaces de façon particulière et met en relief certains éléments. Ces cartes peuvent donc être considérées comme des textes culturels et conforment ainsi un corpus à explorer pour comprendre le conflit. Étant donné que la cartographie prétend être objective, les cartes sont apparemment éloignées des positions qui sont prises dans la discussion. Elles nous offrent, en conséquence, un point de vue privilégié pour entrevoir les hypothèses et les présuppositions de chacun des acteurs. Cet article nous permet une meilleure approcheà travers les cartes, du ? sous-texte ? des antagonistes, des notions, opinions et intentions que les acteurs n'expriment pas de façon explicite, c?est-à-dire de l?inconscient politique de chaque ligne d?argumentation. L?analyse critique de la cartographie nous montre comment, paradoxalement, l?? agenda ? des ONGs écologiques ressemble à celle des agents du développement pétrolier en s?appuyant sur le même type de catégories et de notions. Il nous montre aussi les dispositifs à travers lesquels la cosmologie indigène est rendue statique et essentielle, devenant en même temps invisible et sans légitimité. El presente artículo hace un análisis del caso U'wa, una confrontación que debe su celebridad a la amenaza de suicidio de un pueblo indígena frente a un proyecto petrolero adelantado por dos grandes compañías (la OXY y la SHELL asociadas con el Estado colombiano. El relato de una ?tribu? dispuesta a suicidarse a nombre de lo que ella considera sagrado ha llamado la atención no sólo de los medios en el mundo, sino de numerosas organizaciones no gubernamentales ambientalistas e indigenistas, las que han intervenido de manera activa en esta disputa que se desarrolla en medio del conflicto armado colombiano. El propósito de este artículo es el de adelantar una reflexión sobre el conjunto de relatos, imágenes y representaciones que han guiado las prácticas de los diferentes actores en la confrontación. Todas las partes han preparado e incluso publicado mapas en algún punto de la controversia con el fin de sustentar, resaltar e ilustrar su argumentación. Todos ellos muestran el mismo conjunto de zonas: las del área de explotación petrolera y los territorios indígenas tanto reconocidos por la ley como los reclamados por los indígenas. Cada uno muestra, sin embargo, estas zonas y la relación entre ellas de manera particular y pone en relieve ciertos elementos. Estos mapas se pueden considerar como verdaderos textos culturales y constituyen así un corpus para aproximarnos a la confrontación. Debido a la pretensión de objetividad con la que se expresa la cartografía, los mapas aparecen

  14. Kualitas Hidup Menurut Tafsir Nusantara: Baldatun Thayyibatun wa Rabbun Ghafûr dalam Tafsir Marâh Labîd, Tafsir Al-Azhar, Tafsir An-Nûr, Tafsir Departemen Agama, dan Tafsir Al-Mishbâh

    OpenAIRE

    Andriansyah, Yuli

    2013-01-01

    This article analyzed the phrase “baldatun thayyibatun wa rabbun ghafûr”, one of main keywords in Islamic quality of life research, with reference to the interpretations given by tafsir nusantara i.e. Marâh Labîd, Tafsir An Nur, Tafsir Al-Azhar, Al Qur’ân dan Tafsirnya, and Tafsir Al-Mishbâh. The phrase “baldatun thayyibatun wa rabbun ghafûr” was chosen because of its relation with the concept of civilized and sustainable society as UII research orientation, while the selectio...

  15. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the VP8* carbohydrate-binding protein of the human rotavirus strain Wa

    International Nuclear Information System (INIS)

    The carbohydrate-binding component (VP8*64–223) of the human Wa rotavirus spike protein has been overexpressed in E. coli, purified and crystallized in two different crystal forms. X-ray diffraction data have been collected that have enabled determination of the Wa VP8*64–223 structure by molecular replacement. Rotaviruses exhibit host-specificity and the first crystallographic information on a rotavirus strain that infects humans is reported here. Recognition and attachment to host cells, leading to invasion and infection, is critically linked to the function of the outer capsid spike protein of the rotavirus particle. In some strains the VP8* component of the spike protein is implicated in recognition and binding of sialic-acid-containing cell-surface carbohydrates, thereby enabling infection by the virus. The cloning, expression, purification, crystallization and initial X-ray diffraction analysis of the VP8* core from human Wa rotavirus is reported. Two crystal forms (trigonal P3221 and monoclinic P21) have been obtained and X-ray diffraction data have been collected, enabling determination of the VP8*64–223 structure by molecular replacement

  16. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the VP8* carbohydrate-binding protein of the human rotavirus strain Wa

    Energy Technology Data Exchange (ETDEWEB)

    Kraschnefski, Mark J.; Scott, Stacy A. [Institute for Glycomics, Griffith University (Gold Coast Campus), PMB 50 Gold Coast Mail Centre, Queensland 9726 (Australia); Holloway, Gavan; Coulson, Barbara S.; Itzstein, Mark von [Department of Microbiology and Immunology, The University of Melbourne, Victoria 3010 (Australia); Blanchard, Helen, E-mail: h.blanchard@griffith.edu.au [Institute for Glycomics, Griffith University (Gold Coast Campus), PMB 50 Gold Coast Mail Centre, Queensland 9726 (Australia)

    2005-11-01

    The carbohydrate-binding component (VP8*{sub 64–223}) of the human Wa rotavirus spike protein has been overexpressed in E. coli, purified and crystallized in two different crystal forms. X-ray diffraction data have been collected that have enabled determination of the Wa VP8*{sub 64–223} structure by molecular replacement. Rotaviruses exhibit host-specificity and the first crystallographic information on a rotavirus strain that infects humans is reported here. Recognition and attachment to host cells, leading to invasion and infection, is critically linked to the function of the outer capsid spike protein of the rotavirus particle. In some strains the VP8* component of the spike protein is implicated in recognition and binding of sialic-acid-containing cell-surface carbohydrates, thereby enabling infection by the virus. The cloning, expression, purification, crystallization and initial X-ray diffraction analysis of the VP8* core from human Wa rotavirus is reported. Two crystal forms (trigonal P3{sub 2}21 and monoclinic P2{sub 1}) have been obtained and X-ray diffraction data have been collected, enabling determination of the VP8*{sub 64–223} structure by molecular replacement.

  17. Pioneer 11 observations of trapped particle absorption by the Jovian ring and the satellites 1979, J1, J2, and J3

    Science.gov (United States)

    Pyle, K. R.; Mckibben, R. B.; Simpson, J. A.

    1983-01-01

    Pioneer 11 low energy telescope observation of charged particles around the Jovian satellites Amalthea, 1979 J1, J2, and J3, and the Jupiter ring are examined in the light of Voyager optical data from the same region. Good agreement was found in the absorption features of 0.5-8.7 MeV protons, electrons with energies of 3.4 MeV or more, and medium-Z nuclei. The heavier nuclei are suggested to be oxygen and sulfur particles with energies exceeding 70 MeV/nucleon. The observed intensity features in the regularly spaced radiation bands are interpreted as ring and satellite absorption.

  18. A Search for CO(J=3-2) Emission from the Host Galaxy of GRB 980425 with the Atacama Submillimeter Telescope Experiment

    OpenAIRE

    Hatsukade, Bunyo; Kohno, Kotaro; ENDO, Akira; Tosaki, Tomoka; Ohta, Kouji; Sakamoto, Seiichi; Kawai, Nobuyuki; Cortes, Juan R.; Nakanishi, Kouichiro; Okuda, Takeshi; Muraoka, Kazuyuki; Sakai, Takeshi; Vreeswijk, Paul M.; Ezawa, Hajime; Yamaguchi, Nobuyuki

    2007-01-01

    We report on a deep search for CO(J=3-2) line emission from the host galaxy of GRB 980425 with the Atacama Submillimeter Telescope Experiment (ASTE). We observed five points of the galaxy covering the entire region. After combining all of the spectra, we obtained a global spectrum with the rms noise level of 3.3 mK in T_mb scale at a velocity resolution of 10 km s^-1. No significant emission was detected, though we find a marginal emission feature in the velocity range corre...

  19. Project AProWa: a national view on managing trade-offs between agricultural production and conservation of aquatic ecosystems

    Science.gov (United States)

    Dietzel, Anne; Rahn, Eric; Stamm, Christian

    2014-05-01

    Swiss agriculture is legally committed to fulfill several, partially conflicting goals such as agricultural production on the one hand and the conservation of natural resources on the other hand. In the context of the research project AProWa ("Agricultural Production and Water"), the relationships between the production aspect and the conservation of aquatic ecosystems is analyzed with a holistic approach. Agricultural production and the protection of water resources have high potential for conflicts: Farmers use ground and surface water to irrigate their fields. On the other hand, drainage systems enable the production on otherwise unfavorably wet soils. These in turn often affect ground water recharge and divert precipitation directly into surface waters, which changes their hydrological regime. Typically, drainage systems also elevate the input of nutrients and pesticides into the water bodies. In general, applied fertilizers, plant protection products, veterinary drugs and phytohormones of cultivated plants are introduced into the ground and surface waters through different processes such as drift, leaching, runoff, preferential flow or erosion. They influence the nutrient cycles and ecological health of aquatic systems. The nutrient and pesticide loss processes themselves can be altered by tillage operations and other agricultural practices. Furthermore, the competition for space can lead to additional conflicts between agriculture and the protection of aquatic ecosystems. For example, channelized or otherwise morphologically changed rivers do not have a natural discharge pattern and are often not suitable for the local flora and fauna; but naturally meandering rivers need space that cannot be used for agriculture. In a highly industrialized and densely populated country like Switzerland, all these potential conflicts are of importance. Although it is typically seen as a water-rich country, local and seasonal overexploitation of rivers through water extraction for irrigation can already be documented. Due to drier summers induced by climate change, this phenomenon is expected to gain more importance in the future. Related to water quantity and quality it is crucial to think about the diverging interests between the supply of the population with national agricultural products and the preservation of the water bodies, their ecological value and their other ecosystem services (e.g. drinking water supply). The project AProWa attempts to elucidate trade-offs of national goals for water protection and agricultural production in Switzerland by involving stakeholders from agricultural administration (Federal Office for Agriculture, FOAG), agricultural research (Agroscope), water research (Swiss Federal Institute of Aquatic Science and Technology, Eawag) and environmental protection (Federal Office for the Environment, FOEN). This is done by applying multi-criteria decision analysis facilitating consensus regarding goals and possible activities and alternatives to reach these goals. This is followed by an evaluation of main conflicts and prioritized research gaps. We present preliminary results from workshops and interdisciplinary discussion groups that encompass an objectives hierarchy reflecting agricultural production and water conservation goals. Furthermore, an inventory of agricultural practices and water protection measures is presented, enabling their evaluation for the provision of agricultural production while sustaining aquatic ecosystems.

  20. Arterial roads and area socioeconomic status are predictors of fast food restaurant density in King County, WA

    Science.gov (United States)

    Hurvitz, Philip M; Moudon, Anne V; Rehm, Colin D; Streichert, Laura C; Drewnowski, Adam

    2009-01-01

    Background Fast food restaurants reportedly target specific populations by locating in lower-income and in minority neighborhoods. Physical proximity to fast food restaurants has been associated with higher obesity rates. Objective To examine possible associations, at the census tract level, between area demographics, arterial road density, and fast food restaurant density in King County, WA, USA. Methods Data on median household incomes, property values, and race/ethnicity were obtained from King County and from US Census data. Fast food restaurant addresses were obtained from Public Health-Seattle & King County and were geocoded. Fast food density was expressed per tract unit area and per capita. Arterial road density was a measure of vehicular and pedestrian access. Multivariate logistic regression models containing both socioeconomic status and road density were used in data analyses. Results Over one half (53.1%) of King County census tracts had at least one fast food restaurant. Mean network distance from dwelling units to a fast food restaurant countywide was 1.40 km, and 1.07 km for census tracts containing at least one fast food restaurant. Fast food restaurant density was significantly associated in regression models with low median household income (p < 0.001) and high arterial road density (p < 0.001) but not with percent of residents who were nonwhite. Conclusion No significant association was observed between census tract minority status and fast food density in King County. Although restaurant density was linked to low household incomes, that effect was attenuated by arterial road density. Fast food restaurants in King County are more likely to be located in lower income neighborhoods and higher traffic areas. PMID:19630979

  1. Arterial roads and area socioeconomic status are predictors of fast food restaurant density in King County, WA

    Directory of Open Access Journals (Sweden)

    Streichert Laura C

    2009-07-01

    Full Text Available Abstract Background Fast food restaurants reportedly target specific populations by locating in lower-income and in minority neighborhoods. Physical proximity to fast food restaurants has been associated with higher obesity rates. Objective To examine possible associations, at the census tract level, between area demographics, arterial road density, and fast food restaurant density in King County, WA, USA. Methods Data on median household incomes, property values, and race/ethnicity were obtained from King County and from US Census data. Fast food restaurant addresses were obtained from Public Health-Seattle & King County and were geocoded. Fast food density was expressed per tract unit area and per capita. Arterial road density was a measure of vehicular and pedestrian access. Multivariate logistic regression models containing both socioeconomic status and road density were used in data analyses. Results Over one half (53.1% of King County census tracts had at least one fast food restaurant. Mean network distance from dwelling units to a fast food restaurant countywide was 1.40 km, and 1.07 km for census tracts containing at least one fast food restaurant. Fast food restaurant density was significantly associated in regression models with low median household income (p Conclusion No significant association was observed between census tract minority status and fast food density in King County. Although restaurant density was linked to low household incomes, that effect was attenuated by arterial road density. Fast food restaurants in King County are more likely to be located in lower income neighborhoods and higher traffic areas.

  2. Extremely Strong ^{13}CO J=3-2 Line in the "Water Fountain" IRAS 16342-3814: Evidence for the Hot-Bottom Burning

    CERN Document Server

    Imai, Hiroshi; He, Jin-Hua; Nakashima, Jun-ichi; Hsia, Chih-Hao; Sakai, Takeshi; Deguchi, Shuji; Koning, Nico

    2012-01-01

    We observed four "water fountain" sources in the CO J=3-2 line emission with the Atacama Submillimeter Telescope Experiment (ASTE) 10 m telescope in 2010-2011. The water fountain sources are evolved stars that form high-velocity collimated jets traced by water maser emission. The CO line was detected only from IRAS 16342-3814. The present work confirmed that the ^{12}CO to ^{13}CO line intensity ratio is ~1.5 at the systemic velocity. We discuss the origins of the very low ^{12}CO to ^{13}CO intensity ratio, as possible evidence for the "hot-bottom burning" in an oxygen-rich star, and the CO intensity variation in IRAS 16342-3814.

  3. Transpiration, growth and latex production of a Hevea brasiliensis stand facing drought in Northeast Thailand : the use of the WaNuLCAS model as an exploratory tool

    OpenAIRE

    Boithias, Laurie; Do, Frederic; Isarangkool Na Ayutthaya, Supat; Junjittakarn, Junyia; S. Siltecho; Hammecker, Claude

    2012-01-01

    In order to get the benefit of the growing world demand for natural rubber, Hevea brasiliensis is increasingly planted in drought-prone areas, such as in the southern part of northeast Thailand. Modelling can be a useful approach in identifying key points of improvement for rubber tree cultivation in such waterlimited areas. The first objective of this study was to test the possibility of using the Water Nutrients and Light Capture in Agroforestry Systems (WaNuLCAS) model as an exploratory to...

  4. Formulation and Characterization of LX-17-2 from new FK 800 binder and WA, ATK, and BAE TATBs

    Energy Technology Data Exchange (ETDEWEB)

    DePiero, S C; Hoffman, D M

    2007-08-03

    Currently LLNL has no Kel-F 800 or wet-aminated TATB reserves for formulation. Although both materials are soon to be commercially available, their synthesis processes have changed and the explosive must be re-evaluated. In 2000 3M phased out the uses of perfluorooctanoyl (C8) derivatives due to environmental persistence and bioaccumulation issues. A C8 derivative was used as an emulsifier for making Kel F-800. In 2001 Kel F-800 was scheduled to be discontinued and the last Kel F-800 run was made in early 2002. LANL ordered 2M$ worth of Kel-F 800 for reserves and Pantex purchased several hundred pounds to satisfy mock needs. After four years, 3M has decided to introduce a Kel-F 800-like polymer based on a new emulsifier using the same chlorotrifluoroethylene and vinylidene fluoride monomers and emulsion polymerization process. They have produced 3 batches and claim the 'new' FK-800 is indistinguishable from the 'old' Kel-F 800 in any of their testing parameters. In June-July 2006 3M scaled up a batch of about 800 pounds and have test quantities available. We have samples of the new FK-800 for evaluation. Neither wet nor dry-aminated TATB has been synthesized in the US in any significant quantity since about 1985 and significant quantities of LX-17-1 has not been formulated since about 1990. Over the last few years as part of a DOD MANTECH, ATK Thiokol and BAE Holston Army Ammunition Plant (HAAP) have produced moderate quantities of TATB ({approx}5 kg batches) with plans to scale up for DOD applications. Thiokol TATB is polycrystalline with an average particle size of about 40 m (similar to WA TATB) but HAAP TATB is only 5-6 {micro}m (similar to ultrafine). We have obtained small quantities of these materials for evaluation. The project (1) compares new FK-800 with old Kel-F 800 and FK-800 lots currently available at LLNL, (2) compares and characterizes new TATB with old TATB, (3) formulates new FK-800 with wet-aminated TATB and new TATBs in according to HAAP slurry coating procedure into LX-17-2, and (4) evaluates the mechanical and detonation performance characteristics of this insensitive high explosive (IHE). Priorities are to prove that these new materials can be formulated, pressed to density and machined; and that they contain no impurities which might cause compatibility issues. Since 3M, LANL, Pantex and AWE are currently evaluating the new FK-800, we plan to share data rather than repeating their work. Our effort is described.

  5. ADSORPTION TECHNOLOGIES - EVERETT, WA

    Science.gov (United States)

    The presentation provides an overview of adsorptive media technology for the removal of arsenic from drinking water. The presentation is divided into four topics: Technology, Application, Design and Operation. Each topic is discussed in general and a number of photographs from th...

  6. Overuse of artemisinin-combination therapy in Mto wa Mbu (river of mosquitoes, an area misinterpreted as high endemic for malaria

    Directory of Open Access Journals (Sweden)

    Sauerwein Robert

    2008-11-01

    Full Text Available Abstract Background Adequate malaria diagnosis and treatment remain major difficulties in rural sub-Saharan Africa. These issues deserve renewed attention in the light of first-line treatment with expensive artemisinin-combination therapy (ACT and changing patterns of transmission intensity. This study describes diagnostic and treatment practices in Mto wa Mbu, an area that used to be hyperendemic for malaria, but where no recent assessments of transmission intensity have been conducted. Methods Retrospective and prospective data were collected from the two major village health clinics. The diagnosis in prospectively collected data was confirmed by microscopy. The level of transmission intensity was determined by entomological assessment and by estimating sero-conversion rates using anti-malarial antibody responses. Results Malaria transmission intensity by serological assessment was equivalent to 40% of outpatients attending the clinics in 2006–2007 were diagnosed with malaria. Prospective data demonstrated a very high overdiagnosis of malaria. Microscopy was unreliable with Conclusion Transmission intensity has dropped considerably in the area of Mto wa Mbu. Despite this, most fevers are still regarded and treated as malaria, thereby ignoring true causes of febrile illness and over-prescribing ACT. The discrepancy between the perceived and actual level of transmission intensity may be present in many areas in sub-Saharan Africa and calls for greater efforts in defining levels of transmission on a local scale to help rational drug-prescribing behaviour.

  7. A Search for CO(J=3-2) Emission from the Host Galaxy of GRB 980425 with the Atacama Submillimeter Telescope Experiment

    CERN Document Server

    Hatsukade, Bunyo; Endo, Akira; Tosaki, Tomoka; Ohta, Kouji; Sakamoto, Seiichi; Kawai, Nobuyuki; Cortes, Juan R; Nakanishi, Kouichiro; Okuda, Takeshi; Muraoka, Kazuyuki; Sakai, Takeshi; Vreeswijk, Paul M; Ezawa, Hajime; Yamaguchi, Nobuyuki; Kamegai, Kazuhisa; Kawabe, Ryohei

    2007-01-01

    We report on a deep search for CO(J=3-2) line emission from the host galaxy of GRB 980425 with the Atacama Submillimeter Telescope Experiment (ASTE). We observed five points of the galaxy covering the entire region. After combining all of the spectra, we obtained a global spectrum with the rms noise level of 3.3 mK in T_mb scale at a velocity resolution of 10 km s^-1. No significant emission was detected, though we find a marginal emission feature in the velocity range corresponding to the redshift of the galaxy. We derive 3 sigma upper limits on the global properties: the velocity-integrated CO(3-2) intensity of I_CO(3-2) < 0.26 K km s^-1 by adopting a velocity width of 67 km s^-1; the H_2 column density of N(H_2) < 3 x 10^20 cm^-2; the molecular gas mass of M(H_2) < 3 x 10^8 M_sun, by assuming a CO line luminosity to H_2 molecular gas mass conversion factor of X_CO = 5.0 x 10^20 cm^-2 (K km s^-1)^-1; and the star formation rate of SFR < 0.1 M_sun yr^-1, based on the Schmidt law. The SFR is consi...

  8. High resolution observations of HCN and HCO+ J=3-2 in the disk and outflow of Mrk231 -Detection of vibrationally excited HCN in the warped nucleus

    CERN Document Server

    Aalto, S; Muller, S; Winters, J M; Gonzalez-Alfonso, E; van der Werf, P; Henkel, C; Costagliola, F; Neri, R

    2014-01-01

    We obtained high resolution (0."25 to 0."90) observations of HCN and HCO+ J=3-2 of the ultraluminous QSO galaxy Mrk231 with the IRAM Plateau de Bure Interferometer. We find luminous HCN and HCO+ 3-2 emission in the main disk and we detect compact (r350 pc) line wings are found for HCN 3-2 with velocities +-750 km/s. Line ratios indicate that the emission is emerging in dense gas n=1e4 - 5e5 cm-3 of elevated HCN abundance X(HCN)=1e-8 to 1e-6. High X(HCN) also allows for the emission to originate in gas of more moderate density. We tentatively detect nuclear emission from the reactive ion HOC+ with HCO+/HOC+=10-20. The HCN v2=1f line emission is consistent with the notion of a hot, dusty, warped inner disk of Mrk231 where the v2=1f line is excited by bright mid-IR 14 micron continuum. We estimate the vibrational temperature T_vib to 200-400 K. We propose that 50% of the main HCN emission may have its excitation affected by the radiation field through IR pumping of the vibrational ground state. The HCN emission ...

  9. Corrosion Properties of Duplex Stainless Steels - STS329LD and STS329J3L - for the Seawater Systems in Nuclear Power Plant

    Energy Technology Data Exchange (ETDEWEB)

    Chang, Hyun Young; Park, Heung Bae [Korea Electric Power Corporation E and C, Yongin (Korea, Republic of); Kim, Young Sik [Andong National University, Andong (Korea, Republic of); Ahn, Sang Kon [POSCO, Pohang (Korea, Republic of); Jang, Yoon Young [ANSCO, Daejeon (Korea, Republic of)

    2011-04-15

    Lean duplex stainless steels have been developed in Korea for the purpose of being used in the seawater systems of industry. There are also many important seawater systems in nuclear power plants. These systems supply seawater to cooling water condenser tubes, heat exchanger tubes, related pipes and chlorine injection systems. The flow velocity of some part of seawater systems in nuclear power plants is high and damages of components from corrosion are severe. The considered lean duplex stainless steels are STS329LD (20.3Cr-2.2Ni-1.4Mo) and STS329J3L (22.4Cr-5.7Ni-3Mo) and PRENs of them are 29.4 and 37.3 respectively. Physical, mechanical and micro-structural properties of them are evaluated, and electrochemical corrosion resistance is measured quantitatively in NaCl solution. Critical Pitting Temperatures (CPT)s are measured on these alloys and pit depths are evaluated using laser microscope. Long period field tests on these alloys are now being performed, and some results are going to be presented in the following study.

  10. High Angular Resolution, Sensitive CS J=2-1 and J=3-2 Imaging of the Protostar L1551 NE: Evidence for Outflow-Triggered Star Formation ?

    CERN Document Server

    Yokogawa, S; Momose, M

    2003-01-01

    High angular resolution and sensitive aperture synthesis observations of CS ($J=2-1$) and CS ($J=3-2$) emissions toward L1551 NE, the second brightest protostar in the Taurus Molecular Cloud, made with the Nobeyama Millimeter Array are presented. L1551 NE is categorized as a class 0 object deeply embedded in the red-shifted outflow lobe of L1551 IRS 5. Previous studies of the L1551 NE region in CS emission revealed the presence of shell-like components open toward L1551 IRS 5, which seem to trace low-velocity shocks in the swept-up shell driven by the outflow from L1551 IRS 5. In this study, significant CS emission around L1551 NE was detected at the eastern tip of the swept-up shell from $V_{\\rm{lsr}}$ = 5.3 km s$^{-1}$ to 10.1 km s$^{-1}$, and the total mass of the dense gas is estimated to be 0.18 $\\pm$ 0.02 $M_\\odot$. Additionally, the following new structures were successfully revealed: a compact disklike component with a size of $\\approx$ 1000 AU just at L1551 NE, an arc-shaped structure around L1551 NE...

  11. Voisins ou ennemis à Arba Wa Nus ? La mise en scène du quotidien des migrants forcés égyptiens et réfugiés sud soudanais dans un quartier populaire du Caire

    Directory of Open Access Journals (Sweden)

    Fabienne Le Houérou

    2012-03-01

    Full Text Available Cet article tente, à partir de l’outil vidéo et d’une approche théorique interactive, d’explorer les rapports de voisinage entre deux populations de déplacés (Sud Soudanais et Égyptiens du sud dans une zone irrégulière de la mégapole cairote. Une observation des scènes de la vie quotidienne dans les espaces publics de Quatre et demi (Arba Wa Nus permet de poser l’hypothèse d’un territoire essentiellement marqué par la violence des rapports sociaux. Les agressions dont sont victimes les Sud Soudanais, en provenance du Bar El-Ghazal, sont elles le signe de l’émergence de nouveaux racismes liés à l’augmentation des flux de migrants forcés subsahariens ou alors les hostilités quotidiennes sont-elles le produit social suis-generis d’un espace marginal qui se singularise par l’indigence et le déracinement des populations qui y sont installées ?

  12. An evaluation of potential allelic association between the STRs vWA and D12S391: implications in criminal casework and applications to short pedigrees.

    Science.gov (United States)

    Gill, Peter; Phillips, Chris; McGovern, Catherine; Bright, Jo-Anne; Buckleton, John

    2012-07-01

    An evaluation was carried out to determine the effect on routine forensic calculations when incorporating STRs D12S391 and vWA. These loci are co-located on the same arm of chromosome 12. It has been suggested that allelic association could result in over-estimates of strength-of-evidence calculations. In the first place, we argue that is very unlikely that genotypes collected from typical cosmopolitan forensic databases can provide meaningful information about effects attributable to physical linkage. Since admixture is the most likely cause of allelic association in modern populations we specifically evaluate this effect. We use computer simulation as the preferred approach to generate populations with disequilibrium and observe the effect on match probability. Although we have specifically evaluated the linkage between D12S391 and vWA, the methods described in this paper can be extended and generalized to evaluate linkage effects between any pair of loci where the recombination rate is known. Many jurisdictions apply a subpopulation correction following the standard method of Balding and Nichols. Such corrections would appear to be more than adequate to compensate for any increase in match probability that we were able to create by this admixture. Linkage is likely to have an appreciable effect on relatedness calculations in short pedigrees in some but not all instances. We examined those circumstances where an effect is likely and give formulae for some common situations. The complexity of these calculations is a cause for concern in some laboratories. We discuss possible strategies that might be employed and plausible effects. PMID:22153980

  13. THE SCHOOL OF AHL AL-SUNNAH WA AL-JAMA`AH AND THE ATTACHMENT OF INDONESIAN MUSLIMS TO ITS DOCTRINES

    Directory of Open Access Journals (Sweden)

    Fauzan Saleh

    2008-06-01

    Full Text Available The doctrine of Ahl al-Sunnah wa al-Jama`ah has been exploited by two major Muslim organizations in Indonesia, NU and Muhammadiyah, as the theological basis in determining their religious identity and rituals. Although these organizations claim that all Muslims should adhere to the doctrines of Ahl al-Sunnah, they have never clearly defined that term. This paper discusses in detail the meaning of the term followed by an examination of the ways in which those two Muslim organizations attach themselves to this doctrine. This paper argues that, although the NU links itself to this doctrine, it is still necessary to critically examine to what extent its members apply the doctrines of Ahl al-Sunnah in their daily life. Muhammadiyah, on the other hand, is not obsessed with the claim of being faithful to the doctrines of Ahl al-Sunnah, although its constitution mentions that they advocate theological creeds which are evidently in line with the precepts of Ahl al-Sunnah.

  14. Adsorption of Rh(III) complexes from chloride solutions obtained by leaching chlorinated spent automotive catalysts on ion-exchange resin Diaion WA21J

    International Nuclear Information System (INIS)

    It was found that Rh, Pd and Pt contained in the spent ceramic automotive catalysts could be effectively extracted by dry chlorination with chlorine. In order to concentrate Rh(III) ions contained in the chloride solutions obtained, thermodynamic and kinetics studies for adsorption of Rh(III) complexes from the chloride solutions on an anionic exchange resin Diaion WA21J were carried out. Rh, Pd, Pt, Al, Fe, Si, Zn and Pb from the chloride solution could be adsorbed on the resin. The distribution coefficients (Kd) of Rh(III) decreased with the increase in initial Rh(III) concentration or in adsorption temperature. The isothermal adsorption of Rh(III) was found to fit Langmuir, Freundlich and Dubinin-Kaganer-Radushkevich models under the adsorption conditions. The maximum monolayer adsorption capacities Qmax based on Langmuir adsorption isotherms were 6.39, 6.61 and 5.81 mg/g for temperatures 18, 28 and 40 deg. C, respectively. The apparent adsorption energy of Rh was about -7.6 kJ/mol and thus Rh(III) adsorption was a physical type. The experimental data obtained could be better simulated by pseudo-first-order kinetic model and the activation energy obtained was 6.54 J/mol. The adsorption rate of Rh(III) was controlled by intraparticle diffusion in most of time of adsorption process.

  15. 1999 BPA habitat projects completed within the Asotin Creek Watershed, WA; Ridge-Top to Ridge-Top Habitat Projects; 1999 BPA Completion Report - January 2000

    International Nuclear Information System (INIS)

    The Asotin Creek Model Watershed Program (ACMWP) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The Asotin Creek watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in WRIA 35. According to WDFW's Priority WRIA's by At-Risk Stock Significance Map, it is the highest priority in southeastern WA. Snake River spring chinook salmon, summer steelhead and bull trout, which are listed under the Endangered Species Act (ESA), are present in the watershed. The ACMWP began coordinating habitat projects in 1995. Approximately two hundred seventy-six projects have been implemented through the ACMWP as of 1999. Twenty of these projects were funded in part through Bonneville Power Administration's 1999 Columbia Basin Fish and Wildlife Program. These projects used a variety of methods to enhance and protect watershed conditions. In-stream work for fish habitat included construction of hard structures (e.g. vortex rock weirs), meander reconstruction, placement of large woody debris (LWD) and whole trees and improvements to off-channel rearing habitat; thirty-eight were created with these structures. Three miles of stream benefited from riparian improvements such as vegetative plantings (17,000 trees and shrubs) and noxious weed control. Two sediment basin constructions, 67 acres of grass seeding, and seven hundred forty-five acres of minimum till were implemented to redes of minimum till were implemented to reduce sediment production and delivery to streams in the watershed

  16. El "Capítulo sobre la conservación de la salud" del Kitáb al-taysir fí l-mudawat wa-l-tadbir de Avenzoar (c. 1095-1162) / The «Chapter on health preservation» in the Kitáb al-taysir fí l-mudawat wa-l-tadbir) by Avenzoar (1095-1162)

    Scientific Electronic Library Online (English)

    Carmen, Peña; Fernando, Girón.

    Full Text Available El Kitab al-tays?r f? l-mudawat wa-l-tadb?r (Libro que simplifica la medicación y la dieta) compuesto en árabe por Avenzoar (c. 1095-1162), no ha sido traducido a ningún idioma occidental moderno, tarea de la que queremos ocuparnos. A modo de primicia, ofrecemos una traducción castellana, anotada y [...] comentada, de su preliminar "Capítulo sobre la conservación de la salud". El libro le fue solicitado por el califa almohade 'Abd al-Mu'min, del que era médico de cámara, para su uso personal. Comienza precisamente con dicho apartado sobre las medidas para prevenir y curar ciertas enfermedades. Le sigue una completa relación de enfermedades desde la cabeza a los pies, que constituye el grueso de la obra. El capítulo traducido es un atípico tratado sobre el tema, no muy extenso, realizado de forma casi aforística, con el que Avenzoar quiso solventar de inmediato el tema preventivo, para dedicarse por entero a la que constituye, sin duda, una de las mejores y más extensas nosografías medievales. Sostenemos su carácter atípico porque nuestro autor no utiliza para ello, exclusivamente, el modelo de las denominadas "cosas no naturales", usual base de las medidas de conservación de la salud. En cambio, hace un amplio empleo de medicamentos simples, usados con fines preventivos, lo que no es nada habitual. Además, entremezcla indistintamente elementos de prevención con otros destinados a la curación. Para la mejor comprensión del texto, previamente a la traducción, se indican las bases sobre las que se asentaba la conservación de la salud en el mundo medieval; las razones de la composición del Kitab al-tays?r fi l-mudawat wa-l-tadb?r, y las características del capítulo en cuestión. Asimismo se examinan las fuentes médicas y el contenido de dicho capítulo.

  17. The Tomato 14-3-3 protein TFT4 modulates H+ efflux, basipetal auxin transport, and the PKS5-J3 pathway in the root growth response to alkaline stress.

    Science.gov (United States)

    Xu, Weifeng; Jia, Liguo; Shi, Weiming; Baluska, Frantisek; Kronzucker, Herbert J; Liang, Jiansheng; Zhang, Jianhua

    2013-12-01

    Alkaline stress is a common environmental stress, in particular in salinized soils. Plant roots respond to a variety of soil stresses by regulating their growth, but the nature of the regulatory pathways engaged in the alkaline stress response (ASR) is not yet understood. Previous studies show that PIN-FORMED2, an auxin (indole-3-acetic acid [IAA]) efflux transporter, PKS5, a protein kinase, and DNAJ HOMOLOG3 (J3), a chaperone, play key roles in root H(+) secretion by regulating plasma membrane (PM) H(+)-ATPases directly or by targeting 14-3-3 proteins. Here, we investigated the expression of all 14-3-3 gene family members (TOMATO 14-3-3 PROTEIN1 [TFT1]-TFT12) in tomato (Solanum lycopersicum) under ASR, showing the involvement of four of them, TFT1, TFT4, TFT6, and TFT7. When these genes were separately introduced into Arabidopsis (Arabidopsis thaliana) and overexpressed, only the growth of TFT4 overexpressors was significantly enhanced when compared with the wild type under stress. H(+) efflux and the activity of PM H(+)-ATPase were significantly enhanced in the root tips of TFT4 overexpressors. Microarray analysis and pharmacological examination of the overexpressor and mutant plants revealed that overexpression of TFT4 maintains primary root elongation by modulating PM H(+)-ATPase-mediated H(+) efflux and basipetal IAA transport in root tips under alkaline stress. TFT4 further plays important roles in the PKS5-J3 signaling pathway. Our study demonstrates that TFT4 acts as a regulator in the integration of H(+) efflux, basipetal IAA transport, and the PKS5-J3 pathway in the ASR of roots and coordinates root apex responses to alkaline stress for the maintenance of primary root elongation. PMID:24134886

  18. Semiempirical analysis of perturbations in the triplet 3s, 3d complex of the hydrogen molecule terms. Relative probabilities of the i3?-g, j3?-g ? c3?+u transitions in H2, HD, and D2

    International Nuclear Information System (INIS)

    A semiempirical analysis is performed of data on electronic vibration-rotation (EVR) levels of mutually perturbed i3?-g and j3?-g states and relative spontaneous emission probabilities for transitions from these states to the c3?u state in H2 and D2 molecules. The expansion coefficients for the perturbed wave functions in the Born-Oppenheimer basis for the H2, HD, and D2 molecules are obtained. Analysis of the isotope effect in the line strength ratios for various branches of the i3?- ? c3?u and j3?g ? c3?u transitions showed that: (1) experimental data (76 values) are adequately described in the framework of the proposed nonadiabatic model with the help of a single variable parameter, namely, the ratio of the electronic dipole moments for these transitions, Mjc/Mic = -1.35±0.05; (2) the dependence of the above parameter on the internuclear distance r can be neglected in the range r = 1.5 - 3.0 a.u.; (3) the electron-rotation coupling of the b3?+u and c3?+u states is not essential at 10% accuracy of the relative line strength measurements. The obtained Mjc/Mic value agrees well with that determined by laser photofragmentation specaser photofragmentation spectroscopy and differs by 20-30% from the ab initio value. 25 refs., 4 figs., 3 tabs

  19. An unedited 1.1 kb mitochondrial orfB gene transcript in the Wild Abortive Cytoplasmic Male Sterility (WA-CMS system of Oryza sativa L. subsp. indica

    Directory of Open Access Journals (Sweden)

    Maiti Mrinal K

    2010-03-01

    Full Text Available Abstract Background The application of hybrid rice technology has significantly increased global rice production during the last three decades. Approximately 90% of the commercially cultivated rice hybrids have been derived through three-line breeding involving the use of WA-CMS lines. It is believed that during the 21st century, hybrid rice technology will make significant contributions to ensure global food security. This study examined the poorly understood molecular basis of the WA-CMS system in rice. Results RFLPs were detected for atp6 and orfB genes in sterile and fertile rice lines, with one copy of each in the mt-genome. The RNA profile was identical in both lines for atp6, but an additional longer orfB transcript was identified in sterile lines. 5' RACE analysis of the long orfB transcript revealed it was 370 bp longer than the normal transcript, with no indication it was chimeric when compared to the genomic DNA sequence. cDNA clones of the longer orfB transcript in sterile lines were sequenced and the transcript was determined unedited. Sterile lines were crossed with the restorer and maintainer lines, and fertile and sterile F1 hybrids were respectively generated. Both hybrids contained two types of orfB transcripts. However, the long transcript underwent editing in the fertile F1 hybrids and remained unedited in the sterile lines. Additionally, the editing of the 1.1 kb orfB transcript co-segregated with fertility restoring alleles in a segregating population of F2 progeny; and the presence of unedited long orfB transcripts was detected in the sterile plants from the F2 segregating population. Conclusion This study helped to assign plausible operative factors responsible for male-sterility in the WA cytoplasm of rice. A new point of departure to dissect the mechanisms governing the CMS-WA system in rice has been identified, which can be applied to further harness the opportunities afforded by hybrid vigor in rice.

  20. Using semi-automated photogrammetry software to generate 3D surfaces from oblique and vertical photographs at Mount St. Helens, WA

    Science.gov (United States)

    Schilling, S.; Diefenbach, A. K.

    2012-12-01

    Photogrammetry has been used to generate contours and Digital Elevation Models (DEMs) to monitor change at Mount St. Helens, WA since the 1980 eruption. We continue to improve techniques to monitor topographic changes within the crater. During the 2004-2008 eruption, 26 DEMs were used to track volume and rates of growth of a lava dome and changes of Crater Glacier. These measurements constrained seismogenic extrusion models and were compared with geodetic deflation volume to constrain magma chamber behavior. We used photogrammetric software to collect irregularly spaced 3D points primarily by hand and, in reasonably flat areas, by automated algorithms, from commercial vertical aerial photographs. These models took days to months to complete and the areal extent of each surface was determined by visual inspection. Later in the eruption, we pioneered the use of different software to generate irregularly spaced 3D points manually from oblique images captured by a hand-held digital camera. In each case, the irregularly spaced points and intervening interpolated points formed regular arrays of cells or DEMs. Calculations using DEMs produced from the hand-held images duplicated volumetric and rate results gleaned from the vertical aerial photographs. This manual point capture technique from oblique hand-held photographs required only a few hours to generate a model over a focused area such as the lava dome, but would have taken perhaps days to capture data over the entire crater. Here, we present results from new photogrammetric software that uses robust image-matching algorithms to produce 3D surfaces automatically after inner, relative, and absolute orientations between overlapping photographs are completed. Measurements using scans of vertical aerial photographs taken August 10, 2005 produced dome volume estimates within two percent of those from a surface generated using the vertical aerial photograph manual method. The new August 10th orientations took less than 8 hours to complete, surface generation took a couple of minutes, and its coverage extends over the entire crater. In addition, preliminary tests of surfaces generated with this software from hand-held oblique images suggest equal speed and accuracy to that achieved from vertical aerial photographs. Oblique hand-held images offer ease of image capture and unobscured views at times when steam plumes and clouds obstruct vertical aerial photography. The possibility of quick camera calibration, image capture, and daily surface generation shifts photogrammetry into the realm of near real-time monitoring and hazard assessment.

  1. Characterization of Sheet Fracture Patterns in Polygonal-Jointed Lavas at Kokostick Butte, OR, and Mazama Ridge, WA: Investigation and Interpretation of Their Formation and Significance

    Science.gov (United States)

    Lodge, R. W.; Lescinsky, D. T.

    2006-12-01

    Polygonal joints in lava flows ("columns") are commonly equant leading to a model of formation associated with cooling in an isotropic stress field. This model, however, does not explain rectangular columns, sheet-like fractures, fractures with crosscutting relationships, and fractures with orientations other than perpendicular to the cooling surface. These fracture patterns are often observed at glaciated volcanoes. The presence of preferential fracture orientations suggests an applied stress component likely due to environmental conditions such as the presence of glaciers or flow dynamics such as down-slope settling or flow margin inflation. During this study we investigated the formation and significance of these non-equant fracture patterns to propose a model for their formation. These `abnormal' fracture patterns have not been discussed in the literature and may be important to better understanding the cooling conditions of such lava flows. To test these possibilities we studied Kokostick Butte dacite flow, OR (near South Sister), and Mazama Ridge andesite flow at Mount Rainier, WA. Both of these flows have well developed sheet-like fractures and display evidence of ice-contact during eruption and emplacement. Sheet fractures are long and continuous fractures that have perpendicular connecting fractures forming rectangular columns. The sheet-like fractures are largely parallel to each other on the exposure surface and the connecting fractures vary locally from primary fractures (associated with cooling toward flow interior) to secondary fractures (associated with cooling by water infiltration). Detailed measurements of fracture orientations and spacing were collected at Kokostick Butte and Mazama Ridge to examine the relationship between the sheet fractures and flow geometry. Preliminary results support this relationship and suggest these patterns likely form due to shear associated with small amounts of flow advance by the rapidly cooling lava. Laboratory studies have been undertaken to complement the field observations and measurements. Starch- water experiments have been proven a useful analogue for lava column formation. Various experimental setups involving different mixture thicknesses and compression of the mixture were utilized to simulate the stresses acting during ponding of lava against glacial ice and to produce different fracture morphologies and patterns. Initial results show that compression of the starch slurry results in non-equant fracture patterns with some sheet-like fracturing present.

  2. Improving spatial concentration estimates for nitrogen oxides using a hybrid meteorological dispersion/land use regression model in Los Angeles, CA and Seattle, WA.

    Science.gov (United States)

    Wilton, Darren; Szpiro, Adam; Gould, Timothy; Larson, Timothy

    2010-02-01

    Predictions from a simple line source dispersion model, Caline3, were included as a covariate in a land use regression (LUR) model for NO(X)/NO(2) in Los Angeles, CA and Seattle, WA. The Caline3 model prediction assumed a unit emission factor for all roadway segments (1.0g/vehicle-mile). The NO(X) and/or NO(2) measurements for LA and Seattle were obtained from a comprehensive measurement campaign that is part of the Multi-Ethnic Study of Atherosclerosis Air Pollution Study (MESA Air). The measurement campaigns in both cities were approximately 2weeks in duration employing approximately 145 measurement sites in Greater LA and 26 sites in Seattle. The best "standard" LUR model (obtained without the inclusion of the Caline3 predictions) in LA had R(2) values of 0.53 for NO(X) and 0.74 for NO(2). The leave-one-out cross-validated R(2) values for NO(X) and NO(2) were 0.45 and 0.71, respectively. The equivalent "standard" NO(2) model for Seattle had an R(2) of 0.72 and a leave-one-out cross-validated R(2) of 0.63. When the Caline3 variable was included in the LA hybrid model, the R(2) values were 0.71 and 0.79 for NO(X) and NO(2), respectively. The corresponding cross-validated R(2) values were 0.66 and 0.77, for NOX and NO2, respectively. In Seattle, the inclusion of the Caline3 variable resulted in a NO(2) model with an R(2) of 0.81 and a corresponding cross-validated R(2) of 0.67. In LA, hybrid model performance was not affected by excluding roadways with annual average daily traffic volumes (AADT)vehicles were modelled as separate terms, the estimated fleet average NO(X) emission factors were 8.9 (SE=0.7) and 0.16 (SE=0.12) grams NO(X)/vehicle mile for heavy-duty and lighter-duty vehicles, respectively. These values are consistent with fleet average emission factors computed for LA with EMFAC 2007. PMID:20006373

  3. Status of WA104/ICARUS

    CERN Document Server

    WA104/ICARUS, Collaboration

    2015-01-01

    The present status of the overhauling operations of the ICARUS T600 detector is reported. The T600 detectors are presently hosted at CERN, in building 185. All cryogenics and purification equipment has also been transported to CERN. The foreseen overhauling operation are proceeding according to the schedule with the expected completion in 2016. The T600 will be then transported to FNAL to start data taking with the Booster and NUMI neutrino beams.

  4. WA7 - View from downstream

    CERN Multimedia

    1977-01-01

    With this set-up the Annecy (LAPP)-CERN-Copenhagen(Niels Bohr Institute)-Genova-Oslo-University College London Collaboration investigated large-angle elastic scattering of charged mesons and antiprotons on protons, first at 20 and 30 GeV/c, later at 50 GeV/c. The beam H1 (from top) passes two CEDAR counters (centre) before entering the one-metre long liquid hydrogen target, partly inside a magnet of 1.56 T, with a field volume of about 1.50x0.75x1.50 m3. In the foreground one sees on the left the hadron calorimeter of the 'slow' arm; on the right, are scintillation hodoscopes and behind them, a treshold Cerenkov counter of the 'fast' arm.

  5. RELAP4/MOD6/U4/J3: a JAERI improved version of RELAP4/MOD6 for transient thermal-hydraulic analysis of LWR including effects of BWR core spray

    International Nuclear Information System (INIS)

    The RELAP4/MOD6/U4/J3 code is the latest version of RELAP4/MOD6/Update4 improved in JAERI. The major improvements and modifications included in this version have been carried out aiming at small break LOCA analysis and BWR-LOCA analysis after core spray initiation. For example, a CCFL calculation model and a spray heat transfer model have been added for BWR-LOCA analysis. Using these models, through calculation from the beginning of blowdown to the end of reflood in BWR-LOCA was made practicable. Furthermore, the analyses of operational transients of LWR were facilitated greatly by an addition of a trip reset function. In this report, the description of the improvements and modifications included in this version, the input data description, and the results of two sample problems are contained. (author)

  6. Search of the signals related to the disoriented chiral condensate in the data of the Pb + Pb reaction at 158 A.GeV from the WA98 experiment

    International Nuclear Information System (INIS)

    We used the multiplicity detectors of the WA98 apparatus for the Disoriented Chiral Condensate search (DDC). We developed a method of event selection based on 2-D wavelet transformation for the search of ?0 or ?+- clusters. We use also this method for the localization and characterization of clusters in terms of position and internal structure. The wavelet transformation singles out the signal at every scale in coefficients of two types: those corresponding to a signal smoothing and the wavelet coefficients sensible to signal density variations in case of a 2 D point distribution. By summing over the squared values of the last ones at every scale one can build the strength spectrum which is flat for a uniform distribution and the coefficients of which are sensible to cluster size. This spectrum was used to select the most structured candidates. The authors intend to extend this study by correlating different analysis scales as well as photons and charged particle clusters

  7. Warm and Dense Molecular Gas in the N159 Region: 12CO J=4-3 and 13CO J=3-2 Observations with NANTEN2 and ASTE

    CERN Document Server

    Mizuno, Yoji; Onishi, Toshikazu; Minamidani, Tetsuhiro; Muller, Erik; Yamamoto, Hiroaki; Hayakawa, Takahiro; Mizuno, Norikazu; Mizuno, Akira; Stutzki, Jurgen; Pineda, Jorge L; Klein, Uli; Bertoldi, Frank; Koo, Bon-Chul; Rubio, Monica; Burton, Michael; Benz, Arnold; Ezawa, Hajime; Yamaguchi, Nobuyuki; Kohno, Kotaro; Hasegawa, Tetsuo; Tatematsu, Ken'ichi; Ikeda, Masafumi; Ott, Jurgen; Wong, Tony; Hughes, Annie; Meixner, Margaret; Indebetouw, Remy; Gordon, Karl D; Whitney, Barbara; Bernard, Jean-Philippe; Fukui, Yasuo

    2009-01-01

    New 12CO J=4-3 and 13CO J=3-2 observations of the N159 region in the Large Magellanic Cloud have been made. The 12CO J=4-3 distribution is separated into three clumps. These new measurements toward the three clumps are used in coupled calculations of molecular rotational excitation and line radiation transfer, along with other transitions of the 12CO as well as the isotope transitions of 13CO. The temperatures and densities are determined to be ~70-80K and ~3x10^3 cm-3 in N159W and N159E and ~30K and ~1.6x10^3 cm-3 in N159S. These results are compared with the star formation activity. The N159E clump is associated with embedded cluster(s) as observed at 24 micron and the derived high temperature is explained as due to the heating by these sources. The N159E clump is likely responsible for a dark lane in a large HII region by the dust extinction. The N159W clump is associated with embedded clusters mainly toward the eastern edge of the clump only. These clusters show offsets of 20"-40" from the 12CO J=4-3 peak...

  8. i Engaging as an innovative approach to engage patients in their own fall prevention care

    OpenAIRE

    Hm, Tzeng; Cy, Yin

    2014-01-01

    Huey-Ming Tzeng,1 Chang-Yi Yin21College of Nursing, Washington State University, Spokane, WA, USA; 2Department of History, Chinese Culture University, Taipei, TaiwanAbstract: Decreasing patient fall injuries during hospitalization continues to be a ­challenge at the bedside. Empowering patients to become active participants in their own fall ­prevention care could be a solution. In a previous study, elderly patients recently discharged from a United States hospital expressed a need fo...

  9. Libby Amphibole Contamination in Tree Bark Surrounding Historical Vermiculite Processing Facilities

    OpenAIRE

    Elashheb, Mohamed I.; Spear, Terry M.; Hart, Julie F.; Webber, James S.; Ward, Tony J.

    2011-01-01

    Over a 70-year period, a mine near Libby, MT supplied nearly 80% of the world’s vermiculite. Raw vermiculite, which was contaminated with naturally occurring amphibole in veins throughout the deposit, was shipped to processing sites throughout the United States for exfoliation. In this pilot study, tree bark samples were collected near processing facilities in Spokane, WA, Santa Ana, CA, Newark, CA, and Phoenix, AZ in an effort to determine if areas surrounding these facilities are today co...

  10. Radioactive waste disposal in W.A

    International Nuclear Information System (INIS)

    Radioactive waste in Western Australia arises primarily from medical diagnosis and treatment and from scientific research mainly with a medical orientation. Waste is classified before disposal depending on its level and type of radioactivity and then disposed of either to municipal land fill sites, to the sewerage system or by incineration. The amounts of radioactive materials which may be disposed of to the sewers and air are set by the Radiation Safety Act (1975) Regulations, and the land fill operations are controlled to ensure isolation of the material. Other waste such as unwanted sources used in industrial applications are stored for future disposal. Discussions are being held between officers of the State and Australian Governments aimed at providing suitable disposal methods for sources of this kind

  11. FIELD SURVEY, CLALLAM COUNTY, WA, USA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  12. DCS Hydraulics Submission for Whatcom County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...

  13. Explanation of IAEA EBP WA1

    International Nuclear Information System (INIS)

    An outline of IAEA/ISSC/EBP activities was given and the relation of this WS to those activities was explained. Deep borehole seismic observation is one of the themes in Work Area 1, and the IAEA conveyed its expectation that this WS would lead to the creation of a supplemental document for seismic hazard evaluation to be included in IAEA guide SSG-9 (Seismic Hazards in Site Evaluation for Nuclear Installations). (author)

  14. Staff exchange with Spokane Intercollegiate Research and Technology Institute (SIRTI), final project report

    Energy Technology Data Exchange (ETDEWEB)

    Alexander, G.M.

    1994-12-01

    Staff exchanges, such as the one described in this report, are intended to facilitate communication and collaboration among scientists and engineers at Department of Energy (DOE) laboratories, in U.S. industry, and academia. Funding support for these exchanges is provided by the DOE, Office of Energy Research, Laboratory Technology Transfer Program. Funding levels for each exchange typically range from $20,000 to $40,000. The exchanges offer the opportunity for the laboratories to transfer technology and expertise to industry, gain a perspective on industry`s problems, and develop the basis for further cooperative efforts through Cooperative Research and Development Agreements (CRADAS) or other mechanisms.

  15. Integrated Ocean and Coastal Mapping (IOCM) Project WA1405: STRAIT OF JUAN DE FUCA, WA.

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of Integrated Ocean and Coastal Mapping (IOCM) is to improve the coordination among federal, state and local government, non-governmental and private...

  16. Integrated Ocean and Coastal Mapping (IOCM) Project WA1002: PUDGET SOUND - WHIDBEY ISLAND, WA.

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of Integrated Ocean and Coastal Mapping (IOCM) is to improve the coordination among federal, state and local government, non-governmental and private...

  17. Integrated Ocean and Coastal Mapping (IOCM) Project WA1406: OLYMPIA, WA.

    National Oceanic and Atmospheric Administration, Department of Commerce — The objective of Integrated Ocean and Coastal Mapping (IOCM) is to improve the coordination among federal, state and local government, non-governmental and private...

  18. Criminal Victimization And Perceptions Of Community Safety In 12 Cities, 1998

    Science.gov (United States)

    This report, recently released by the Bureau of Justice Statistics, provides city-level survey data on crime victimization in twelve US cities: Chicago, IL; Kansas City, MO; Knoxville, TN; Los Angeles, CA; Madison, WI; New York, NY; San Diego, CA; Savannah, GA; Spokane, WA; Springfield, MA; Tucson, AZ; and Washington, DC. The report presents data on community policing, the rates at which residents are victimized by crime, citizens' perceptions of crimes and their attitudes toward their community and local law enforcement agencies. The report is available in .pdf or ASCII format. Users may also download a compressed file (.zip) containing all the survey data spreadsheets (.wk1).

  19. Incremental Risks of Transporting NARM to the LLW Disposal Facility at Hanford

    Energy Technology Data Exchange (ETDEWEB)

    Weiner, R.F.

    1999-02-23

    This study models the incremental radiological risk of transporting NARM to the Hanford commercial LLW facility, both for incident-free transportation and for possible transportation accidents, compared with the radiological risk of transporting LLW to that facility. Transportation routes are modeled using HIGHWAY 3.1 and risks are modeled using RADTRAN 4. Both annual population doses and risks, and annual average individual doses and risks are reported. Three routes to the Hanford site were modeled from Albany, OR, from Coeur d'Alene, ID (called the Spokane route), and from Seattle, WA. Conservative estimates are used in the RADTRAN inputs, and RADTRAN itself is conservative.

  20. Refrigeration and Cryogenics Specialist. J3ABR54530

    Science.gov (United States)

    Air Force Training Command, Sheppard AFB, TX.

    This document package contains an Air Force course used to train refrigeration and cryogenics specialists. The course is organized in six blocks designed for group instruction. The blocks cover the following topics: electrical principles; fundamentals of tubing and piping; metering devices, motor controls, domestic and commercial refrigeration;…

  1. Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams; 2002-2003 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Jason M. (Kalispel Tribe of Indians, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife); Butler, Chris (Spokane Tribe of Indians, Wellpinit, WA)

    2006-02-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  2. Resident Fish Stock above Chief Joseph and Grand Coulee Dams; 2003-2004 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Jason M. (Kalispel Tribe of Indians, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife, Olympia, WA); Butler, Chris (Spokane Tribe of Indians, Wellpinit, WA)

    2005-11-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial and native fish assemblages in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. The project began addressing identified data gaps throughout the Blocked Area in 1999. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, Spokane River below Spokane Falls, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002 and 2003. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  3. Al-Isl?m wa al-q?n?n wa al-dawlah: Dir?sah f? fikri Ki Bagus Hadikusumo wa dawrihi

    Directory of Open Access Journals (Sweden)

    Sudarnoto Abdul Hakim

    2014-07-01

    Full Text Available This article discusses the intellectual and political biography of Ki Bagus Hadikusumo, a prominent Muslim leader in Indonesia. He was born in Yogyakarta where he grew up  in a Muslim priyayi family of Kauman in the city. This study explains that the Sufi tradition of Pesantren Wonokromo in Yogyakarta deeply influenced his religious thoughts. Later, he was noted as one of the first students of K.H. Ahmad Dahlan, the founder of Muhammadiyah. It is clear that he was under a strong intellectual, ideological and religious influence of Dahlan. He published works on Islamic theology, Fiqh, Sufism, and also on Islam and state. During the Japanese occupation, he  became the Chairman of Muhammadiyah organization . Ki Bagus was also known as a prominent leader of political parties, i.e. PII, MIAI, Masyumi and then a prominent member of BPUPKI, an important element of Indonesian independence in 1945. Representing a nationalist-Islamist wing, he greatly contributed to the politics of early modern Indonesia by (1 preparing  the Indonesian constitution, and (2 providing solid arguments for Muslims to accept Pancasila as the nation’s state ideology.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v21i1.881

  4. Factors regulating excystment of Alexandrium in Puget Sound, WA, USA

    Science.gov (United States)

    Moore, Stephanie K.; Bill, Brian D.; Hay, Levi R.; Emenegger, Jennifer; Eldred, Kiara C.; Greengrove, Cheryl L.; Masura, Julie E.; Anderson, Donald M.

    2015-01-01

    Factors regulating excystment of a toxic dinoflagellate in the genus Alexandrium were investigated in cysts from Puget Sound, Washington State, USA. Experiments were carried out in the laboratory using cysts collected from benthic seedbeds to determine if excystment is controlled by internal or environmental factors. The results suggest that the timing of germination is not tightly controlled by an endogenous clock, though there is a suggestion of a cyclical pattern. This was explored using cysts that had been stored under cold (4 °C), anoxic conditions in the dark and then incubated for 6 weeks at constant favorable environmental conditions. Excystment occurred during all months of the year, with variable excystment success ranging from 31–90%. When cysts were isolated directly from freshly collected sediments every month and incubated at the in situ bottom water temperature, a seasonal pattern in excystment was observed that was independent of temperature. This pattern may be consistent with secondary dormancy, an externally modulated pattern that prevents excystment during periods that are not favorable for sustained vegetative growth. However, observation over more annual cycles is required and the duration of the mandatory dormancy period of these cysts must be determined before the seasonality of germination can be fully characterized in Alexandrium from Puget Sound. Both temperature and light were found to be important environmental factors regulating excystment, with the highest rates of excystment observed for the warmest temperature treatment (20 °C) and in the light.

  5. Geological Structures in the WaIls of Vestan Craters

    Science.gov (United States)

    Mittlefehldt, David; Nathues, A.; Beck, A. W.; Hoffmann, M.; Schaefer, M.; Williams, D. A.

    2014-01-01

    A compelling case can be made that Vesta is the parent asteroid for the howardite, eucrite and diogenite (HED) meteorites [1], although this interpretation has been questioned [2]. Generalized models for the structure of the crust of Vesta have been developed based on petrologic studies of basaltic eucrites, cumulate eucrites and diogenites. These models use inferred cooling rates for different types of HEDs and compositional variations within the clan to posit that the lower crust is dominantly diogenitic in character, cumulate eucrites occur deep in the upper crust, and basaltic eucrites dominate the higher levels of the upper crust [3-5]. These models lack fine-scale resolution and thus do not allow for detailed predictions of crustal structure. Geophysical models predict dike and sill intrusions ought to be present, but their widths may be quite small [6]. The northern hemisphere of Vesta is heavily cratered, and the southern hemisphere is dominated by two 400-500 km diameter basins that excavated deep into the crust [7-8]. Physical modeling of regolith formation on 300 km diameter asteroids predicts that debris layers would reach a few km in thickness, while on asteroids of Vesta's diameter regolith thicknesses would be less [9]. This agrees well with the estimated =1 km thickness of local debris excavated by a 45 km diameter vestan crater [10]. Large craters and basins may have punched through the regolith/megaregolith and exposed primary vestan crustal structures. We will use Dawn Framing Camera (FC) [11] images and color ratio maps from the High Altitude and Low Altitude Mapping Orbits (HAMO, 65 m/pixel; LAMO, 20 m/pixel) to evaluate structures exposed on the walls of craters: two examples are discussed here.

  6. 75 FR 34154 - Ridgefield National Wildlife Refuge, Clark County, WA

    Science.gov (United States)

    2010-06-16

    ...area. The 4.3-mile auto tour route would remain open year...complete habitat assessments to guide restoration of streams and tidally...developed. The existing auto tour route would be open year round...expansion. The existing auto tour route would remain...

  7. 78 FR 76750 - Drawbridge Operation Regulation; Chambers Creek, Steilacoom, WA

    Science.gov (United States)

    2013-12-19

    ...Drawbridge Operation Regulation...Chambers Creek Railway Bridge across...Positive Train Control requirements...Manager, Docket Operations, telephone 202-366-9826...Chambers Creek Railway Bridge across...The normal operation schedule falls...Positive Train Control...

  8. 77 FR 54805 - Revocation of Jet Route J-528; WA

    Science.gov (United States)

    2012-09-06

    ...serve a useful navigation or air traffic control purpose and is causing flight plan rejections in the air traffic control automation system. DATES...within Canada. The current FAA air traffic control automation system does...

  9. Net Anthropogenic Nitrogen Inputs in the Seattle, WA Metropolitan Area

    Science.gov (United States)

    Larson, E. K.; Alberti, M.

    2014-12-01

    Nitrogen loading has been identified as a potential stressor to marine ecosystems of the Puget Sound in the Pacific Northwest, and the Washington State Department of Ecology has estimated that anthropogenic sources of dissolved inorganic nitrogen to the Sound are 2.7 times higher than natural loads (Mohamedali et al. 2011). The Seattle urban area, situated in the southeast of the Sound, has the largest population in the northwestern US. Heavily urbanized along the coast, the 4 counties comprising the region (Snohomish, King, Pierce, and Kitsap) also include forests and agriculture. Urban and agricultural areas tend to have substantial anthropogenic N loading due to fertilizer application, presence of N-fixing vegetation, N atmospheric deposition, and human and other animal waste. To determine the relative contribution of urban vs. rural agricultural activities to N loads from the Seattle region to the Puget Sound, we used the Net Anthropogenic Nitrogen Inputs (NANI) calculator developed by Hong et al. (2011) for the watersheds of this region. The NANI calculator uses nationally available datasets to calculate NANI as the sum of oxidized N deposition, fertilizer application, agricultural N fixation, net food and feed inputs, and net animal and human N consumption. We found that NANI ranged from approximately 100 to 1500 kg m-2 y-1, with some of the highest rates in watersheds with high impervious surface or agricultural areas with N-fixing crops or large fertilizer additions. Many of the agricultural watersheds have intervening low-NANI watershed between themselves and the coast, thus it is likely that agricultural NANI is attenuated before entering the Puget Sound. The urban areas in the region do not have these attenuating watersheds, and so are likely to be the main contributor to the observed total aquatic N yield. This information is helpful for developing policies to reduce N loading to the Sound.

  10. 78 FR 16713 - Board Meeting; April 16, 2013; Richland, WA

    Science.gov (United States)

    2013-03-18

    ...Office of Environmental Management will precede a discussion...complex-wide waste management practice. A series...will be on DOE's Strategy for the Management and Disposal of Used...information on lodging or logistics, contact Linda...

  11. 75 FR 37294 - Modification of Class E Airspace; Kelso, WA

    Science.gov (United States)

    2010-06-29

    ...No. 09-ANM-20] Modification of Class E Airspace...from 700 feet above the surface, at Southwest Washington...feet or more above the surface of the earth...from 700 feet above the surface within a 6.4-mile...side of the 290[deg] bearing of the airport...

  12. 77 FR 68068 - Modification of Class E Airspace; Pullman, WA

    Science.gov (United States)

    2012-11-15

    ...from 700 feet above the surface within a 10-mile radius...Regional Airport 229[deg] bearing extending from the 10-mile...Regional Airport 064[deg] bearing of the airport to the...Regional Airport 066[deg] bearing of the airport; thence...200 feet above the surface bounded by a line...

  13. (EDMUNDS, WA) WILDLAND FIRE EMISSIONS MODELING: INTEGRATING BLUESKY AND SMOKE

    Science.gov (United States)

    This presentation is a status update of the BlueSky emissions modeling system. BlueSky-EM has been coupled with the Sparse Matrix Operational Kernel Emissions (SMOKE) system, and is now available as a tool for estimating emissions from wildland fires...

  14. Hiperhomocysteinemia - wa?ny czynnik ryzyka choroby niedokrwiennej serca

    Directory of Open Access Journals (Sweden)

    Krzysztof Chi?y?ski

    2002-06-01

    Full Text Available Hiperhomocysteinemi? traktuje si? obecnie jako niezale?ny czynnik rY7-^^ choroby niedokrwiennej serca. Mechanizm pro mia?d?ycowego dzia?ania homocysteiny to zarówno bezpo?rednie uszkadzanie ?ródb?onka naczyniowego przez grup? sulfhydrylow?, jak i u?atwianie syntezy nadtlenku wodoru w komórkach ?ródb?onka i produkcja wolnych rodników przyspieszaj?ce procesy mia?d?ycowe. Inne mechanizmy to hamowanie syntezy prostacykliny, zwi?kszona agregacja i adhezja p?ytek do ?cian uszkodzonych naczy? i aktywacja licznych czynników krzepni?cia. St??enie homocysteiny w surowicy zale?y od aktywno?ci wielu enzymów. Kluczow? rol? odgrywaj? dwa z nich: |3-syntaza cystationinowa (CBS oraz reduktaza metylenotetrahydrofolia-nowa (MTHFR. CBS jest jednym z enzymów na szlaku przemiany metioniny w cystein?, natomiast MTHFR katalizuje konwersj? 5,10-metylotetrahydrofolianu do 5-metylotetrahydrofolianu, który jest g?ównym donorem reszt metylowych w reakcji remetylacji homocysteiny do metioniny. Kofaktorami dla tych enzymów s? witaminy B6 i B12 oraz kwas foliowy. Mutacja genu reduktazy 5,10-metyltetrahydrofolianu (substytucja C—>1 w pozycji 677 powoduje zamian? alaniny na walin? i zmniejsza aktywno?? reduktazy 5,10-metyltetra-hydrofolianu, co wi??e si? ze wzrostem st??enia homocysteiny w osoczu oraz zwi?kszonym ryzykiem choroby wie?cowej i zawa?u mi??nia sercowego. Wyst?puj? 3 ró?ne genotypy: homozygoty TT i CC i heterozy-goty CT. Wyst?powanie allela T jest zwi?zane z wyst?powaniem hiperhomocysteinemii. Wwielu badaniach wykazano zwi?zek polimorfizmu C677T z chorob? niedokrwienn? serca a genotyp TT uznano za czynnik ryzyka choroby niedokrwiennej serca. Wyst?pienie defektu w genach cz?sto nie jest czynnikiem wystarczaj?cym do wyzwolenia hiperhomocysteinemii. Wzrost poziomu homocysteiny mo?e by? spowodowany: niew?a?ciw? diet? (niedostateczna poda?: kwasu foliowego i(lub witamin B6 i B12, farmakoterapia (stosowanie antagonistów kwasu foliowego np. metotreksatu, antagonistów witaminy B6 lub B12, fenytoiny, antykoncepcja lub leczenie hormonalne zaburzenia endokrynologiczne, niewydolno?? nerek, palenie tytoniu, nadu?ywanie alkoholu. Wyst?powanie umiarkowanej hiperhomocysteinemii w ogólnej populacji zosta?o oszacowane na 5-10%. Wykazano zwi?zek wysokich st??e? homocysteiny z angiograficznie potwierdzon? chorob? wie?cow? i zawa?em serca. Podwy?szony poziom homocysteiny u pacjentów z chorob? niedokrwienn? serca potwierdzon? w koronarografii uwa?any jest za niezale?ny czynnik zagro?enia zgonem sercowym.

  15. Badania sily termoelektrycznej ?eliwnych wa?ków rozrz?du

    Directory of Open Access Journals (Sweden)

    W. Or?owicz

    2008-03-01

    Full Text Available W pracy pr7cdstawiono ynilii badah 2eEiwnych walkbw rozrzqdu silnika spalinowcgo z krzywkami utwardzonymi rnctoda odlewniczq.Na przckrqiu poprxcznym knywcb occniono rnikros~rukturq, trvardoSt, oraz zvaltoSC sil y clcktrorermiczncj

  16. DCS Survey Submission for Unincorporated Pierce County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  17. Kilohoku - Ho‘okele Wa‘a: Hawaiian Navigational Astronomy

    Science.gov (United States)

    Dye, Ahia; Ha'o, Celeste; Slater, Timothy F.; Slater, Stephanie

    2015-01-01

    Over thousands of years of Pacific Basin settlement, Polynesians developed a complex, scientific understanding of the cosmos, including a generative view of the celestial sphere. Memorizing the location and spatial relationships of hundreds of stars, across changing latitudes, this astronomy was one of the four scientific knowledge bases Polynesians used to navigate thousands of miles, across open water, without instrumentation. After Western colonization, this large body of knowledge was nearly lost to Hawaiians. Since the Hawaiian Renaissance, much of this knowledge has been reconstructed, and is again in use in open oceanic navigation. While some of this knowledge has been shared with the broader public, much of what we know has been unavailable to those beyond the family of navigators. This paper represents an attempt to begin sharing this catalog of knowledge with the outside world, with the hopes that the larger community will appreciate the complexity of astronomical knowledge possessed by navigators, and that the international body of astronomy historians will help insure that this knowledge will not be lost again. This paper will present, Na ´Ohanah?k?, the Hawaiian star families that divide the celestial sphere into four wedges, running from the circumpolar north, beyond the horizon to the south. Na Hoku Huihui, or Hawaiian constellations will be discussed, in addition to a brief introduction to the setting and rising pairs that are used to determine direction and latitude.

  18. 77 FR 24146 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2012-04-23

    ...maintenance of the train signaling system scheduled for April...maintenance of the train signaling system. BNSF will be ``cutting over'' the train signaling system to a new system...bridge's operational status via the Coast Guard...

  19. 78 FR 15293 - Drawbridge Operation Regulations; Columbia River, Vancouver, WA

    Science.gov (United States)

    2013-03-11

    ...temporary deviation, call or email Randall Overton, Bridge Administrator, Coast Guard Thirteenth...206-220-7282, email Randall.D.Overton@uscg.mil. If you have questions on...Dated: February 27, 2013. Randall D. Overton, Bridge Administrator. [FR Doc....

  20. 77 FR 38004 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2012-06-26

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: June 13, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-15543 Filed...

  1. 77 FR 53141 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2012-08-31

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: August 21, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-21535 Filed...

  2. 77 FR 66714 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2012-11-07

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: October 29, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-27251 Filed...

  3. 78 FR 3836 - Drawbridge Operation Regulation; Snohomish River, Everett, WA

    Science.gov (United States)

    2013-01-17

    ...District; telephone 206-220-7282, email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: January 7, 2013. Randall D. Overton, Bridge Administrator, Thirteenth Coast Guard...

  4. 77 FR 37317 - Drawbridge Operation Regulation; Lake Washington, Seattle, WA

    Science.gov (United States)

    2012-06-21

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: June 8, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-15191 Filed...

  5. 78 FR 23487 - Drawbridge Operation Regulation; Columbia River, Vancouver, WA

    Science.gov (United States)

    2013-04-19

    ...temporary deviation, call or email Randall Overton, Bridge Administrator, Coast Guard Thirteenth...206-220-7282, email Randall.D.Overton@uscg.mil. If you have questions on...Dated: April 9, 2013. Randall D. Overton, Bridge Administrator. [FR Doc....

  6. 78 FR 18478 - Drawbridge Operation Regulations; Snohomish River, Everett, WA

    Science.gov (United States)

    2013-03-27

    ...temporary deviation, call or email Randall Overton, Coast Guard Thirteenth District, Bridge...206-220-7282, email Randall.D.Overton@uscg.mil. If you have questions on...Dated: March 14, 2013. Randall D. Overton, Bridge Administrator, Thirteenth...

  7. 77 FR 12514 - Drawbridge Operation Regulation; Hood Canal, WA

    Science.gov (United States)

    2012-03-01

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing or submitting...provisions or options for compliance, please contact Randall Overton, Coast Guard Bridge Administrator, 13th Coast Guard...

  8. 76 FR 65945 - Modification of Class B Airspace; Seattle, WA

    Science.gov (United States)

    2011-10-25

    ...commenters suggested changes to accommodate paragliding and hang gliding operations at Tiger...activity, or creating a cutout for the paragliding and hang gliding operations. Another...impose costs. The areas of interest for paragliding/hang gliding are the landing...

  9. Resident Fish Stock above Chief Joseph and Grand Coulee Dams; 2002 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Jason M. (Kalispel Department of Natural Resources, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife, Spokane, WA); Butler, Chris (Spokane Tribe of Indians, Department of Natural Resources, Wellpinit, WA)

    2003-09-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power and Conservation Council (NPCC), formerly the Northwest Power Planning Council. The NPCC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPCC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial fish assemblages and native fish in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area. The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. In 1999, 2000, and 2001 the project began addressing some of the identified data gaps throughout the Blocked Area. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of streams and lakes on the Spokane Indian Reservation were completed by 2001. Assessments of the Little Spokane River and its tributaries, tributaries to the Pend Oreille River, small lakes in Pend Oreille County, WA, and water bodies within and near the Spokane Indian Reservation were conducted in 2002. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  10. Association between Depressive Symptoms and Metabolic Syndrome in Police Officers: Results from Two Cross-Sectional Studies

    International Nuclear Information System (INIS)

    Policing is one of the most dangerous and stressful occupations and such stress can have deleterious effects on health. The purpose of this study was to examine the association between depressive symptoms and metabolic syndrome (Met Syn) in male and female police officers from two study populations, Buffalo, NY and Spokane, WA. Depressive symptoms were measured using the Center for Epidemiologic Studies-Depression (CES-D) scale. Met Syn was defined using the 2005 AHA/NHBLI guidelines. Analysis of covariance was used to describe differences in number of Met Syn components across depressive symptom categories. The number of Met Syn components increased significantly across categories of CES-D for Spokane men only (p-trend = 0.003). For each 5-unit increase in CES-D score, odds increased by 47.6% for having hypertriglyceridemia, by 51.8% for having hypertension, and by 56.7% for having glucose intolerance. Exploring this association is important since both are predictors of future chronic health problems and the results could be helpful in developing future gender-specific prevention and intervention efforts among police officers

  11. A thick homogeneous vegetated cover design proves cost - and schedule-effective for the reclamation of uranium mills sites near Spokane, Washington

    Energy Technology Data Exchange (ETDEWEB)

    Blacklaw, J.; Robertson, G.; Stoffel, D.; Ahmad, J.; Fordham, E. [Washington State Dept. of Health, Olympia, WA (United States)] [and others

    1997-08-01

    The Washington State Department of Health (WDOH) has licensed two medium sized uranium mills with tailings impoundments covering 28 and 40 hectares (70 and 100 acres), respectively, The uranium mill licensees have submitted closure and reclamation plans to the state, and site-specific conditions have determined the closure design features, Conventional uranium mill cover designs usually incorporate an overall cap of one to three meters, which includes a low-permeability clay barrier layer. A technical evaluation of several uranium mill facilities that used this design was published in the fall of 1994 and reported that unexpected vegetation root damage had occurred in the low-permeability clay (or bentonite amended) barrier layers. The technical report suggested that the low-permeability design feature at some sites could be compromised within a very short time and the regulatory goal of 1,000 years performance might not be achieved. In October 1994, WDOH sponsored a technical forum meeting to consider design alternatives to address these reliability concerns. Representatives from the federal government, nuclear industry, licensees, engineering firms, and state regulatory agencies attended the workshop. Risk factors considered in the evaluation of the uranium mill reclamation plans include: (1) radon gas emanation through the cover (the air pathway), and (2) migration of hazardous and/or radioactive constituents (the groundwater pathway). Additional design considerations include site structural stability, longevity of 1,000 years, and no active (ongoing) maintenance. 9 refs.

  12. Wa re o Bona e Hlotša, wa e Nametša Thaba! Bibele, Basadi ba Maafrika ba Afrika-Borwa le HIV le AIDS

    OpenAIRE

    Madipoane Masenya(ngwan’a Mphahlele)

    2010-01-01

    The question of the history of the reception of the Christian Bible in South Africa particularly by African- South Africans has not been a smooth ride. It was part of a bigger package that included among others, the importation of European patriarchy onto African soil, the land grabbing exercise which resulted in among others, the impoverishment of African peoples and, the emasculation of the African man. The latter in turn led to the intensification of patriarchy within the average African f...

  13. Luba folklore and women's ethno-gendered discourse of wifehoodin “Cintu Wa Bujitu”

    OpenAIRE

    Mulamba, Nshindi-Germain

    2013-01-01

    This paper investigates Lubà-kasààyi folklore, particularly a folk song, in order to reveal an ethno-gendered construction of wifehood. It aims to show girls’ socialization into a sexist and patriarchal discourse and how such a practice ideologically initiates them into their future subservient role of caterers for the husbands’ alimentation needs. Moreover, folklore seems to perpetuate traditions, and so the gender inequality inscribed within them, a situation that is particularly apparent i...

  14. Yeast Interacting Proteins Database: YCL019W, YDR261W-A [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YCL019W - Retrotransposon TYA Gag and TYB Pol genes ; transcribed/translated as one unit; polypro ... se (PR), and integrase (IN); similar to retroviral genes ... Rows with this bait as bait (2) Rows with this bai ... it description Retrotransposon TYA Gag and TYB Pol genes ; transcribed/translated as one unit; polyprotein i ... se (PR), and integrase (IN); similar to retroviral genes ... Rows with this bait as bait Rows with this bait as ...

  15. Syed Abdul Malik: Hayatuhu wa A’amaluhu Syed Abdul Malik: His Life and Works

    Directory of Open Access Journals (Sweden)

    Mahbubur Rahman

    2013-10-01

    Full Text Available Syed Abdul Malik (1919-2000 was an uncrowned emperor of Assamese literature. He started his literary career in the early forties and enriched Assamese literature with short stories, novels, poetry and other writings spanning over five decades. In terms of statistics of fictional work, Syed Abdul Malik was unrivalled. No other writer has contributed so extensively towards the growth of Assamese literature as he did. Malik’s contribution to Assamese literature, particularly in the sphere of novel and short story, is indeed noteworthy. He is a distinguished writer among the fiction writes of the pre as well as post world war period who have successfully depicted the problems of man and the society.

  16. 75 FR 32855 - Safety Zone; Pierce County, WA, Department of Emergency Management, Regional Water Exercise

    Science.gov (United States)

    2010-06-10

    ...Emergency Management, Regional Water Exercise AGENCY: Coast Guard, DHS. ACTION...is sponsoring a Regional Water Rescue Exercise in the waters of East Passage near Browns...from passing within 900 yards of the exercise area, and restricting deep draft...

  17. 76 FR 9047 - Ridgefield National Wildlife Refuge, Clark County, WA; Final Comprehensive Conservation Plan and...

    Science.gov (United States)

    2011-02-16

    ...current 4.3-mile auto tour route would remain open...habitat assessments to guide stream and tidally influenced...developed. The current auto tour route would be open year...habitat assessments to guide stream and tidally influenced...developed. The existing auto tour route will be open...

  18. Jihad, Da'wa and Hijra: Islamic Missionary Movements in Europe

    OpenAIRE

    Gugler, Thomas K.

    2009-01-01

    Revised version of a lecture held at the conference "Islamic Fundamentalism and Sufism: Continuities and Confrontations through Modernity and Globalization" at the University of Haifa from July 1-4, 2007. The new Islamic presence in Europe, which is the consequence of massive and voluntary settlement of millions of Muslims in Western societies, owes its visibility partly to the Muslim missionary movements from South, which have proven specific strengths in shaping the Islamic-religious fields...

  19. Water Accounting Plus (WA+) – a water accounting procedure for complex river basins based on satellite measurements

    OpenAIRE

    Molden, D.; W. G. M. Bastiaanssen; Karimi, P.

    2012-01-01

    Coping with the issue of water scarcity and growing competition for water among different sectors requires proper water management strategies and decision processes. A pre-requisite is a clear understanding of the basin hydrological processes, manageable and unmanageable water flows, the interaction with land use and opportunities to mitigate the negative effects and increase the benefits of water depletion on society. Currently, water professionals do not have a common framework that lin...

  20. Recent results on prompt gamma physics from experiment WA70 at the CERN SPS

    International Nuclear Information System (INIS)

    This paper reports on the production of direct photons which offers a good testing ground for hadron constituent dynamics in high pT collisions. The calculation of inclusive cross sections requires as input only the theoretical sub-process cross sections and the measured parton structure functions (S.F.): no fragmentation functions are required. To first order the Born terms responsible for the process are: the annihilation graph q bar q ? ?g (important in ?-p ? ?X, at large XT) and the QCD Compton graph qg ? ?q (dominant in ?+ (p)p ? ?X reactions). Having a gluon in the initial or final state, prompt gamma physics may be used to study gluon phenomenology (both S.F. and fragmentation functions). Next-to-leading-log corrections to the Born terms, which are large, have been calculated. The main experimental drawbacks using direct gammas as parton level probes are associated with the presence of large backgrounds from the decays of neutral mesons or the bremsstrahlung of high energy muons, accompanying the beam particles and the requirement to control the energy scale of the calorimeters used to detect prompt gammas at a level better than 1%

  1. Decontamination and decommissioning assessment for the Waste Incineration Facility (Building 232-Z) Hanford Site, [Hanford], WA

    International Nuclear Information System (INIS)

    Building 232-Z is an element of the Plutonium Finishing Plant (PFP) located in the 200 West Area of the Hanford Site. From 1961 until 1972, plutonium-bearing combustible materials were incinerated in the building. Between 1972 and 1983, following shutdown of the incinerator, the facility was used for waste segregation activities. The facility was placed in retired inactive status in 1984 and classified as a Limited Control Facility pursuant to DOE Order 5480.5, Safety of Nuclear Facilities, and 6430.1A, General Design Criteria. The current plutonium inventory within the building is estimated to be approximately 848 grams, the majority of which is retained within the process hood ventilation system. As a contaminated retired facility, Building 232-Z is included in the DOE Surplus Facility Management Program. The objective of this Decontamination and Decommissioning (D ampersand D) assessment is to remove Building 232-Z, thereby elmininating the radiological and environmental hazards associated with the plutonium inventory within the structure. The steps to accomplish the plan objectives are: (1) identifying the locations of the most significant amounts of plutonium, (2) removing residual plutonium, (3) removing and decontaminating remaining building equipment, (4) dismantling the remaining structure, and (5) closing out the project

  2. Bird Activity Analysis Using Avian Radar Information in Naval Air Station airport, WA

    Science.gov (United States)

    Wang, J.; Herricks, E.

    2010-12-01

    The number of bird strikes on aircraft has increased sharply over recent years and airport bird hazard management has gained increasing attention in wildlife management and control. Evaluation of bird activity near airport is very critical to analyze the hazard of bird strikes. Traditional methods for bird activity analysis using visual counting provide a direct approach to bird hazard assessment. However this approach is limited to daylight and good visual conditions. Radar has been proven to be a useful and effective tool for bird detection and movement analysis. Radar eliminates observation bias and supports consistent data collection for bird activity analysis and hazard management. In this study bird activity data from the Naval Air Station Whidbey Island was collected by Accipiter Avian Radar System. Radar data was pre-processed by filtering out non-bird noises, including traffic vehicle, aircraft, insects, wind, rainfall, ocean waves and so on. Filtered data is then statistically analyzed using MATLAB programs. The results indicated bird movement dynamics in target areas near the airport, which includes (1) the daily activity varied at dawn and dusk; (2) bird activity varied by target area due to the habitat difference; and (3) both temporal and spatial movement patterns varied by bird species. This bird activity analysis supports bird hazard evaluation and related analysis and modeling to provide very useful information in airport bird hazard management planning.

  3. Sediment Transport Modeling Along the Gravel-Sand Transition Zone of the Snohomish River, WA

    Science.gov (United States)

    DeVries, P.; Huang, C.; Aldrich, R.

    2014-12-01

    Long term sediment trapping efficiency was modeled for 1000-2000 ft long analysis segments of the tidally influenced, diked Snohomish River, upstream, along, and downstream of the ~3.5 mile long gravel-sand transition zone. A depth-averaged 2-dimensional hydrodynamic model was calibrated to a recent flood with a ~25 year recurrence interval, and the output used to extract parameters used to estimate shear stress over a range of high flows. Shear stress was estimated using (i) a roughness relation and (ii) the uniform flow approximation. Riverbed grain size distributions were estimated using pebble counts upstream, and Ponar grab samples within and downstream of the transition zone. Four different gravel and sand transport equations (Engelund-Hansen, Ackers-White, Wilcock-Crowe, and Yang) were applied to estimate transport rates at each flow level analyzed. The resulting rates were integrated over a 50 year period to compute total load entering and exiting each analysis segment to evaluate long term trends in bed elevation profiles. Results were sensitive to the choice of shear stress and bedload transport estimator with most method-dependent variation in trends apparent for segments within the transition zone.

  4. 77 FR 66479 - Public Land Order No. 7805; Extension of Public Land Order No. 6952; WA

    Science.gov (United States)

    2012-11-05

    ...is necessary to continue protection of the tree improvement and forest research activities of the Peony...under the United States mining laws, but not from leasing under the mineral leasing laws, to protect the Peony, Pole Pick,...

  5. Options To Cleanup Site-wide Vadose Zone Contamination At The Hanford Site, WA, State

    International Nuclear Information System (INIS)

    The U.S. Department of Energy (DOE) Hanford Site in south central Washington State lies along the Columbia River and is one of DOE's largest legacy waste management sites. Enormous radionuclide and chemical inventories exist below-ground. These include Resource Conservation and Recovery Act (RCRA) storage facilities where hazardous and radioactive contaminants were discharged and leaked to the soil surface and to the deep vadose zone and groundwater. The vadose zone is also contaminated from facilities regulated by the RCRA and Comprehensive Environmental Response Compensation and Liability Act (CERCLA) Act. Hanford now contains as much as 28,300 cubic meters of soil contaminated with radionuclides from liquid wastes released near processing facilities. The Hanford Federal Facility Agreement and Consent Order, Tri-Party Agreement (TPA) has set the completion of the cleanup of these sites by 2024. There are numerous technical and regulatory challenges to cleanup of the vadose zone at the Hanford site. This paper attempts to identify the categories of deep vadose zone problem and identifies a few possible regulatory options to clean up the site under the mix of state and federal regulatory authorities. There are four major categories of vadose contamination areas at the Hanford Site. The first is laterally extensive with intermediate depth (ground surface to about 45 meters depth) mostly related to high volume effluent discharge into cribs, ponds and ditches of designat into cribs, ponds and ditches of designated CERCLA facilities. The second is dominated by laterally less extensive mostly related to leaks from RCRA tank farms. The later contamination is often commingled at depth with wastes from adjacent CERCLA facilities. The third category is from the high volume CERCLA facilities extending from the surface to more than 60 meters below ground. Contamination from the later category crosses the entire thickness of the vadose zone and reached groundwater. The fourth category is the lower volume waste sites. There are multiple management options to clean up the above four categories of vadose zones sites. The following are some of the options considered for detailed evaluation: - Maintain separate decision processes for each RCRA and CERCLA units/waste sites with a more accommodating schedule. - Create new vadose zone operable units with limited geographical boundaries regardless of site category/origin and make an integrated decision. - Expand the existing CERCLA groundwater operable units to include the deep vadose zone - Use a combination of the above. Each option has pros and cons and regulatory limitations. Detailed evaluation of these options is required to support a cost effective expedited cleanup. (authors)

  6. 77 FR 60960 - Safety Zone, Coast Guard Exercise Area, Hood Canal, WA

    Science.gov (United States)

    2012-10-05

    ...which involve fast moving surface vessels, smoke machines, pyrotechnics, and other elements which could create safety concerns for...include fast moving surface vessels, smoke machines, and pyrotechnics. Blank ammunition, flares and LA51 warning munitions...

  7. 77 FR 26699 - Safety Zone; Coast Guard Exercise, Hood Canal, WA

    Science.gov (United States)

    2012-05-07

    ...Coast Guard Sector Puget Sound; Coast Guard; telephone 206-217-6045...vessels, smoke machines, and pyrotechnics. Blank ammunition, flares...zones from the COTP, Puget Sound or Designated Representative...zones from the COTP, Puget Sound or Designated...

  8. 76 FR 70649 - Safety Zone; Department of Defense Exercise, Hood Canal, WA

    Science.gov (United States)

    2011-11-15

    ...Coast Guard Sector Puget Sound; Coast Guard; telephone...vessels, smoke machines, and pyrotechnics. This safety zone is being...zones from the COTP, Puget Sound or Designated Representative...zones from the COTP, Puget Sound or Designated...

  9. Controls on debris flow bulking in proglacial gully networks on Mount Rainier, WA

    Science.gov (United States)

    Legg, N. T.; Meigs, A.; Grant, G. E.; Kennard, P.

    2012-12-01

    Conversion of floodwaters to debris flows due to sediment bulking continues to be a poorly understood phenomenon. This study examines the initiation zone of a series of six debris flows that originated in proglacial areas of catchments on the flank of Mount Rainier during one storm in 2006. One-meter spatial resolution aerial photographs and LiDAR DEMs acquired before and after the storm reveal the lack of a single mass failure to explain the debris flow deposits. Rather, the imagery show appreciable gully widening along reaches up to approximately 1.5 km in length. Based on gully discharges estimated from rainfall rates and estimates of sediment contribution from gully wall width change, we find that the sediment volumes contributed from gully walls are sufficient to bulk floodwaters up to debris flow concentrations. Points in gullies where width change began (upstream limit) in 2006 have a power law trend (R2 = 0.58) in terms of slope-drainage area. Reaches with noticeable width change, which we refer to as bulking reaches (BR), plot along a similar trend with greater drainage areas and gentler slopes. We then extracted slope and drainage area of all proglacial drainage networks to examine differences in morphology between debris flow basins (DFB) and non-debris flow basins (NDFB), hypothesizing that DFB would have a greater portion of their drainage networks with similar morphology to BR than NDFB. A comparison of total network length with greater slope and area than BR reveals that the two basins types are not statistically different. Lengths of the longest reaches with greater slope and drainage area than the BR trend, however, are statistically longer in DFB than in the NDFBs (pbulking does not operate as a simple threshold phenomenon in slope-area space. Instead debris flow initiation via bulking depends upon slope, drainage area, and gully length. We suspect the dependence on length relates to the poorly understood bulking process where feedback mechanisms working to progressively increase sediment concentrations likely operate. The apparent length dependence revealed in this study requires a shift in thought about the conditions leading to debris flow generation in catchments dominated by unconsolidated and transportable material.

  10. 2006 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Lewis County, WA

    National Oceanic and Atmospheric Administration, Department of Commerce — Watershed Sciences, Inc. collected Light Detection and Ranging (LiDAR) data of Western Lewis County for the Puget Sound LiDAR Consortium. This data set covers...

  11. Using Low Frequency Earthquakes to Examine Slow Slip Beneath the Olympic Peninsula, WA

    Science.gov (United States)

    Chestler, S.; Creager, K. C.; Sweet, J. R.

    2014-12-01

    Using data from the Array of Arrays (AofA) and Cascadia Arrays for Earthscope (CAFE) experiments we found 61 families of low frequency earthquakes (LFEs) beneath the Olympic Peninsula, Washington. Detections within each family range from Mw1-2. We cross-correlated 6-second long windows within 99 separate hours of tremor data during the 2010 and 2011 Episodic Tremor and Slip (ETS) events. For each hour, we stacked the autocorrelation functions from a set of 7 three-component base stations chosen for their high signal-to-noise ratios. We extracted windows with correlation coefficients higher than 9 times the median absolute deviation. These time windows contain our preliminary LFE detections. We clustered the time windows and produced template waveforms by stacking the waveforms corresponding to a given cluster. By scanning templates through the entire time period when the AofA network was active (June 2009 - September 2010 and August 2011), we identify bursts of LFE activity lasting 2-10 days during times of known tremor [Wech, 2010], including the August 2010 and 2011 ETS events and three tremor swarms in November 2009, March 2010, and July 2010, each of which is assumed to signify a slow-slip event (SSE). During the larger ETS events, we can identify the passage of the main rupture front, rapid tremor reversals and/or dip-parallel streaks. These alternate propagation modes are less obvious during smaller SSEs. We examine the spatial extent of the SSEs by determining which families were active during each event. While all families were active during the 2010 and 2011 ETS events, fewer families were active during the smaller SSEs. The families active during smaller SSEs are located farther down dip. Finally, we are applying double-difference methods to obtain more robust LFE locations, which will shed light on the patchy structure of the plate interface.

  12. HEALTHY STOCKS OF NW SALMON FOR CA, ID, OR, AND WA

    Science.gov (United States)

    Geographic distribution of eight species/races of Pacific salmon and steelhead (spring/summer chinook, fall chinook, sockeye salmon, chum salmon, coho salmon, pink salmon, summer steelhead and winter steelhead. The data are based upon the Oregon Trout report Healthy Native Stock...

  13. 75 FR 71638 - Safety Zone; Fleet Week Maritime Festival, Pier 66, Elliot Bay, Seattle, WA

    Science.gov (United States)

    2010-11-24

    ...safety zone, response craft would need to maneuver...regulations concerning water-borne peaceful...alternative channels for water-borne protestors...there is minimal impact on water-borne protestors...on-scene patrol craft and enforced...

  14. 76 FR 61378 - Dungeness National Wildlife Refuge, Clallam County, WA; Comprehensive Conservation Plan and...

    Science.gov (United States)

    2011-10-04

    ...sound principles of fish and wildlife management, conservation, legal mandates, and our policies...the best possible approach to wildlife, plant, and habitat conservation, while providing for wildlife-dependent recreation...

  15. 76 FR 45600 - Columbia National Wildlife Refuge, Adams and Grant Counties, WA; Draft Comprehensive Conservation...

    Science.gov (United States)

    2011-07-29

    ...mission of the National Wildlife Refuge System, consistent...principles of fish and wildlife management, conservation, legal mandates, and...addition to outlining broad management direction on conserving wildlife and their...

  16. 77 FR 2992 - Columbia National Wildlife Refuge, Adams and Grant Counties, WA; Final Comprehensive Conservation...

    Science.gov (United States)

    2012-01-20

    ...mission of the National Wildlife Refuge System, consistent...principles of fish and wildlife management, conservation, legal mandates, and...addition to outlining broad management direction on conserving wildlife and their...

  17. 77 FR 71011 - Dungeness National Wildlife Refuge, Clallam County, WA; Comprehensive Conservation Plan and...

    Science.gov (United States)

    2012-11-28

    ...mission of the National Wildlife Refuge System (NWRS...principles of fish and wildlife management, conservation, legal mandates, the...addition to outlining broad management direction on conserving wildlife and their...

  18. 76 FR 50247 - Willapa National Wildlife Refuge, Pacific County, WA; Final Comprehensive Conservation Plan and...

    Science.gov (United States)

    2011-08-12

    ...mission of the National Wildlife Refuge System, consistent...principles of fish and wildlife management, conservation, legal mandates, and...addition to outlining broad management direction for conserving wildlife and their...

  19. 33 CFR 100.1307 - Special Local Regulations, Strait Thunder Performance, Port Angeles, WA.

    Science.gov (United States)

    2010-07-01

    ... encompasses all waters located inside of a line connecting the following points located near Port Angeles, Washington: Point 1: 48°07?24? N, 123...points located near Port Angeles, Washington: Point 1: 48°07?32? N,...

  20. First evidence of directed flow at CERN-SPS energy from WA98 experiment.

    Czech Academy of Sciences Publication Activity Database

    H?ivná?ová, Ivana; Aggarwal, M. M.; Agnihotri, A.; Antonenko, V.; Kurata, M.; Kugler, Andrej; Petrá?ek, Vojt?ch; Rak, Jan; Eliseev, Sergej; Šumbera, Michal; Svensson, T.; Trivedi, M. D.; Tsvetkov, A.; Eijndhoven, N. V.; Vinogradov, A.; Vodopianov, A.; Wyslouch, B.; Yokota, Y.; Young, G. R.

    Calcutta : Narosa Publishing House, 1998 - (Sinha, B.; Srivastava, D.; Viyogi, Y.), s. 549-553 ISBN 81-7319-167-0. [International Conference on Physics and Astrophysics of Quark Gluon Plasma. Jaipur (IN), 17.03.1997-21.03.1997] Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  1. Production of V0 pairs in the hyperon experiment WA89

    Science.gov (United States)

    Adamovich, M. I.; Alexandrov, Yu. A.; Baranov, S. P.; Barberis, D.; Beck, M.; Bérat, C.; Beusch, W.; Boss, M.; Brons, S.; Brückner, W.; Buénerd, M.; Busch, C.; Büscher, C.; Charignon, F.; Chauvin, J.; Chudakov, E. A.; Dersch, U.; Dropmann, F.; Engelfried, J.; Faller, F.; Fournier, A.; Gerassimov, S. G.; Godbersen, M.; Grafström, P.; Haller, T.; Heidrich, M.; Hubbard, E.; Hurst, R. B.; Königsmann, K.; Konorov, I.; Kovalenko, S.; Keller, N.; Martens, K.; Martin, P.; Masciocchi, S.; Michaels, R.; Müller, U.; Neeb, H.; Newbold, D.; Newsom, C.; Paul, S.; Pochodzalla, J.; Potashnikova, I.; Povh, B.; Ren, Z.; Rey-Campagnolle, M.; Rosner, G.; Rossi, L.; Rudolph, H.; Scheel, C.; Schmitt, L.; Siebert, H.-W.; Simon, A.; Smith, V.; Thilmann, O.; Trombini, A.; Vesin, E.; Volkemer, B.; Vorwalter, K.; Walcher, T.; Wälder, G.; Werding, R.; Wittmann, E.; Zavertyaev, M. V.

    2007-12-01

    We present a comprehensive study of the inclusive production of V0V0 pairs (V0=?, ?¯ or KS ) by ?- and ?- of 340 GeV/ c momentum and neutrons of 260 GeV/ c mean momentum in copper and carbon targets. In particular, the dependence of the xF spectra on the combination of beam-particle and produced V0V0 pair is investigated and compared to predictions obtained from PYTHIA and QSGM calculations. The data and these predictions differ in many details, the agreement can at best be termed as qualitative. A signal from decays of the tensor meson f’2(1525) was observed in the KS KS mass distribution and inclusive production cross sections were measured. No signal was found from the double-strange H-dibaryon decaying to ??.

  2. 78 FR 20852 - Safety Zones; Marine Week Air Ground Demonstration, Lake Washington; Seattle, WA

    Science.gov (United States)

    2013-04-08

    ...the Corps' Marine Air Ground Task Force and expeditionary...Proposed Rule The Marine Air Ground Task Force Demonstration...will include low flying aircraft, amphibious vehicles...is for the Marine Air Ground Task Force Demonstration...assessment of potential costs and benefits...

  3. 75 FR 81467 - Safety Zone; Potential Unexploded Ordnance, Pier 91, Seattle, WA

    Science.gov (United States)

    2010-12-28

    ...Seattle discovered discarded military munitions while conducting...the facility was used by the military. Each time, after the items...utilize the facility. Port police continued to perform routine...responsibility for removal of discarded military munitions from this...

  4. WILDERNESS SOCIETY'S SALMON STATUS DATA FOR CA, ID, OR, AND WA

    Science.gov (United States)

    The fish status layers show the historic distribution of freshwater habitat and current status of ten different species of anadromous fish: spring/summer chinook, fall chinook, winter chinook, sockeye salmon, chum salmon, coho salmon, pink salmon, sea-run cutthroat, summer steel...

  5. T.E. KLEINDIENST, E.W. CORSE, F.T. BLANCHARD, W.A. LONNEMAN

    Science.gov (United States)

    Carbonyl compounds are important constituents in urban and global atmospheres. n urban atmospheres these compounds frequently serve to initiate photochemical smog and certainly sustain the chain reactions leading to ozone formation. easurement of carbonyl compounds under atmosphe...

  6. 75 FR 41883 - Notice of Inventory Completion: Museum of Anthropology, Washington State University Pullman, WA

    Science.gov (United States)

    2010-07-19

    ...of Inventory Completion: Museum of Anthropology, Washington State University Pullman...possession and control of the Museum of Anthropology, Washington State University, Pullman...human remains was made by Museum of Anthropology, Washington State University,...

  7. 76 FR 28076 - Notice of Inventory Completion: Museum of Anthropology, Washington State University, Pullman, WA...

    Science.gov (United States)

    2011-05-13

    ...of Inventory Completion: Museum of Anthropology, Washington State University, Pullman...were in possession of the Museum of Anthropology at Washington State University, Pullman...human remains was made by the Museum of Anthropology at the Washington State...

  8. 78 FR 78379 - Notice of Inventory Completion: Museum of Anthropology at Washington State University, Pullman, WA

    Science.gov (United States)

    2013-12-26

    ...of Inventory Completion: Museum of Anthropology at Washington State University, Pullman...SUMMARY: The Museum of Anthropology at Washington State University has...a written request to the Museum of Anthropology at Washington State University....

  9. 77 FR 23507 - Notice of Inventory Completion: Museum of Anthropology at Washington State University, Pullman, WA

    Science.gov (United States)

    2012-04-19

    ...of Inventory Completion: Museum of Anthropology at Washington State University, Pullman...SUMMARY: The Museum of Anthropology at Washington State University has...human remains may contact the Museum of Anthropology at Washington State University....

  10. 76 FR 28073 - Notice of Inventory Completion: Museum of Anthropology at Washington State University, Pullman, WA

    Science.gov (United States)

    2011-05-13

    ...of Inventory Completion: Museum of Anthropology at Washington State University, Pullman...possession and control of the Museum of Anthropology at Washington State University, Pullman...human remains was made by the Museum of Anthropology at Washington State University...

  11. 77 FR 75597 - Proposed Establishment of Class E Airspace; Wilbur, WA

    Science.gov (United States)

    2012-12-21

    ...Global Positioning System (GPS) standard instrument...action may be changed in light of comments received...airports_airtraffic/air_traffic/publications/airspace...Aviation Administration, Air Traffic Organization, Western...aircraft using the new RNAV (GPS) standard...

  12. 77 FR 50419 - Proposed Amendment of Class E Airspace; Pullman, WA

    Science.gov (United States)

    2012-08-21

    ...Global Positioning System (GPS) standard instrument...action may be changed in light of comments received...airports_airtraffic/air_traffic/publications/airspace...Aviation Administration, Air Traffic Organization, Western...aircraft using the RNAV (GPS) standard...

  13. 75 FR 20322 - Proposed Amendment of Class E Airspace; Kelso, WA

    Science.gov (United States)

    2010-04-19

    ...Global Positioning System (GPS) Standard Instrument...action may be changed in light of comments received...airports_airtraffic/air_traffic/publications/airspace...Aviation Administration, Air Traffic Organization, Western...aircraft using the new RNAV (GPS) SIAP's at...

  14. 78 FR 10064 - Safety Zone; Vigor Industrial Roll-Out, West Duwamish Waterway, Seattle, WA

    Science.gov (United States)

    2013-02-13

    ...Environmental Health Risks and Safety Risks. This rule is not an economically...does not create an environmental risk to health or risk to safety that may disproportionately...T13-241 Safety Zone; Vigor Industrial Vessel Roll-Out, West...

  15. 78 FR 37969 - Safety Zone; South Park Bridge Construction, Lower Duwamish Waterway, Seattle, WA

    Science.gov (United States)

    2013-06-25

    ...1625-AA00 Safety Zone; South Park Bridge Construction, Lower Duwamish Waterway...and workers involved in the bridge construction. The safety zone will prohibit...hazards associated with the bridge construction. Under 5 U.S.C....

  16. 77 FR 13626 - Notice of Inventory Completion: Maxey Museum, Whitman College, Walla Walla, WA

    Science.gov (United States)

    2012-03-07

    ...representatives of the Confederated Tribes and Bands of the Yakama Nation, Washington; Confederated Tribes of the Colville Reservation...and Snake rivers to the Colville, Umatilla, Warm Springs, Yakama and Nez Perce reservations. The Wanapum Band was removed...

  17. 76 FR 73666 - Notice of Inventory Completion: Paul H. Karshner Memorial Museum, Puyallup, WA

    Science.gov (United States)

    2011-11-29

    ...representatives of the Coeur D'Alene Tribe of the Coeur D'Alene Reservation, Idaho; Confederated Tribes and Bands of the Yakama Nation, Washington; Confederated Tribes of the Chehalis Reservation, Washington; Confederated Tribes of the Colville...

  18. 78 FR 50094 - Notice of Inventory Completion: Maxey Museum, Walla Walla, WA

    Science.gov (United States)

    2013-08-16

    ...of Confederated Tribes and Bands of the Yakama Nation; Confederated Tribes of the Colville...tributaries to the Colville, Umatilla, Yakama, Warm Springs, and Nez Perce reservations...the Confederated Tribes and Bands of the Yakama Nation; Confederated Tribes of the...

  19. 78 FR 21401 - Notice of Inventory Completion: Central Washington University, Ellensburg, WA

    Science.gov (United States)

    2013-04-10

    ...the Confederated Tribes and Bands of the Yakama Nation; Confederated Tribes of the Colville...the Confederated Tribes and Bands of the Yakama Nation in the Treaty of 1855, but none...that this band belonged to the Simcoe (Yakama) reservation but refused to move...

  20. 77 FR 48535 - Notice of Inventory Completion: Washington State Parks and Recreation Commission, Olympia, WA

    Science.gov (United States)

    2012-08-14

    ...Reservation, Oregon; Confederated Tribes of the Warm Springs Reservation of Oregon; Confederated Tribes and Bands of the Yakama Nation, Washington; and the Nez Perce Tribe, Idaho (previously listed as Nez Perce Tribe of Idaho) (hereafter...

  1. 76 FR 20707 - Cle Elum Dam Fish Passage Facilities and Fish Reintroduction Project; Kittitas County, WA

    Science.gov (United States)

    2011-04-13

    ...Department of Fish and Wildlife and the Yakama Nation. The Bonneville Power Administration...and Wildlife, in collaboration with the Yakama Nation, is evaluating the implementation...Reclamation prevailed in a suit filed by the Yakama Nation concerning the NEPA and...

  2. 78 FR 13887 - Notice of Inventory Completion: Washington State Parks and Recreation Commission, Olympia, WA

    Science.gov (United States)

    2013-03-01

    ...but did not participate: Confederated Tribes and Bands of the Yakama Nation (deferred, with a request to be kept informed); Confederated...responsible for notifying the Confederated Tribes and Bands of the Yakama Nation; Samish Indian Nation (previously listed as the...

  3. 76 FR 14829 - Safety Zone; 2011 Hylebos Bridge Restoration, Hylebos Waterway, Tacoma, WA

    Science.gov (United States)

    2011-03-18

    ...injury to the maritime public during concrete removal portions of the Hylebos Bridge...safety of the maritime public during concrete removal and will do so by prohibiting...13211. Technical Standards The National Technology Transfer and Advancement Act...

  4. 76 FR 38011 - Safety Zone; Hylebos Bridge Restoration, Hylebos Waterway, Tacoma, WA

    Science.gov (United States)

    2011-06-29

    ...restoration involves removal of deteriorated concrete from the Hylebos Bridge and refinishing...be used can remove up to 16 inches of concrete in a single pass presenting a major safety...13211. Technical Standards The National Technology Transfer and Advancement Act...

  5. 78 FR 20100 - Public Utility District No. 1 of Snohomish County, WA; Notice of Technical Meeting

    Science.gov (United States)

    2013-04-03

    ...Discuss the change in the description of the turbine braking system for the proposed Admiralty...January 15, 2013. e. Proposed Agenda: 1. Introduction; 2. Meeting objectives; and 3. Turbine braking system. f. A summary of the...

  6. 76 FR 35363 - Proposed Amendment to Class B Airspace; Seattle, WA

    Science.gov (United States)

    2011-06-17

    ...describes the application procedure. Background In 1974, the...simultaneous instrument approach procedures. For calendar year 2009...aircraft routinely enter, exit, and then reenter Class B...published instrument approach procedures, which is contrary to...

  7. 75 FR 57167 - Safety Zone; CLS Fall Championship Hydroplane Race, Lake Sammamish, WA

    Science.gov (United States)

    2010-09-20

    ...spectators and other waterway users...speed hydroplane races. Hydroplane races...a significant effect or economic impact...Statement of Energy Effects under Executive...a significant effect on the human environment...Championship Hydroplane Race, Lake Sammamish...be assisted by other federal,...

  8. Production of V0 pairs in the hyperon experiment WA89

    International Nuclear Information System (INIS)

    We present a comprehensive study of the inclusive production of V0V0 pairs (V0=?, anti ? or KS) by ?- and ?- of 340 GeV/c momentum and neutrons of 260 GeV/c mean momentum in copper and carbon targets. In particular, the dependence of the xF spectra on the combination of beam-particle and produced V0V0 pair is investigated and compared to predictions obtained from PYTHIA and QSGM calculations. The data and these predictions differ in many details, the agreement can at best be termed as qualitative. A signal from decays of the tensor meson f'2(1525) was observed in the KSKS mass distribution and inclusive production cross sections were measured. No signal was found from the double-strange H-dibaryon decaying to ??. (orig.)

  9. 75 FR 41074 - Amendment of Class D and E Airspace; Everett, WA

    Science.gov (United States)

    2010-07-15

    ...the airport, and removes the operating hours established by a Notice to Airmen...publication, the FAA found that the operating hours for the Class D airspace had...therefore, will continue the operating hours to be effective during the...

  10. Hundimiento de las aguas al sur de Cuba / Downwelling wa ters in the south of Cuba

    Scientific Electronic Library Online (English)

    Benigno, Hernández; Roberto, Piñeiro.

    Full Text Available Se realizan 23 estaciones oceanográficas a bordo del Buque de Investigaciones Científicas BIC "Ulises" en marzo de 1994 y abril de 1996 en el polígono de estudio situado en los 21°00'-21°30'N y 81°50'-83°00'W al sureste de la Isla de la Juventud, Cuba, con el objetivo de estudiar algunas de las rela [...] ciones hidrofísicas que controlan la dinámica de las larvas de langosta espinosa Panulirus argus en la interfase del talud con el océano. Se analizan el viento, transporte Ekman, turbulencia, profundidad de inicio de la termoclina, temperatura superficial del mar y estabilidad vertical en el hundimiento de las aguas cercanas al talud en los dos cruceros de primavera. El índice de transporte (IT) mostró un movimiento neto hacia la costa, provocando un hundimiento en la zona cercana al talud. El hundimiento produce un efecto de mezcla o falso afloramiento llamado "efecto cascada" que mantiene los nutrientes resuspendidos por un período que varía según la intensidad del viento y las corrientes imperantes en la zona. Este efecto, al parecer, es responsable de la retención larvaria en esta región Abstract in english Take account 23 oceanographic stations on Oceanographic Research Vessel BIC "Ulises" in March 1994 and April 1996 in the study polygon located in the 21°00'-21°30'N and 81°50'-83°00'W in southwest of Isla de la Juventud, Cuba, with the main objective to study hydrophysical relationships that control [...] the dynamics of the Panulirus argus spiny lobster larvae in the boundary shelf. Importance of the wind, Ekman transport, turbulence, depth of the top of the thermocline, sea surface temperature, vertical stability in the convergence or downwelling nearshore waters in this important area of spawns, was demonstrated. Transport Index (IT) showed a net movement toward the coast causing nearshore downwelling. The downwelling produces a mixture effect or false upwelling called also "cascade effect" that maintains nutrients suspended for one period that varies according to the wind intensity and the prevailing currents in the area. This effect apparently, is responsible for the larvae retention in this region

  11. Hundimiento de las aguas al sur de Cuba Downwelling wa ters in the south of Cuba

    Directory of Open Access Journals (Sweden)

    Benigno Hernández

    2003-01-01

    Full Text Available Se realizan 23 estaciones oceanográficas a bordo del Buque de Investigaciones Científicas BIC "Ulises" en marzo de 1994 y abril de 1996 en el polígono de estudio situado en los 21°00'-21°30'N y 81°50'-83°00'W al sureste de la Isla de la Juventud, Cuba, con el objetivo de estudiar algunas de las relaciones hidrofísicas que controlan la dinámica de las larvas de langosta espinosa Panulirus argus en la interfase del talud con el océano. Se analizan el viento, transporte Ekman, turbulencia, profundidad de inicio de la termoclina, temperatura superficial del mar y estabilidad vertical en el hundimiento de las aguas cercanas al talud en los dos cruceros de primavera. El índice de transporte (IT mostró un movimiento neto hacia la costa, provocando un hundimiento en la zona cercana al talud. El hundimiento produce un efecto de mezcla o falso afloramiento llamado "efecto cascada" que mantiene los nutrientes resuspendidos por un período que varía según la intensidad del viento y las corrientes imperantes en la zona. Este efecto, al parecer, es responsable de la retención larvaria en esta regiónTake account 23 oceanographic stations on Oceanographic Research Vessel BIC "Ulises" in March 1994 and April 1996 in the study polygon located in the 21°00'-21°30'N and 81°50'-83°00'W in southwest of Isla de la Juventud, Cuba, with the main objective to study hydrophysical relationships that control the dynamics of the Panulirus argus spiny lobster larvae in the boundary shelf. Importance of the wind, Ekman transport, turbulence, depth of the top of the thermocline, sea surface temperature, vertical stability in the convergence or downwelling nearshore waters in this important area of spawns, was demonstrated. Transport Index (IT showed a net movement toward the coast causing nearshore downwelling. The downwelling produces a mixture effect or false upwelling called also "cascade effect" that maintains nutrients suspended for one period that varies according to the wind intensity and the prevailing currents in the area. This effect apparently, is responsible for the larvae retention in this region

  12. GigaWaM—Next-Generation WDM-PON Enabling Gigabit Per-User Data Bandwidth

    DEFF Research Database (Denmark)

    Prince, Kamau; Gibbon, Timothy Braidwood

    2012-01-01

    The “Gigabit access passive optical network using wavelength division multiplexing” project aims to implement 64-Gb/s data transmission over 20-km single-mode fiber. Per-user symmetric data rates of 1-Gb/s will be achieved using wavelength division multiplexing passive optical network (WDM-PON) architecture with a 1:64 user split per PON segment. Enabling technologies being developed within the scope of the project include tunable transceivers and athermal 50-GHz array waveguide grating multiplexer devices. The future-proof WDM architecture will enable convergence triple-play (telephony, TV, and broadband internet) service over existing optical infrastructure, and also facilitate cost-effective dense wavelength division multiplexing for metro aggregation and mobile backhaul networks.

  13. 77 FR 35850 - Safety Zone; F/V Deep Sea, Penn Cove, WA

    Science.gov (United States)

    2012-06-15

    ...fishing vessel, which may include debris and other potentially hazardous...and/or exposure to hazardous debris and/or materials associated...Deep Sea, sank after catching fire. Containment and absorbent...operating and that may contain debris or hazardous materials...

  14. 77 FR 21868 - Safety Zone; Marina Salvage, Bellingham Bay, Bellingham, WA

    Science.gov (United States)

    2012-04-12

    ...preventing contact with associated debris, and sunken vessels, and will...hazards created by a marina fire, which produced sunken vessels...and/or exposure to hazardous debris associated with the marina salvage...navigation in areas that may contain debris and hazardous materials...

  15. Residential property values are associated with obesity among women in King County, WA, USA.

    Science.gov (United States)

    Rehm, Colin D; Moudon, Anne V; Hurvitz, Philip M; Drewnowski, Adam

    2012-08-01

    Studies of social determinants of weight and health in the US have typically relied on self-reported education and incomes as the two primary measures of socioeconomic status (SES). The assessed value of one's home, an important component of wealth, may be a better measure of the underlying SES construct and a better predictor of obesity. The Seattle Obesity Study (SOS), conducted in 2008-9, was a cross-sectional random digit dial telephone survey of 2001 adults in King County, Washington State, US. Participants' addresses were geocoded and residential property values for each tax parcel were obtained from the county tax assessor's database. Prevalence ratios of obesity by property values, education, and household income were estimated separately for women and men, after adjusting for age, race/ethnicity, household size, employment status and home ownership. Among women, the inverse association between property values and obesity was very strong and independent of other SES factors. Women in the bottom quartile of property values were 3.4 times more likely to be obese than women in the top quartile. No association between property values and obesity was observed for men. The present data strengthen the evidence for a social gradient in obesity among women. Property values may represent a novel and objective measure of SES at the individual level in the US. Measures based on tax assessment data will provide a valuable resource for future health studies. PMID:22591823

  16. Residential property values are associated with obesity among women in King County, WA, USA

    OpenAIRE

    Rehm, Colin D.; Moudon, Anne V.; Hurvitz, Philip M.; Drewnowski, Adam

    2012-01-01

    Studies of social determinants of weight and health in the US have typically relied on self-reported education and incomes as the two primary measures of socioeconomic status (SES). The assessed value of one’s home, an important component of wealth, may be a better measure of the underlying SES construct and a better predictor of obesity. The Seattle Obesity Study (SOS), conducted in 2008-9, was a cross-sectional random digit dial telephone survey of 2001 adults in King County, Washington S...

  17. 76 FR 30014 - Safety Zone; Fleet Week Maritime Festival, Pier 66, Elliott Bay, Seattle, WA

    Science.gov (United States)

    2011-05-24

    ...emergency and ensuring participant, spectator and maritime safety. The Captain of the Port, Puget Sound may be assisted...this area for this short period of time to ensure maritime safety. One comment stated the revised proposed rule...

  18. Completion of the 16 station Plate Boundary Observatory (PBO) network on Mt. St. Helens, WA

    Science.gov (United States)

    Austin, K.; Hafner, K.; Fengler, K.; Doelger, S.

    2006-12-01

    The Plate Boundary Observatory (PBO), part of the larger NSF-funded EarthScope project, is completing year 3 of the installation phase of 852 continuously operating GPS stations in the Western United States. Some of these GPS stations are focused specifically on centers of volcanic activity. Mt. St. Helens is one of these volcanic areas of interest in the Pacific Northwest (PNW) region. The PNW region will complete the installation of a 16 station GPS network on Mt. St. Helens during September 2006. This work also includes the co-location and installation of tiltmeters at four of the existing GPS sites. Network upgrades will be completed to handle the increase in data flow from the new GPS stations as well as the data from the tiltmeters and strainmeters. New GPS site installations include six helicopter accessible sites, and three drive to sites on the south flank of the mountain. Higher elevation sites will be outfitted with an eight battery, three solar panel power array to keep the stations operational during winter months. The remaining sites use a four battery, three solar panel array that has proved sufficient at other GPS locations over the past 2 winters. All stations will communicate via one of 2 radio networks set up on the mountain. The northern radio network transmits data for ten stations through a microwave connection at the Johnston Ridge observatory that also provides communications for PBO strainmeter, tiltmeter and CVO equipment. The remaining 10 stations on the south side of the mountain, are relayed through a hub at Washington State University's Vancouver Campus that is also providing data services for CVO. Results from analysis of data from both PBO and USGS GPS stations on the mountain, show a radially inward and downward motion, with the maximum vertical offsets high on the mountain and the maximum horizontal offsets located at distances of 5-10km from the crater. Displacements are small over the 2004-present eruption with a maximum of 3cm of inward movement. Modeling of the data by Lisowski et al. (AGU 2006) only accounts for a volume loss that is one third of the amount of material erupted. GPS stations installed high on the mountain were subjected to severe winter weather and heavy rime ice accumulations over the last year. This ice build-up caused distortion of the GPS antenna phase center, and blocked sun access to the solar panels at several sites. Due to the large battery storage capacity, very few power failures occurred at these stations. However, the build up of ice on the GPS antennas caused cm-level pseudo-displacements that mask the ground movements associated with the eruption.

  19. Mechanism of Al-Wa’Ad (Promise): Teory and Application in Islamic Banking in Malaysia

    OpenAIRE

    Nor Adila bt. Mohd Noor; Aripin, Mohd Ashraf B.

    2010-01-01

    Contract according to Syariah Law can be defined as being “an expression of the matching between a positive proposal made by one of the contractors and the acceptance of the other contractor in a way which has an impact on the subject of the contract” . There are standard requirements provides by the law in order to constitute a valid binding contract namely offer, acceptance, consideration, and intention to create legal relation. This requirement is more or less the same ...

  20. 77 FR 16852 - Notice of Reclassification of Five Regional Offices to Investigative Field Offices: Seattle, WA...

    Science.gov (United States)

    2012-03-22

    ...another agency. The planned lease of office space and tenant finish...terminating existing real estate leases prior to their expiration date...terminating some existing real estate leases prior to their expiration date...Services The plan was designed to improve the quality and level of...

  1. 76 FR 9051 - Notice of Inventory Completion: Washington State Department of Natural Resources, Olympia, WA and...

    Science.gov (United States)

    2011-02-16

    ...found to have a cultural affiliation with...Department of Anthropology, had believed...Department of Anthropology, and Burke Museum...Central Coast Salish cultural group (Suttles...Department of Anthropology, have determined...Maurice Major, Cultural Resource...

  2. Yeast Interacting Proteins Database: YCL020W, YDR261W-A [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YCL020W - Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this b ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this p ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this b ... n that is the structural constituent of virus-like particles ... (VLPs); similar to retroviral Gag Rows with this p ...

  3. 76 FR 60587 - Environmental Impact Statement; North Corridor Transit Project, Seattle (WA) Metropolitan Area...

    Science.gov (United States)

    2011-09-29

    ...comments on the scope of alternatives...the proposed project, the Alternatives...Transportation Systems Management (TSM) Alternative...floodplain management, and 11990...that meet the project purpose and...need for the project, the scope of...

  4. 77 FR 21866 - Safety Zone; Sunken Vessel, Puget Sound, Everett, WA

    Science.gov (United States)

    2012-04-12

    ...colliding with a sunken dry dock and associated debris, and to ensure the safety of the salvage...that may contain sunken obstructions, and debris. Discussion of Rule The Coast Guard is...select regulatory approaches that maximize net benefits (including potential...

  5. Supplemental Groundwater Remediation Technologies to Protect the Columbia River at Hanford, WA

    Energy Technology Data Exchange (ETDEWEB)

    Thompson, K. M.; Petersen, Scott W.; Fruchter, Jonathan S.; Ainsworth, Calvin C.; Vermeul, Vince R.; Wellman, Dawn M.; Szecsody, Jim E.; Truex, Michael J.; Amonette, James E.; Long, Philip E.

    2007-12-15

    Nine projects have been recently selected by the US Department of Energy (EM-22) to address groundwater contaminant migration at the Hanford Site. This paper summarizes the background and objectives of these projects. Five of the selected projects are targeted at hexavalent chromium contamination in Hanford 100 Area groundwater. These projects represent an integrated approach towards identifying the source of hexavalent chromium contamination in the Hanford 100-D Area and treating the groundwater contamination. Currently, there is no effective method to stop strontium-90 associated with the riparian zone sediments from leaching into the river. Phytoremediation may be a possible way to treat this contamination. Its use at the 100-N Area will be investigated. Another technology currently being tested for strontium-90 contamination at the 100-N Area involves injection (through wells) of a calcium-citrate-phosphate solution, which will precipitate apatite, a natural calcium-phosphate mineral. Apatite will adsorb the strontium-90, and then incorporate it as part of the apatite structure, isolating the strontium-90 contamination from entering the river. This EM-22 funded apatite project will develop a strategy for infiltrating the apatite solution from ground surface or a shallow trench to provide treatment over the upper portion of the contaminated zone, which is unsaturated during low river stage.

  6. Supplemental Groundwater Remediation Technologies to Protect the Columbia River at Hanford, WA

    International Nuclear Information System (INIS)

    Nine projects have been recently selected by the US Department of Energy (EM-22) to address groundwater contaminant migration at the Hanford Site. This paper summarizes the background and objectives of these projects. Five of the selected projects are targeted at hexavalent chromium contamination in Hanford 100 Area groundwater. These projects represent an integrated approach towards identifying the source of hexavalent chromium contamination in the Hanford 100-D Area and treating the groundwater contamination. Currently, there is no effective method to stop strontium-90 associated with the riparian zone sediments from leaching into the river. Phytoremediation may be a possible way to treat this contamination. Its use at the 100-N Area will be investigated. Another technology currently being tested for strontium-90 contamination at the 100-N Area involves injection (through wells) of a calcium-citrate-phosphate solution, which will precipitate apatite, a natural calcium-phosphate mineral. Apatite will adsorb the strontium-90, and then incorporate it as part of the apatite structure, isolating the strontium-90 contamination from entering the river. This EM-22 funded apatite project will develop a strategy for infiltrating the apatite solution from ground surface or a shallow trench to provide treatment over the upper portion of the contaminated zone, which is unsaturated during low river stage.

  7. NOAA Office for Coastal Management Coastal Inundation Digital Elevation Model: Seattle (WA) WFO - Grays Harbor County

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital elevation model (DEM) is a part of a series of DEMs produced for the National Oceanic and Atmospheric Administration Office for Coastal Management's...

  8. WAED-HP-103, Health Physics Manual, Revision XII, March 1981. Final report

    International Nuclear Information System (INIS)

    The project scope of work included the complete decontamination and decommissioning (D and D) of the Westinghouse ARD Fuel Laboratories at the Cheswick Site in the shortest possible time. This has been accomplished in the following four phases: (1) preparation of documents and necessary paperwork; packaging and shipping of all special nuclear materials in an acceptable form to a reprocessing agency; (2) decontamination of all facilities, glove boxes and equipment; loading of generated waste into bins, barrels and strong wooden boxes; (3) shipping of all bins, barrels and boxes containing waste to the designated burial site; removal of all utility services from the laboratories; (4) final survey of remaining facilities and certification for nonrestricted use; preparation of final report. This attachment describes the responsibilities, standards, practices and procedures for radiaton protection and safety in the facilities of the Westinghouse Electric Corporation at Cheswick, Pennsylvania. In addition to the application of these standards and procedures, there is continual surveillance of the operations, equipment, and personnel to detect and correct any conditions which might create a health or accident hazard

  9. 77 FR 38236 - Special Local Regulation, Underwater Music Festival, Carr Inlet, Cutts Island, WA

    Science.gov (United States)

    2012-06-27

    ...1625-AA08 Special Local Regulation, Underwater Music Festival, Carr Inlet, Cutts Island...the maritime public during the Underwater Music Festival and would do so by establishing...notice. Basis and Purpose The Underwater Music Festival is an event which includes...

  10. Dense Medium Plasma Water Purification Reactor (DMP WaPR) Project

    National Aeronautics and Space Administration — The Dense Medium Plasma Water Purification Reactor offers significant improvements over existing water purification technologies used in Advanced Life Support...

  11. 77 FR 3111 - Safety Zone; Export Grain Terminal (EGT), Columbia River, Longview, WA

    Science.gov (United States)

    2012-01-23

    ...required in the area between the shoreline and the navigable channel where...implemented to help ensure the safe navigation of maritime traffic in the area...enclosed by three lines and the shoreline: line one starting on the...

  12. 33 CFR 165.1319 - Safety Zone Regulations, Seafair Blue Angels Air Show Performance, Seattle, WA.

    Science.gov (United States)

    2010-07-01

    ... Section 165.1319 Navigation and Navigable Waters...WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS... Specific Regulated Navigation Areas and Limited Access...side of the bridge to the shoreline on the western...

  13. Water Accounting Plus (WA+) – a water accounting procedure for complex river basins based on satellite measurements :

    OpenAIRE

    Karimi, P.; Bastiaanssen, W. G. M.; Molden, D.

    2013-01-01

    Coping with water scarcity and growing competition for water among different sectors requires proper water management strategies and decision processes. A pre-requisite is a clear understanding of the basin hydrological processes, manageable and unmanageable water flows, the interaction with land use and opportunities to mitigate the negative effects and increase the benefits of water depletion on society. Currently, water professionals do not have a common framework that links depletion to u...

  14. DCS Survey Submission for City of Longview PAL, Cowlitz County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  15. DCS Survey Submission for Unincorporated Cowlitz County PAL, Cowlitz County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  16. DCS Survey Submission for City of Kelso PAL, Cowlitz County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  17. DCS Survey Submission for City of Woodland PAL, Cowlitz County, WA

    Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...

  18. 75 FR 81641 - Odessa Subarea Special Study; Adams, Franklin, Grant, and Lincoln Counties, WA

    Science.gov (United States)

    2010-12-28

    ...at the following locations: Bureau of Reclamation, Columbia-Cascades Area Office...telephone: (509) 575-5848. Bureau of Reclamation, Pacific Northwest Regional...can request in your comment for us to withhold your personal...

  19. Guineaworm infection in the Wa district of north-western Ghana.

    Science.gov (United States)

    Lyons, G R

    1972-01-01

    The Ghana-5 schistosomiasis project is situated in an exclusively rural area of north-western Ghana. Since the inhabitants rely for the most part on natural sources of drinking water the transmission of both urinary schistosomiasis and guineaworm infection must often occur at the same sites, and the epidemiology and the problems of control of these diseases might be expected to have features in common. An epidemiological survey of 8 300 people in 1967-68 showed that guineaworm had a scattered distribution, 35 of 43 villages having an annual incidence of less than 10%. Intensive study of 5 of the most seriously affected villages over a period of 3 years has shown that there is a delicate balance between the parasite and its human host in this area, largely as a result of the impermanent nature of the principal transmission sites, i.e., ponds and the smaller riverine pools. The timing, duration, and intensity of transmission have been shown to vary widely from one locality to another, as well as from year to year. These characteristics are determined by the type and extent of the local source of drinking water, the availability of alternative sources, and the monthly pattern of rainfall. PMID:4267016

  20. 75 FR 53195 - Security Zone; U.S. Coast Guard BSU Seattle, Pier 36, Seattle, WA

    Science.gov (United States)

    2010-08-31

    ...or movement within this security zone is prohibited without...rulemaking (NPRM) entitled Security Zone; U.S. Coast Guard...and Purpose Heightened awareness of potential terrorist acts requires enhanced security of our ports,...

  1. Numerical Simulation of Admiralty Inlet, WA, with Tidal Hydrokinetic Turbine Siting Application

    Science.gov (United States)

    Thyng, Kristen M.

    Tidal hydrokinetic energy has been recognized as a potential source of sustainable, renewable energy. In order to properly site turbines for commercial-scale development, the complex flow conditions in a potential deployment region must be understood. Viable locations for turbines are limited by many factors, including underwater space that is above the bottom boundary layer, below shipping traffic, within areas of strong currents, and yet avoids additional fatiguing stresses. The primary area of interest in the Puget Sound for commercial tidal energy development is Admiralty Inlet, which includes potentially disruptive flow features such as vortices and strong turbulence. This dissertation seeks to increase the body of knowledge of these features both from an oceanographic perspective and as they pertain to turbine site characterization. The primary means of studying Admiralty Inlet in this document is through numerical simulation of the region using the Regional Ocean Modeling System (ROMS). The model output is found to compare well with field data, capturing eddy fields, turbulence properties, relative tidal phases, and illuminating many flow features. Horizontal velocities in the simulation are, on average, approximately 75% the size of those found in the data. This speed deficiency is inherited from the forcing model in which the Admiralty Inlet simulation is nested. The model output also shows that the flow field of this fjord-like estuary is largely affected by a headland on the northeast side of the Inlet. Vortices generated by this headland, Admiralty Head, are found to vary considerably depending on the tidal cycle. The eddies can persist beyond the half-cycle of generation to significantly affect the horizontal speed and other flow field properties in the subsequent half-cycle. Detailed analysis of the vertical vorticity governing equation shows that advection, tilting, stretching, and boundary generation are the most significant processes dictating the behavior of the vorticity. Turbulence modeling in the simulation is carried out via a k-epsilon turbulence closure scheme. Comparisons of model output with high resolution field data show the model to perform reasonably well: predicted Reynolds stress and turbulent dissipation rate values are usually within a factor of two of the field data. The turbulent kinetic energy from the simulation compares well with field data that is restricted to the frequency range of classical turbulence. The energy density spectrum of the data is found to follow Kolmogorov's theory beyond the inertial subrange. Using this fact and Taylor's frozen field approximation, an inferred calculation for the turbulent kinetic energy is derived that spans the full frequency range of the data set. The output from the inferred calculation compares well with the full turbulent kinetic energy from the field data. Maps of metrics for tidal turbine siting are generated that address many considerations for turbine placement, and can be adjusted for the model's speed deficiency with a simple multiplication factor. Among the possible best locations for turbine deployment are north of Point Wilson on the west side of Admiralty Inlet and near the center of the channel between Point Wilson and Admiralty Head. These locations have a strong tidal resource available along with highly bi-directional tidal currents and low turbulence levels.

  2. Field Measurements to Characterize Turbulent Inflow for Marine Hydrokinetic Devices - Marrowstone Island, WA

    Science.gov (United States)

    Richmond, M. C.; Thomson, J. M.; Durgesh, V.; Polagye, B. L.

    2011-12-01

    Field measurements are essential for developing an improved understanding of turbulent inflow conditions that affect the design and operation of marine and hydrokinetic (MHK) devices. The Marrowstone Island site in Puget Sound, Washington State is a potential location for installing MHK devices, as it experiences strong tides and associated currents. Here, field measurements from Nodule Point on the eastern side of Marrowstone Island are used to characterize the turbulence in terms of velocity variance as a function of length and time scales. The field measurements were performed using Acoustic Doppler Velocimetry (ADV) and Acoustic Doppler Current Profiler (ADCP) instruments. Both were deployed on a bottom-mounted tripod at the site by the Applied Physics Lab at the University of Washington (APL-UW). The ADV acquired single point, temporally resolved velocity data from 17-21 Feb 2011, at a height of 4.6 m above the seabed at a sampling frequency of 32 Hz. The ADCP measured the velocity profile over the water column from a height of 2.6 m above the seabed up to the sea-surface in 36 bins, with each bin of 0.5 m size. The ADCP acquired data from 11-27 Feb 2011 at a sampling frequency of 2 Hz. Analysis of the ADV measurements shows distinct dynamic regions by scale: anisotropic eddies at large scales, an isotropic turbulent cascade (-5/3 slope in frequency spectra) at mesoscales, and contamination by Doppler noise at small scales. While Doppler noise is an order of magnitude greater for the ADCP measurements, the turbulence bulk statistics are consistent between the two instruments. There are significant variations in turbulence statistics with stage of the tidal currents (i.e., from slack to non-slack tidal conditions), however an average turbulent intensity of 10% is a robust, canonical value for this site. The ADCP velocity profiles are useful in quantifying the variability in velocity along the water column, and the ensemble averaged velocity profiles may be described by a power law, commonly used to characterize boundary layers.

  3. NOAA Office for Coastal Management Coastal Inundation Digital Elevation Model: Portland WFO (WA)

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital elevation model (DEM) is a part of a series of DEMs produced for the National Oceanic and Atmospheric Administration Office for Coastal Management's...

  4. 76 FR 79137 - Proposed Establishment of Area Navigation (RNAV) Routes; Seattle, WA

    Science.gov (United States)

    2011-12-21

    ...originating within Seattle Air Route Traffic Control Center's (ARTCC) airspace. The routes...Department of Transportation, Docket Operations, M-30, 1200 New Jersey Avenue SE...office of the Western Service Center, Operations Support Group, Federal Aviation...

  5. 75 FR 72781 - Buckhorn Exploration Project 2010, Okanogan-Wenatchee National Forest, Okanogan County, WA

    Science.gov (United States)

    2010-11-26

    ...public lands and surface resources by initially using remote sensing and other non-surface disturbing prospecting techniques...being prepared for federal lands. The Washington DNR, Geology & Earth Resources Division Manager is the SEPA...

  6. View of the WA3 set-up from upstream the beam entering the hydrogen target.

    CERN Multimedia

    1977-01-01

    The Amsterdam-CERN-Cracow-Munich-Oxford-Rutherford (ACCMOR)Collaboration set-up this experiment in the H1 beam of West Hall to study a variety of exclusive hadron reactions over a wide kinematic range up to 100 GeV/c incident momentum.

  7. 78 FR 26249 - Drawbridge Operation Regulation; Lake Washington Ship Canal, Seattle, WA

    Science.gov (United States)

    2013-05-06

    ...temporary deviation, call or email Randall Overton, Bridge Administrator, Coast Guard Thirteenth...206-220-7282, email Randall.D.Overton@uscg.mil. If you have questions on...Dated: April 22, 2013. Randall D. Overton, Bridge Administrator, Thirteenth...

  8. 77 FR 22217 - Drawbridge Operation Regulation; Snohomish River and Steamboat Slough, Everett and Marysville, WA

    Science.gov (United States)

    2012-04-13

    ...this rule, call or email Randall D. Overton, Bridge Administrator, Coast Guard Thirteenth...206-220-7282; email randall.d.overton@uscg.mil. If you have questions on...Dated: March 30, 2012. Randall D. Overton, Bridge Administrator. [FR Doc....

  9. 76 FR 69131 - Drawbridge Operation Regulation; Lake Washington Ship Canal, Seattle, WA

    Science.gov (United States)

    2011-11-08

    ...District; telephone (206) 220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: October 26, 2011. Randall D. Overton, Bridge Administrator. [FR Doc. 2011-28846 Filed...

  10. 78 FR 31412 - Drawbridge Operation Regulation; Thea Foss Waterway Previously Known as City Waterway, Tacoma, WA

    Science.gov (United States)

    2013-05-24

    ...If you have questions on this rule, call or email Randall Overton, Bridge Administrator, Coast Guard Thirteenth District; telephone (206) 220-7282, email Randall.D.Overton@uscg.mil. If you have questions on viewing the...

  11. 77 FR 25079 - Drawbridge Operation Regulation; Lake Washington Ship Canal, Seattle, WA

    Science.gov (United States)

    2012-04-27

    ...Thirteenth District; telephone 206-220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: March 30, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-10186 Filed...

  12. 78 FR 21063 - Drawbridge Operation Regulations; Snohomish River and Steamboat Slough, Everett, and Marysville, WA

    Science.gov (United States)

    2013-04-09

    ...temporary deviation, call or email Randall Overton, Bridge Administrator, Coast Guard Thirteenth...206-220-7282, email Randall.D.Overton@uscg.mil. If you have questions on...Dated: March 25, 2013. Randall D. Overton, Bridge Administrator, Thirteenth...

  13. 77 FR 57019 - Drawbridge Operation Regulation; Lake Washington Ship Canal, Seattle, WA

    Science.gov (United States)

    2012-09-17

    ...District; telephone 206-220-7282; email randall.d.overton@uscg.mil. If you have questions on viewing the docket...under 33 CFR 117.35. Dated: August 5, 2012. Randall D. Overton, Bridge Administrator. [FR Doc. 2012-22796 Filed...

  14. 76 FR 72839 - Drawbridge Operation Regulation; City Waterway Also Known as Thea Foss Waterway, Tacoma, WA

    Science.gov (United States)

    2011-11-28

    ...District; telephone (206) 220-7282 email randall.d.overton@uscg.mil. If you have questions on viewing the docket...33 CFR 117.35. Dated: November 14, 2011. Randall D. Overton, Bridge Administrator. [FR Doc. 2011-30513 Filed...

  15. Lidar Investigation of Infiltration Water Heterogeneity in the Tamala Limestone, SW WA

    Science.gov (United States)

    Mahmud, K.; Mariethoz, G.; Treble, P. C.; Baker, A.

    2014-12-01

    To better manage groundwater resources in carbonate areas and improve our understanding of speleothem archives, it is important to understand and predict unsaturated zone hydrology in karst. The high level of complexity and spatial heterogeneity of such systems is challenging and requires knowledge of the typical geometry of karstic features. We present an exhaustive characterization of Golgotha Cave, SW Western Australia, based on an extensive LIDAR measurement campaign. The cave is developed in Quaternary age aeolianite (dune limestone) and contains speleothem records. We collect 30 representative 3D scan images from this site using FARO Focus3D, a high-speed 3D laser scanner, to visualize, study and extract 2D and 3D information from various points of view and at different scales. In addition to LIDAR data, 32 automatic drip loggers are installed at this site to measure the distribution and volume of water flow. We perform mathematical morphological analyses on the cave ceiling, to determine statistical information regarding the stalactites widths, lengths and spatial distribution. We determine a relationship between stalactites diameter and length. We perform tests for randomness to investigate the relationship between stalactite distribution and ceiling features such as fractures and apply this to identify different types of possible flow patterns such as fracture flow, solution pipe flow, primary matrix flow etc. We also relate stalactites density variation with topography of the cave ceiling which shows hydraulic gradient deviations. Finally we use Image Quilting, one of the recently developed multiple-point geostatistics methods, with the training images derived from LIDAR data to create a larger cave system to represent not only the caves that are visible, but the entire system which is inaccessible. As a result, an integral geological model is generated which may allow other scientists, geologist, to work on two different levels, integrating different speleothem datasets: (1) a basic level based on the accurate and metric support provided by the laser scanner; and (2) an advanced level using the image-based modelling.

  16. Exact diagonalization study of the spin-1 two-dimensional J1-J3 Heisenberg model on a triangular lattice

    Science.gov (United States)

    Rubin, P.; Sherman, A.

    2014-11-01

    The spin-1 Heisenberg model on a triangular lattice with the ferromagnetic nearest-neighbor and antiferromagnetic third-nearest-neighbor exchange interactions, J1 = - (1 - p) J and J2 = pJ, J > 0 (0 ? p ? 1), is studied with the use of the SPINPACK code. This model is applicable for the description of the magnetic properties of NiGa2S4. The ground, low-lying excited state energies and spin-spin correlation functions have been found for lattices with N = 16 and N = 20 sites with the periodic boundary conditions. These results are in qualitative agreement with earlier authors' results obtained with Mori's projection operator technique.

  17. States of $\\rho D^* \\bar D^*$ with $J=3$ within the Fixed Center Approximation to the Faddeev equations

    CERN Document Server

    Bayar, M; Oset, E

    2015-01-01

    We study the interaction of the a $\\rho$ and $D^*$, $\\bar D^*$ with spins aligned using the Fixed Center Approximation to the Faddeev equations. We select a cluster of $D^* \\bar D^*$, which is found to be bound in $I=0$ and can be associated to the X(3915), and let the $\\rho$ meson orbit around the $D^*$ and $\\bar D^*$. In this case we find an $I=1$ state with mass around 4340 MeV and narrow width of about 50 MeV. We also investigate the case with a cluster of $\\rho D^*$ and let the $\\bar D^*$ orbit around the system of the two states. The $\\rho D^*$ cluster is also found to bind and leads to the $D^*_2(2460)$ state. The addition of the extra $\\bar D^*$ produces further binding and we find, with admitted uncertainties, a state of $I=0$ around 4000 MeV, and a less bound narrow state with $I=1$ around 4200 MeV.

  18. Radon measurements in 130 schools

    International Nuclear Information System (INIS)

    During the winter of 1989, Rn screening measurements were made in 130 schools distributed across the United States. The primary purpose of the paper is to identify schools suitable for a year-long follow-up study, the results of which will be used to update EPA's guidance for Rn testing in schools. The 130 schools were selected nonrandomly using school characteristics and accessibility in areas where there were known or suspected Rn problems in homes. Levels found in this screening study may indicate the potential for Rn problems in US schools. Over half of the 130 schools tested had at least one radon measurement ?4 pCi/L, and nearly 20% of the 3028 rooms measured ?4 pCi/L. The number of rooms ?4 pCi/L is often three rooms or less. However, schools with more than five rooms ?4 pCi/L are common in some areas. The data include schools that could be typical of much of the US school population as well as schools which exhibit extreme radon problems, such as those tested in Nashville, TN and Spokane, WA

  19. Kashf al-Niq?b ‘an Ramz al-Muq?wamah al-Thaq?f?yah: ?ir?’ bayn al-Muslim?n wa al-Nubal?’ f? Risalatay D?rm?gandul wa G?t?l?sh?

    Directory of Open Access Journals (Sweden)

    Mochamad Ali

    2014-03-01

    Full Text Available The discussion of this article is devoted to delineating the differences and even conflicting characteristics between these two sorts of the Japanese literature. Embedded within the two mentioned social and cultural groups of the Javanese, the priyayi and the santri, the two Javanese literature presented the discourses which are not only different but also disagreement between each other. In the nineteenth century Java, and also the Indonesian archipelago at large, due to the Dutcb colonial government, these mentioned two social and cultural of the Javanese developed into respectively distinct and even conflicting groups.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v9i3.662

  20. Taq?lid Tuallif Kutub al-Tafs?r al-Malay?w?yah wa al-J?w?yah wa al-Sund?w?yah: Mu?awalah li Rasm Khar??ah

    Directory of Open Access Journals (Sweden)

    Ervan Nurtawab

    2005-12-01

    Full Text Available This article examines the tradition of translating and interpreting the Qur'an in Javanese, Malay, and Sundanese, with a focus on manuscripts since the beginning of the 20th century. The author of this article has sought to show the dynamics of the translations and interpretations of the Qur'an in these three languages since the 17th century, while further explaining the characteristics of these works in the respective periods.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v12i3.585

  1. Al-Isl?m wa Fat?n?y?n f? Tayl?nd: Ta?add?yat al-M??? wa Ta?allu’?t al-Mustaqbal

    Directory of Open Access Journals (Sweden)

    A. Ghani Ya'qub

    2014-03-01

    Full Text Available This article presents abroad discussion on the history of lslam in Patani. This discussion, which relies heavily on local sources of information, also provides an explanation of the various factors that have influenced the formation of the Patani Muslim community's culture, including social, economic and political elements.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v10i2.633

  2. Nah?at al-‘Ulam?’ bay al-B?tin?yah al-J?w?yah wa al-Ta?awwuf al-Isl?m?: ‘Ar?un wa Mun?qash?t

    Directory of Open Access Journals (Sweden)

    Muhammad Nursamad

    2004-08-01

    Full Text Available Three kebatinan "holy books", Darmogandul, Gatoloco, and Wirid Hidayat Jati, are the point of focus in the analysis of doctrinal sources. The tendency of these three texts to ridicule santri(students at Islamic boarding schools or pesantren strengthens the impression that the Dutch colonial government used kebatinan to attack Islam. At the very least, this "cultural war" was closely linked to these texts.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v11i2.604

  3. «Wa-wa?aln? ‘al? barakat All?h il? ?g?l?z»: à propos de la localisation d’?g?l?z-Des-Har?a, le ?i?n du Mahd? Ibn T?mart

    Directory of Open Access Journals (Sweden)

    Van Staëvel, Jean-Pierre

    2006-06-01

    Full Text Available L’article se propose d’infirmer la proposition émise par Allen Fromherz dans l’une des dernières livraisons d’Al-Qan?ara d’identifier ?g?l?z-Des-Har?a, lieu de naissance d’Ibn T?mart et premier foyer de la révolution almohade, avec la localité d’?gl? dans la vallée du Sous. Conjuguant étude de la documentation écrite, rappel historiographique des rares études savantes à avoir été consacrées à ce site méconnu, et premiers éléments d’une enquête de géographie historique et d’archéologie en cours, la présente contribution voudrait montrer : 1.º que la théorie de Fromherz est sous-tendue par des erreurs d’appréciation des matériaux historiques utilisés ; 2.º que le village natal d’Ibn T?mart se situe non dans la vallée du Sous, mais dans l’Anti-Atlas central, comme l’avaient déjà bien montré en leur temps Huici Miranda et D. Jacques-Meunié ; 3.º que le site d’?g?l?z-Des-Har?a, dont on avance ici une localisation précise, comprend notamment un lieu fortifié de hauteur qui a servi, lors des premiers affrontements contre les Almoravides, de refuge à Ibn T?mart et aux membres de sa tribu. Une brève description archéologique des vestiges est enfin donnée de ce site jusqu’à ce jour inédit.

    El artículo se propone rebatir la propuesta que planteó Allen Fromherz en uno de los últimos números de Al-Qan?ara, al identificar ?g?l?z-Des-Har?a, lugar de nacimiento de Ibn T?mart y primer foco de la revolución almohade, con la localidad de ?gl?, ubicada en el valle del Sous. Al juntar el estudio de la documentación escrita, la evocación historiográfica de los pocos estudios eruditos dedicados a este yacimiento desconocido, con los primeros elementos de una encuesta de geografía histórica y arqueológica en curso, la presente contribución pretende demostrar : 1.º que la teoría de Fromherz adolece de errores de apreciación de los materiales históricos empleados ; 2.º que el pueblo natal de Ibn T?mart no se ubica en el valle del Sous, sino en el Anti-Atlas central, tal como ya demostraron Huici Miranda y D. Jacques- Meunié ; 3.º que el yacimiento de ?g?l?z-Des-Har?a, del cual se avanza aquí una ubicación precisa, encierra entre otros elementos un lugar fortificado de altura que sirvió de refugio a Ibn T?mart y los miembros de su tribu durante los primeros enfrentamientos contra los Almorávides. Finalmente, se da una breve descripción arqueológica de los vestigios de este yacimiento inédito hasta ahora.

  4. Initial Site-wide Groundwater remediation Strategy of the Hanford Site, WA: Its Application, Lessons Learned and Future Path forward

    International Nuclear Information System (INIS)

    In 1989, the Washington State Department of Ecology (Ecology), the U.S. Environmental Protection Agency (EPA), and the U.S. Department of Energy (DOE) formed an agreement to clean up the Hanford Site, located in the state of Washington. By 1995, the three parties developed an initial comprehensive site wide groundwater remediation strategy with a vision to address contaminated plumes of hazardous and radioactive waste. The Hanford Site has more than 170 square miles of contaminated groundwater. Almost half exceeds the state and federal drinking water standards. The plumes are often commingled. The remediation is challenged by limited technologies, poor understanding of conceptual models, and subsurface contaminant behavior. This paper briefly describes the basic principles of the initial strategy, its application, the results of the decade-long operation, and the future path forward. The initial strategy was based on a qualitative assessment to reduce immediate risk to human health and the environment; to support commonly held values of stakeholders, including tribal nations and the public; and to deploy available remediation technologies. Two different approaches were used for two distinct geographic, the river shore reactor areas and the central plateau few miles away. The strategy was to cleanup the major groundwater plumes in the reactor areas next to the Columbia River where chromium, strontium-90, and uranium already entering the river and to contain the plumes ering the river and to contain the plumes of chlorinated solvents and radionuclides in the central plateau. The strategy acknowledges the lack of cost-effective technologies to address the contaminants, and asked DOE to develop, test, and deploy cost-effective alternative technologies wherever applicable. After more than a decade, the results are mixed. While the pump and treat provided a meaningful approach to address certain contaminants, it was too small in scale. Efforts to scale up these operations enhance characterization, and to deployment innovative technologies are progressing; albeit slowly due to budget constraints. A number of innovative technologies were identified to address source control and groundwater remediation across the Hanford Site. In the 10 years since the initial strategy was developed, additional severe groundwater and vadose zone contaminations were discovered under the waste storage tanks on the central plateau and river corridor areas. These problems required changes to the strategy. Changes include complete integration of vadose zone and groundwater characterization and remediation activities and immediate needs for technologies to address the deep vadose zone source areas, as well as thick aquifer contamination - especially for chlorinated solvents and technetium-99. The successes of the initial strategy show that even a strategy based on incomplete information can make progress on difficult issues. The regulatory agencies identified these issues early and provided the needed direction to DOE to move forward with the overall mission of clean up. The cleanup of the Hanford site is a big challenge, not only for DOE, but also for the regulators, to ensure the tri-party agencies achieve the desired goals. (authors)

  5. Pluralism and ethnic conflict in Tanzania's arid lands: the case of the Maasai and the WaArusha.

    Science.gov (United States)

    Ole Kuney, R O

    1994-01-01

    In Tanzania, the Maasai and Waarusha tribes are experiencing conflict because differences in their modes of productions and economic strategies undermine the peaceful coexistence that they have enjoyed since the 18th century. The Maasai are pastoralists, while the Waarusha are agricultural subsistence farmers who are encroaching on the best pasture lands. A sketch of the history of the two groups shows that the Maasai reached the peak of their land holding in 1880 before the arrival of European colonists who seized land and restricted the Maasai to a semi-arid reserve but allowed the Maasai to remain an autonomous and powerful group. The Waarusha began encroaching on Maasai land after independence due to land and population pressure. While closely tied, each group looks down on the other, and Maasai ascendancy has given way to Waarusha challenges. After independence, the tribal and ethnic rule that was protected by the colonial system was disrupted to allow for increased internal migration and new patterns of settlement. The rights of land ownership were transferred from tribes to the State, allowing privileged groups to benefit. The Waarusha began to engage in illegal land-grabbing and to encroach on the Maasai preserve using legal and illegal means. The Maasai view land as collective property and have had difficulty retaining title of traditional lands in the face of population pressure. This loss of grazing land has forced the Maasai into a mixed economy that depends upon agricultural production as well as livestock production. In the meantime, the Waarusha have deliberately sought political office to gain power to secure their holdings. Immediate action is needed to produce 1) a policy on spontaneous settlement, 2) an immediate adjustment of legal procedures for land acquisition, 3) a land tenure policy that equally emphasizes agricultural and livestock production, and 4) controls on undue expansion of subsistence agriculture into semi-arid rangelands. PMID:12293129

  6. Al-Ma‘had al-Tur?th? wa Taqwim al-Jam?‘ah: Tajribah Ma‘had Hidayatullah

    Directory of Open Access Journals (Sweden)

    Sirojudin Abbas

    2014-03-01

    Full Text Available This article discusses some of the characteristic peculiarities of the pesantren as in Pesantren Hidayatullah, Balikpapan, East Kalimantan, which does not make Arabic reviewing activities as part of the daily staple of his students.During the last three decades, pesantren in Indonesia have shown  a variety of institutional developments. The identification of pesantren as Islamic learning institutions-especially in term of their specific role in preserving intellectual tradition and reproducing 'ilama' may no longer be sufficient to explaint that development. Such a trend can be seen in the establishment of a significant number of Islamic learning institution in the country with different visions and characteristics of learning. One of the leading institutions representing this new form of pesantren is Pesantren Hidayatullah, Balikpapan, East Kalimantan.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v5i2.756

  7. 78 FR 30901 - Record of Decision and Wetland/Floodplain Statement of Findings for the W.A. Parish Post...

    Science.gov (United States)

    2013-05-23

    ...the relatively shallow depths of existing groundwater...wells as compared to the depths of the proposed CO ...increased sedimentation and turbidity in adjacent water bodies...surface water from Smithers Lake than is currently...increased sedimentation and turbidity in...

  8. 77 FR 32943 - Takes of Marine Mammals Incidental to Specified Activities; Pile Driving in the Columbia River, WA

    Science.gov (United States)

    2012-06-04

    ...window if they can be installed during low water periods under dry conditions. Sound...diameter pile in the dry during low water would be similar to the sound levels...window if they can be installed during low water periods under dry conditions....

  9. 76 FR 28505 - Okanogan Public Utility District No. 1 of Okanogan County, WA; Notice of Availability of Draft...

    Science.gov (United States)

    2011-05-17

    ...Low flow periods correspond with low water velocities from which suspended sediments...vegetation establishes along the new low water line; Abandoning and restoring...vegetation establishes along the new low water line. It also proposes to...

  10. 77 FR 58533 - Notice of Availability of the Draft Environmental Impact Statement for the W.A. Parish Post...

    Science.gov (United States)

    2012-09-21

    ...Post-Combustion CO 2 Capture and Sequestration Project, Southeastern...Parish Post-Combustion Carbon Dioxide (CO2) Capture and Sequestration Project (DOE/EIS-0473D...Post-Combustion CO 2 Capture and Sequestration Project (Parish...

  11. Rise Time and Formant Transition Duration in the Discrimination of Speech Sounds: The Ba-Wa Distinction in Developmental Dyslexia

    Science.gov (United States)

    Goswami, Usha; Fosker, Tim; Huss, Martina; Mead, Natasha; Szucs, Denes

    2011-01-01

    Across languages, children with developmental dyslexia have a specific difficulty with the neural representation of the sound structure (phonological structure) of speech. One likely cause of their difficulties with phonology is a perceptual difficulty in auditory temporal processing (Tallal, 1980). Tallal (1980) proposed that basic auditory…

  12. 75 FR 16502 - Notice of Intent to Repatriate Cultural Items: Northwest Museum Whitman College, Walla Walla, WA

    Science.gov (United States)

    2010-04-01

    ...unassociated funerary objects are a stone pestle (Whit-O-0135) and a stone mortar...stone scraper (WHIT-BR-0076); 1 pestle (WHIT-BR-0089); and 13 stone implements...0094). At an unknown date, a stone pestle (Whit-O-0137) was collected at...

  13. Hasbi Ash-Shiddieqy wa Tajd?d al-Fiqh f? Ind?n?s?y?

    Directory of Open Access Journals (Sweden)

    M. Andi Sarjan

    2014-03-01

    Full Text Available Hasbi Ash-Shiddieqy (1904-1975 was a jurist reformer. The assertion may be begging the question: how can a renewal of thought suggests Jurist. Jurisprudence Is not it synonymous with stagnation? The reaction was understandable given the jurisprudence has long been described as Islamic thought static, dogmatic, rigid, and lacking an appreciation of social change. In this paper will be assessed on the role and influence of Hasbi Ash-Shiddieqy particularly among students of Islamic studies because most of his work in the form of text books which became a popular reference them as areas of fiqh, hadith, and 'ulum al-Qur'anCopyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v3i3.802

  14. 76 FR 41237 - Public Utility District No. 1 of Snohomish County, WA; Notice Concluding Pre-Filing Process and...

    Science.gov (United States)

    2011-07-13

    ...by OpenHydro Group Ltd., mounted on completely submerged gravity foundations; (2) two 250-meter service cables connected...2011. environmental assessment. Comments due and 10(j) resolution, January 16, 2012. if...

  15. GigaWaM project overview : high Density WDM-PON based on tunable lasers and VCSEL Arrays

    DEFF Research Database (Denmark)

    Rodes Lopez, Roberto; Gibbon, Timothy Braidwood

    In the poster we present novel hybridized central office and optical network unit technologies for a 64 user WDM-PON, providing 1.25 Gbps bidirectional access over 20 km. Preliminary experimental transmission results are presented, including the possibility of upgrade up to 10 Gbps.

  16. Electronic materials and processes; Proceedings of the Second International SAMPE Electronics Conference, Seattle, WA, June 14-16, 1988

    Science.gov (United States)

    Hoggatt, John T.; Jensen, Warren; Kushner, Morton; McCollough, Stacy

    Various papers on material and process engineering are presented. Materials and processes for high-density circuitry, printed wiring boards, electronic devices, superconductors, surface-mounted assemblies, automated processing, rigid-flex circuity, adhesives for use in electronic assemblies, conformal coatings, and radomes and antennas are discussed.

  17. Solar and temperature treatments affect the ability of human rotavirus wa to bind to host cells and synthesize viral RNA.

    Science.gov (United States)

    Romero-Maraccini, Ofelia C; Shisler, Joanna L; Nguyen, Thanh H

    2015-06-15

    Rotavirus, the leading cause of diarrheal diseases in children under the age of five, is often resistant to conventional wastewater treatment and thus can remain infectious once released into the aquatic environment. Solar and heat treatments can inactivate rotavirus, but it is unknown how these treatments inactivate the virus on a molecular level. To answer this question, our approach was to correlate rotavirus inactivation with the inhibition of portions of the virus life cycle as a means to identify the mechanisms of solar or heat inactivation. Specifically, the integrity of the rotavirus NSP3 gene, virus-host cell interaction, and viral RNA synthesis were examined after heat (57°C) or solar treatment of rotavirus. Only the inhibition of viral RNA synthesis positively correlated with a loss of rotavirus infectivity; 57°C treatment of rotavirus resulted in a decrease of rotavirus RNA synthesis at the same rate as rotavirus infectivity. These data suggest that heat treatment neutralized rotaviruses primarily by targeting viral transcription functions. In contrast, when using solar disinfection, the decrease in RNA synthesis was responsible for approximately one-half of the decrease in infectivity, suggesting that other mechanisms, including posttranslational, contribute to inactivation. Nevertheless, both solar and heat inactivation of rotaviruses disrupted viral RNA synthesis as a mechanism for inactivation. PMID:25862222

  18. 75 FR 5941 - Umatilla National Forest, Walla Walla Ranger District, Walla Walla, WA; Cobbler II Timber Sale...

    Science.gov (United States)

    2010-02-05

    ...structural diversity, stocking densities, and fuel loads. Additionally...management practices. A majority of current forest stands originated as...3-9 inch DBH) and a high density of understory trees still remains...remain in effect until the current Forest Plan is revised....

  19. Smoking, it is slow suicide - aiming for smoking cessation; Kitsuen sore wa kanmannaru jisatsu. Kin'en wo mezashite

    Energy Technology Data Exchange (ETDEWEB)

    Azuma, Keiko [sophia University, Tokyo (Japan)

    1999-02-01

    Toxic substances content rate in the particle phase and the gas phase of paper roll tobacco and included substances in mainstream smoke and sidestream smoke were shown. Delay of information disclosure in developing countries including Japan was introduced along with explanation of the smoking situation in Japan and each country in world in the man and woman independence. As health hazard by smoking, symptom by nicotin, carbon dioxide and included other substances was described separately and smoking cessation countermeasure was introduced. (NEDO)

  20. THE COST OF POSITIONAL NEGOTIATIONS VERSUS COLLABORATIVE OR RELATIONAL NEGOTIATIONS FOR NEGOTIATING COMPLIANCE MILESTONES AT HANFORD WA

    International Nuclear Information System (INIS)

    The Hanford site is subject to the Hanford Federal Facility Agreement and Consent Order (HFFACO), an order on consent signed by the DOE, the U. S. Environmental Protection Agency, (EPA) and the Washington Department of Ecology (WDOE). Under the HFFCCO, negotiations for transition milestones begin within six months after the issuance of a shutdown order. In the case of the PFP, the Nuclear Materials disposition and stabilization activities, a DOE responsibility, were necessary as precursor activities to Transition. This situation precipitated a crisis in the negotiations between the agencies, and formal negotiations initiated in 1997 ended in failure. The negotiations reached impasse on several key regulatory and operational issues. The 1997 negotiation was characterized by a strongly positional style. DOE and the regulatory personnel took hard lines early in the negotiations and were unable to move to resolution of key issues after a year and a half. This resulted in unhappy stakeholders, poor publicity, and work delays as well as wounded relationships between DOE and the regulatory community. The PFP is a former plutonium metal production facility. The operating mission of the PFP ended with a DOE Headquarters shutdown letter in October of 1996. Generally, the receipt of a shutdown letter initiates the start of Transition (as the first step of Decommissioning) of a facility. In the 2000-2001 PFP negotiations, a completely different approach was suggested and eventualferent approach was suggested and eventually initiated: Collaborative or Relational Negotiations. The relational negotiation style resulted in agreement between the agencies on all key issues within 6 months of initiation. All parties were very pleased with the results and all parties were relieved that protracted negotiations sessions were not needed with the new style of working together collaboratively to serve each other's interests without compromising each party's needs. The characteristics of collaborative negotiations included building trust, emphasizing equality of team members, problem solving by the entire team, relying on individual communications, and self-management skills. A specific example of positional negotiations is given with the resultant increase in cost, duration of negotiations, and lingering questions regarding trust among the parties

  1. Integrated Status and Effectiveness Monitoring Program Population Estimates for Juvenile Salmonids in Nason Creek, WA ; 2008 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Matthew; Murdoch, Keely [Yakama Nation Fisheries Resource Management

    2009-07-20

    This report summarizes juvenile coho, spring Chinook, and steelhead salmon migration data collected at a 1.5m diameter cone rotary fish trap on Nason Creek during 2008; providing abundance and freshwater productivity estimates. We used species enumeration at the trap and efficiency trials to describe emigration timing and to estimate the number of emigrants. Trapping began on March 2, 2008 and was suspended on December 11, 2008 when snow and ice accumulation prevented operation. During 2008, 0 brood year (BY) 2006 coho, 1 BY2007 coho, 906 BY2006 spring Chinook, 323 BY2007 fry Chinook, 2,077 BY2007 subyearling Chinook, 169 steelhead smolts, 414 steelhead fry and 2,390 steelhead parr were trapped. Mark-recapture trap efficiency trials were performed over a range of stream discharge stages. A total of 2,639 spring Chinook, 2,154 steelhead and 12 bull trout were implanted with Passive Integrated Transponder (PIT) tags. Most PIT tagged fish were used for trap efficiency trials. We were unable to identify a statistically significant relationship between stream discharge and trap efficiency, thus, pooled efficiency estimates specific to species and trap size/position were used to estimate the number of fish emigrating past the trap. We estimate that 5,259 ({+-} 359; 95% CI) BY2006 Chinook, 16,816 ({+-} 731; 95% CI) BY2007 Chinook, and 47,868 ({+-} 3,780; 95% CI) steelhead parr and smolts emigrated from Nason Creek in 2008.

  2. 75 FR 5626 - Cle Elum Dam Fish Passage Facilities and Fish Reintroduction Project; Kittitas County, WA INT-DES...

    Science.gov (United States)

    2010-02-03

    ...Department of Fish and Wildlife and the Yakama Nation. The Bonneville Power Administration...Fish and Wildlife, in collaboration with Yakama Nation, is evaluating the implementation...Reclamation prevailed in a suit filed by the Yakama Nation concerning the NEPA and...

  3. 77 FR 72337 - Notice of Availability of the Injury Assessment Plan for the Hanford Site, Richland, WA

    Science.gov (United States)

    2012-12-05

    ...Washington, State of Oregon, Confederated Tribes of the Umatilla Indian Reservation, Confederated Tribes and Bands of the Yakama Nation, and Nez Perce Tribe) for conducting the assessment of natural resources exposed to hazardous substances....

  4. 77 FR 13622 - Notice of Intent To Repatriate Cultural Items: Maxey Museum, Whitman College, Walla Walla, WA

    Science.gov (United States)

    2012-03-07

    ...the Confederated Tribes and Bands of the Yakama Nation, Washington; Confederated Tribes...were reported to be repatriated to the Yakama Nation in 1982 (Collins et al. 2001...the Colville, Umatilla, Warm Springs, Yakama and Nez Perce reservations. The...

  5. 77 FR 61781 - Notice of Intent to Repatriate Cultural Items: Maxey Museum, Whitman College, Walla Walla, WA...

    Science.gov (United States)

    2012-10-11

    ...before November 13, 2012. Repatriation of the unassociated funerary objects to the Confederated Tribes and Bands of the Yakama Nation, Washington; Confederated Tribes of the Colville Reservation, Washington; Confederated Tribes of the Umatilla...

  6. WA47?Tweets, hashtags and palliative care: a workshop for social media newbies looking to join the digital revolution.

    Science.gov (United States)

    Noonan, Kerrie

    2015-04-01

    : A recent article in the BMJ highlighted the role of social media has in changing the way we talk about and respond to death and dying. There are so many social media channels do you know which ones are best for communicating about your work? for networking with peers? participating in journal clubs? disseminating research with the international community? What about your local community- how do you increase engagement online to promote your work and events? How can you use social media to source and access interesting content and information about the public health approach? This workshop is designed as a beginner level and new user workshop and is suitable for anyone wanting to be more active in social media. It is designed specifically to focus on social media in relation to the end of life, palliative care and death care online communities. Bring your social media device - your phone, ipad or computer and we will do the following: login and practice communicating with other users develop and implement basic social media goals apply strategies to increase your engagement and effectiveness on social media learn simple ways to measure your reach. Workshop participants will have an opportunity to build confidence and be more effective communicators in social media. You then get to practice your newly learned skills for the remainder of the PHPC Conference. PMID:25960469

  7. 75 FR 20988 - City of Tacoma, WA; Notice of Application for Amendment of License and Soliciting Comments...

    Science.gov (United States)

    2010-04-22

    ...downramping rates) and 409 (timing of planned spill events) to allow for monthly spillway gate testing at the LaGrande Dam from November 1 to February 15. The spillway gate testing is a recommendation of the June 2008 Independent Consultant's...

  8. Living on the Edge? Clumped Isotope and Oxygen Isotope Record of Early Cascade Topography (Eocene Chumstick Basin, WA, USA)

    Science.gov (United States)

    Methner, K.; Mulch, A.; Fiebig, J.; Wacker, U.; Umhoefer, P. J.; Chamberlain, C. P.

    2014-12-01

    The topographic evolution of the world's major orogens exerts a strong impact on atmospheric circulation and precipitation patterns and is a key element in reconstructing the interactions among tectonics, climate, and Earth surface processes. Using carbonate stable and clumped isotope data together with low-temperature thermochronology information from the terrestrial Eocene Chumstick Basin (Central Washington; USA), today located to the East of the Washington Cascades, we investigate the E-W extent of the western North American plateau region and the evolution of Cascade topography. Oxygen isotope measurements of Eocene (51 to 37 Ma) pedogenic carbonate concretions and calcic horizons yield low ?18Ocarbonate values of +9 to +13 ‰ (SMOW) despite the proximity of the Eocene Chumstick Basin to the Pacific moisture source and paleofloral data that indicate moderate elevations and montane rain forest conditions during a warm and rather wet, seasonal climate. This either suggests that 51-37 Ma ago Cascade-like topography characterized the western edge of the North American-Pacific plate margin to the West of the Chumstick Basin or that the ?18Ocarbonate data were variably reset or only formed during burial and diagenesis. Clumped isotope (?47) thermometry of pedogenic carbonate and carbonate concretions (n=11 samples) indicates spatially variable burial temperatures of 80 to 120 °C that correlate with vitrinite reflectance data in these sediments. In concordance with changes in depositional environment the youngest (isotope and clumped isotope data, therefore support models of late Miocene Cascade uplift and provide insight into the topographic configuration of the western North American plate margin prior to the late Miocene.

  9. 75 FR 17402 - Public Utility District No. 1 of Snohomish County, WA; Notice of Preliminary Permit Application...

    Science.gov (United States)

    2010-04-06

    ...pursuant to section 4(f) of the Federal Power Act (FPA), proposing to study the feasibility of the Admiralty Inlet Tidal Energy Project to be located in Admiralty Inlet in the northwestern portion of Puget Sound, between the Olympic...

  10. Mohammad Iqbal, al-?a?arah al-Gharb?yah wa Qa?ay? al-Tajd?d

    Directory of Open Access Journals (Sweden)

    Salahuddin Al-Nadwi

    2014-03-01

    Full Text Available Mohammad Iqbal regarded as one of the most important thinkers of India during the turn of the century. He was born in 1873 in Siyalkote, India. Iqbal came from prominent families and religious. Her father is an educated and progressive figure for the size of the community in his day. Rather than send their children to traditional schools, he would prefer a new school Iqbal entered the English language. Towards Iqbal graduated from high school, his father encouraged him to get into a state university in Lahore, where Iqbal completed Bachelor level (BA in 1897. He specializes in the field of literary Arabic, Persian, and Islamic Studies under the guidance of Shaykh Meer Hassan, a famous intellectual in India.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v2i1.845

  11. Ijtih?d al-‘Ulam?’ al-Ind?n?s?y?n wa Ta?w? al-Fiqh

    Directory of Open Access Journals (Sweden)

    Helmy Karim

    2014-03-01

    Full Text Available Ijtihad as thinking or reasoning to solve problems that can not be found in the detailed explanation of the Qur'an and Sunnah, is an open and universal concept. But in practice ijtihad can not be separated from the situation where and when he was done. Therefore it is very conditional execution diligence, and sometimes very local.In the Indonesian context, ijtihad done them by the Fatwa Commission, the Indonesian Ulema Council (MUI, the issues can not be separated from the context of the Indonesian-ness. Then the extent of ijtihad MUI contribute to the development of Islamic law in both the substance and methodology?Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v1i2.858

  12. 78 FR 34552 - Modification of Class D and Class E Airspace and Establishment of Class E Airspace; Pasco, WA

    Science.gov (United States)

    2013-06-10

    ...extension to a Class D surface area. * * * * * ANM...extending upward from the surface within 3.5 miles each...Tri-Cities Airport 045[deg] bearing extending from the 4...east of the 026[deg] bearing of Richland Airport extending...200 feet above the surface bounded by a line...

  13. 77 FR 49857 - Early Scoping Notification for the Alternatives Analysis of the Tacoma Link Expansion in Tacoma, WA

    Science.gov (United States)

    2012-08-17

    ...transit system and major activity centers. This notice...identification of a preferred mode and corridor. If preparation...with Tacoma's major activity centers and destinations...from regional growth and activity centers in Tacoma and...public transportation modes. The need to...

  14. Weighted averaging partial least squares regression (WA-PLS): an improved method for reconstructing environmental variables from species assemblages

    OpenAIRE

    Braak, C.J.F., ter; Juggins, S (Stephen)

    1993-01-01

    Weighted averaging regression and calibration form a simple, yet powerful method for reconstructing environmental variables from species assemblages. Based on the concepts of niche-space partitioning and ecological optima of species (indicator values), it performs well with noisy, species-rich data that cover a long ecological gradient (>3 SD units). Partial least squares regression is a linear method for multivariate calibration that is popular in chemometrics as a robust alternative to prin...

  15. 33 CFR 165.1321 - Security Zone; Protection of Military Cargo, Captain of the Port Zone Puget Sound, WA.

    Science.gov (United States)

    2010-07-01

    ... Section 165.1321 Navigation and Navigable Waters...WATERWAYS SAFETY REGULATED NAVIGATION AREAS AND LIMITED ACCESS... Specific Regulated Navigation Areas and Limited Access...southeasterly along the shoreline of the Blair...

  16. W.A. Parish Post-Combustion CO{sub 2} Capture and Sequestration Project Phase 1 Definition

    Energy Technology Data Exchange (ETDEWEB)

    Armpriester, Anthony; Smith, Roger; Scheriffius, Jeff; Smyth, Rebecca; Istre, Michael

    2014-02-01

    For a secure and sustainable energy future, the United States (U.S.) must reduce its dependence on imported oil and reduce its emissions of carbon dioxide (CO{sub 2}) and other greenhouse gases (GHGs). To meet these strategic challenges, the U.S. wiU have to create fundamentally new technologies with performance levels far beyond what is now possible. Developing advanced post-combustion clean coal technologies for capturing CO{sub 2} from existing coal-fired power plants can play a major role in the country's transition to a sustainable energy future, especially when coupled with CO{sub 2}-enhanced oil recovery (CO{sub 2}-EOR). Pursuant to these goals, NRG Energy, Inc. (NRG) submitted an application and entered into a cost-shared collaboration with the U.S. Department of Energy (DOE) under Round 3 of the Clean Coal Power Initiative (CCPI) to advance low-emission coal technologies. The objective of the NRG W A Parish Post-Combustion CO{sub 2} Capture and Sequestration Demonstration Project is to establish the technical feasibility and economic viability of post-combustion CO{sub 2} capture using flue gas from an existing pulverized coal-fired boiler integrated with geologic sequestration via an enhanced oil recovery (EOR) process. To achieve these objectives, the project will be executed in three phases. Each phase represents a distinct aspect of the project execution. The project phases are: • Phase I. Project Definition/Front-End Engineering Design (FEED) • Phase ll. Detailed Engineering, Procurement & Construction • Phase III. Demonstration and Monitoring The purpose of Phase I is to develop the project in sufficient detail to facilitate the decision-making process in progressing to the next stage of project delivery. Phase n. This report provides a complete summary of the FEED study effort, including pertinent project background information, the scope of facilities covered, decisions, challenges, and considerations made regarding configuration and performance of the facility, along with the conceptual design and estimate results. The findings of this report should be considered conceptual in nature and are conditioned on the statements contained herein. The cost of preparing this report (including the FEED study described herein) was funded in part by a $167-million grant provided by the U.S. DOE.

  17. Epistemologia Rudolfa Hermanna Lotzego. Obiektywno?? jako epistemiczna wa?no?? [Epistemology of Rudolf Hermann Lotze. Objectivity as epistemic importance

    Directory of Open Access Journals (Sweden)

    Marcin Furman

    2013-09-01

    Full Text Available In the article I am describing epistemology R.H. Lotze’s, which as first entered comprehending the value into language of philosophy. He emphasized the limitation of the human mind in his project. He thought that metaphysics was insufficient as a base for science to arise. Therefore the sphere of the human cognition is supposed to be limited to a system of the importance and its confirmation in experience. As a result of such a thinking, it is necessary to express the cognition through the validity. Namely through the awareness of stretching it what detailed and general.

  18. Canada continues use prohibition of gene recombination cattle somatotropin; Kanada wa idenshikumikaegyu seicho horumon no shiyo kinshi wo keizoku

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-04-05

    Canada continued use prohibition of gene recombination cattle somatotropin (BST) which stimulated milk increased production of this company in spite of request of Monsanto Co.. The cow that BST was administered is based on the report of veterinary surgeon that causes reproductive function and lowering in the life, dysbasia and increase in the mastitis on this. From the research report that BST causes thyroid gland cyst of the male rat in U.S.A., consumer organization and environment group petition FDA for the elimination of BST from the U.S.A. market. In the meantime, Monsanto Co. in the report which Canada adopted, chemical structure is different, and it reports that it uses BST of other company in which dosing method and dosing frequency differ and disregards the report of Cornell university in which the life of the cow administered more and more does not lower BST. (translated by NEDO)

  19. 75 FR 1049 - Public Utility District No. 1 of Snohomish County, WA; Notice of Intent To File License...

    Science.gov (United States)

    2010-01-08

    ...Necessary for Expedited Processing of a Hydrokinetic Pilot Project License Application...Application for an Original License for a Hydrokinetic Pilot Project. b. Project No...application for an original license for a hydrokinetic pilot project and a draft license...

  20. 76 FR 68510 - Grays Harbor Paper, LLC, Including on-site Workers From Barrier West, Inc., Hoquiam, WA; Amended...

    Science.gov (United States)

    2011-11-04

    ...on-site Workers From Barrier West, Inc., Hoquiam...Assistance and Alternative Trade Adjustment Assistance...Assistance and Alternative Trade Adjustment Assistance...that workers from Barrier West, Inc. were...on-site workers from Barrier West, Inc., Hoquiam...Section 223 of the Trade Act of 1974,...

  1. “Nahni wa xfendik” (We and the others: Negotiation of multiple identities in the maronite community of Cyprus

    Directory of Open Access Journals (Sweden)

    Koumarianou Maria

    2011-01-01

    Full Text Available In this study I will examine the negotiation of multiple identities in the Maronite Community of Cyprus which comprises four villages in the occupied territories (Kormakiti, Asomatos, Karpashia, Agia Marina and a large number of displaced population in the area of Nicosia, Larnaca and Limassol, and especially the extent to which some identities are negotiable, while others are not. I will analyze the concept of collective identity in relation to religious and ethnic factors (Maronite, Arab origin vs the Orthodox Cypriots of Greek origin, differences within the community in relation to language (use of a particular Arabic dialect only by the inhabitants of Kormakiti, while other villages speak the Greek-Cypriot dialect and a deliberate identification with Lebanon through Catholicism and similarities in history.

  2. 78 FR 55737 - Notice of Service Delivery Area Designation for the Tejon Indian Tribe

    Science.gov (United States)

    2013-09-11

    ...Confederated Tribes & Bands of the Klickitat, WA, Lewis, WA, Yakama Nation, Washington. Skamania, WA,\\12\\ Yakima, WA. Coquille...for contract health services. \\12\\ Historically part of the Yakama Service Unit population since 1979. \\13\\ Contract...

  3. 75 FR 20608 - Notice of Re-Designation of the Service Delivery Area for the Cowlitz Indian Tribe

    Science.gov (United States)

    2010-04-20

    ...Confederated Tribes & Bands of the Klickitat, WA, Lewis, WA, Yakama Nation, Washington. Skamania, WA,\\12\\ Yakima, WA. Coquille...for contract health services. \\12\\ Historically part of the Yakama Service Unit population since 1979. \\13\\ Contract...

  4. 75 FR 26774 - Notice of Re-Designation of the Service Delivery Area for the Cowlitz Indian Tribe

    Science.gov (United States)

    2010-05-12

    ...Confederated Tribes & Bands of the Klickitat, WA, Lewis, WA, Yakama Nation, Washington. Skamania, WA,\\12\\ Yakima, WA. Coquille...for contract health services. \\12\\ Historically part of the Yakama Service Unit population since 1979. \\13\\ Contract...

  5. 78 FR 55731 - Notice of Service Delivery Area Designation for the Wilton Rancheria

    Science.gov (United States)

    2013-09-11

    ...Confederated Tribes & Bands of the Klickitat, WA, Lewis, WA, Yakama Nation, Washington. Skamania, WA,\\12\\ Yakima, WA. Coquille...for contract health services. \\12\\ Historically part of the Yakama Service Unit population since 1979. \\13\\ Contract...

  6. 78 FR 55743 - Notice of Service Delivery Area Designation for the Shinnecock Indian Nation

    Science.gov (United States)

    2013-09-11

    ...Confederated Tribes & Bands of the Klickitat, WA, Lewis, WA, Yakama Nation, Washington. Skamania, WA,\\12\\ Yakima, WA. Coquille...for contract health services. \\12\\ Historically part of the Yakama Service Unit population since 1979. \\13\\ Contract...

  7. Pioneer 11 observations of trapped particle absorption by the Jovian ring and the satellites 1979, J1, J2, and J3

    International Nuclear Information System (INIS)

    Pioneer 10 and 11, during their encounters with Jupiter in 1973 and 1974, penetrated to L values of 2.8 and 1.7, respectively. During these encounters, at several L values, decreases in the intensity of energetic trapped particles were observed, some of which could be explained as due to absorption by the known moons Io and Amalthea; however, some decreases inside L = 4 could not be explained. The recent Voyager 1 and 2 optical discoveries of several new moons and a ring in this region has led us to reexamine our particle data, and we summarize results in this report. We report observations in three channels: protons 0.5--8.7 MeV; electrons >3.4 MeV; and medium-Z nuclei, probably oxygen and sulfur >70 MeV/nucleon. We find that with the additional moons and the ring, all observed intensity features in the stably trapped radiation are accounted for by satellite and ring absorption

  8. Hydrologic analysis for selection and placement of conservation practices at the watershed scale

    Science.gov (United States)

    Wilson, C.; Brooks, E. S.; Boll, J.

    2012-12-01

    When a water body is exceeding water quality standards and a Total Maximum Daily Load has been established, conservation practices in the watershed are able to reduce point and non-point source pollution. Hydrological analysis is needed to place conservation practices in the most hydrologically sensitive areas. The selection and placement of conservation practices, however, is challenging in ungauged watersheds with little or no data for the hydrological analysis. The objective of this research is to perform a hydrological analysis for mitigation of erosion and total phosphorus in a mixed land use watershed, and to select and place the conservation practices in the most sensitive areas. The study area is the Hangman Creek watershed in Idaho and Washington State, upstream of Long Lake (WA) reservoir, east of Spokane, WA. While the pollutant of concern is total phosphorus (TP), reductions in TP were translated to total suspended solids or reductions in nonpoint source erosion and sediment delivery to streams. Hydrological characterization was done with a simple web-based tool, which runs the Water Erosion Prediction Project (WEPP) model for representative land types in the watersheds, where a land type is defined as a unique combination of soil type, slope configuration, land use and management, and climate. The web-based tool used site-specific spatial and temporal data on land use, soil physical parameters, slope, and climate derived from readily available data sources and provided information on potential pollutant pathways (i.e. erosion, runoff, lateral flow, and percolation). Multiple land types representative in the watershed were ordered from most effective to least effective, and displayed spatially using GIS. The methodology for the Hangman Creek watershed was validated in the nearby Paradise Creek watershed that has long-term stream discharge and monitoring as well as land use data. Output from the web-based tool shows the potential reductions for different tillage practices, buffer strips, streamside management, and conversion to the conservation reserve program in the watershed. The output also includes the relationship between land area where conservation practices are placed and the potential reduction in pollution, showing the diminished returns on investment as less sensitive areas are being treated. This application of a simple web-based tool and the use of a physically-based erosion model (i.e. WEPP) illustrates that quantitative, spatial and temporal analysis of changes in pollutant loading and site-specific recommendations of conservation practices can be made in ungauged watersheds.

  9. A view of the West Hall from the target region

    CERN Multimedia

    1976-01-01

    Beams are being lay out. Starting from the left one sees the S1 and E1A/H1A beam lines pointing to Omega magnet, the H1B beam towards WA3 and WA7 experiments, the hyperon beam Y1, the H3 beam (WA9, WA6, Wa5), the S3 beam to BEBC.

  10. MULTIDISCIPLINARY APPROACH TO STUDY MIGMATITES: ORIGIN AND TECTONIC HISTORY OF THE NASON RIDGE MIGMATITIC GNEISS, WENATCHEE BLOCK, CASCADES CRYSTALLINE CORE, WA, USA

    Directory of Open Access Journals (Sweden)

    Stowell Harold H.

    2008-12-01

    Full Text Available The Nason Ridge Migmatitic Gneiss of the Cascades Core is a migmatitic unit comprising concordant pelitic schist and gneiss, amphibolite, and tonalite gneiss, and cross cutting tonalite, quartz-rich granitoid, and pegmatite. There are several generations of 'igneous' lithologies (leucosomes = tonalite, quartz-rich granitoid, and pegmatite some of which are concordant; others clearly crosscut the strongly deformed host rocks. The host rocks are interpreted to be Chiwaukum Schist with metasedimentary (pelitic schist and some gneiss and metavolcanic(amphibolites origins. Metamorphic fabric in the Nason Ridge Migmatitic Gneiss is characterized by preferred orientation of platy minerals (continuous schistosity, compositional layering, mineral lineations (elongate grains and grain aggregates, and non-coaxial deformational features (asymmetric augen, grain offsets,rotated porphyroblasts, etc.. Compositional layering is characterized by quartz-plagioclase lenses and patches (mm to cm scale and by large variations in biotite content. This composite fabric is faulted and folded by mesoscopic structures. The most strongly foliated leucosomes (gneissic tonalites are generally concordant with the regional trend of foliation, while weakly foliated leucosomes (tonalites and pegmatite veins crosscut host rock and tonalite gneisses. Thin melanosome layers (biotiteand amphibole schist are developed locally around quartz - plagioclase lenses and patches. Metamorphism in the Nason Ridge Migmatitic Gneiss and the nearby Chiwaukum Schist likely peaked after intrusion of the Mt. Stuart Batholith ca. 91-94 Ma. Peak temperatures and pressures for the Nason Ridge Migmatitic Gneiss in the Wenatchee Ridge and Pacific Crest areas were 650 - 720 °C and 6 - 9 kbar with a pressure increase of £ 2.0 kbar during metamorphism. Thermodynamic modeling indicates that hydrous partial melting would begin at ca. 660 °C and is relatively pressure independent. Field and petrographic observations, mineral chemistry and thermobarometry, and bulk rock chemistry and thermodynamic modeling of phase equilibria (pseudosections applied to the Nason Ridge 235Migmatitic Gneiss indicate that at least some of the leucosome bodies were derived by local partial melting. The clearly intrusive character and the sharp contacts between some tonalite leucosome bodies and host rock support an externally derived origin for these tonalite melts. However, some of these bodies may have originated from partial melting of the host Chiwaukum Schist and traveled a short distance before crystallization, or have been modified by deformation so as to obscure textural evidence for local derivation. Results are compatible with derivation of leucosome rocks in the Nason Ridge Migmatitic Gneiss from two non-exclusive processes: partial melting of the host rock and intrusion of externally derived tonalite melts.

  11. NOAA Office for Coastal Management Coastal Inundation Digital Elevation Model: Seattle (WA) WFO - Clallam, Jefferson, Kitsap, Mason, Pierce, and Thurston Counties

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital elevation model (DEM) is a part of a series of DEMs produced for the National Oceanic and Atmospheric Administration Office for Coastal Management's...

  12. VeWa: Investigating effects of Vegetation on Water flows and mixing in northern ecosystems using stable isotopes and conceptual models

    Science.gov (United States)

    Tetzlaff, Doerthe

    2015-04-01

    The lack of comprehensive tracer data sets still hinders the development of a generalized understanding of how northern catchments function hydrologically. Here, we use stable isotope records from precipitation and stream flow to examine the effects of soils and landcover along representative landscape transects in six high-latitude experimental catchments located in the UK, USA, Sweden and Canada. Precipitation and stream flow at each site occupies space on the meteoric water line that broadly reflects latitude. The annual variability of stream water isotopes at each site reflects both the nature (rate and duration) of the spring snowmelt and the relative importance of near-surface and deeper flow paths. This hydrological partitioning also acts a fundamental control on the influence of summer evaporation on stream waters. After accounting for differences in radiation inputs, strongest fractionation is most evident at sites where wet riparian soils with near-surface runoff processes can mobilize evaporated soil water during summer and autumn storms.

  13. In situ biomonitoring of juvenile Chinook salmon (Onchorhynchus tshawytscha) using biomarkers of chemical exposures and effects in a partially remediated urbanized waterway of the Puget Sound, WA

    International Nuclear Information System (INIS)

    In situ biomonitoring has been used to assess the effects of pollution on aquatic species in heavily polluted waterways. In the current study, we used in situ biomonitoring in conjunction with molecular biomarker analysis to determine the effects of pollutant exposure in salmon caged in the Duwamish waterway, a Pacific Northwest Superfund site that has been subject to remediation. The Duwamish waterway is an important migratory route for Pacific salmon and has received historic inputs of polycyclic aromatic hydrocarbons (PAHs) and polychlorinated biphenyls (PCBs). Juvenile pre-smolt Chinook salmon (Oncorhynchus tshawytscha) caged for 8 days in the three contaminated sites in close proximity within the Duwamish were analyzed for steady state hepatic mRNA expression of 7 exposure biomarker genes encompassing several gene families and known to be responsive to pollutants, including cytochrome P4501A (CYP1A) and CYP2K1, glutathione S-transferase ? class (GST-?), microsomal GST (mGST), glutamylcysteine ligase catalytic subunit (GCLC), UDP-glucuronyltransferase family 1 (UDPGT), and type 2 deiodinase (type 2 DI, or D2). Quantitation of gene expression was accomplished by quantitative reverse transcriptase polymerase chain reaction (qRT-PCR) in assays developed specifically for Chinook salmon genes. Gill PAH-DNA adducts were assessed as a chemical effects biomarker using 32P-postlabeling. The biomarkers in the field-caged fish were analyzed with respect to cagedfish were analyzed with respect to caged animals maintained at the hatchery receiving flow-through water. Chemical analysis of sediment samples from three field sampling sites revealed relatively high concentrations of total PAHs in one site (site B2, 6711 ng/g dry weight) and somewhat lower concentrations of PAHs in two adjacent sites (sites B3 and B4, 1482 and 1987 ng/g, respectively). In contrast, waterborne PAHs at all of the sampling sites were relatively low (<1 ng/L). Sediment PCBs at the sites ranged from a low of 421 ng/g at site B3 to 1160 ng/g at site B4, and there were no detectable waterborne PCBs at any of the sites (detection limit=10 ng/L). There were no significant differences (p<0.05) in biomarker gene expression in the Duwamish-caged fish relative to controls, although there was a pattern of gene expression suppression at site B3, the most heavily PAH-enriched site. The lack of a marked perturbation of mRNA biomarkers was consistent with relatively low levels of gill PAH-DNA adduct levels that did not differ among caged reference and field fish, and which were also consistent with relatively low waterborne concentrations of chemicals. The results of our study suggest a low bioavailability of sediment pollutants in caged juvenile Chinook potentially reflecting low waterborne exposures occurring at contaminated sites within the Duwamish waterway that have undergone partial remediation.

  14. Precedent, commentary, and legal rules in the Madhhab-Law tradition: Ibn Qu?l?bugh?'s (d. 879/1474) al-Ta???? wa-al-tarj??

    OpenAIRE

    Al-azem, Talal; Melchert, Christopher

    2011-01-01

    This thesis examines the role that scholarly digests and commentaries played in the formation of legal rules in the Muslim legal institution known as the madhhab. I posit that a shared approach to legal rule-determination, and the respect of juristic precedent that it entails, underlies the jurisprudential processes of all of the four post-classical Sunni madhhabs (the ?anaf?, M?lik?, Sh?fi'?, and ?anbal?), and unites them in a wider ‘madhhab-law tradition’. Taking the ?an...

  15. Studies on the separation between higher-twist and minimum-twist in the photoproduction experiment WA69 at the CERN-OMEGA spectrometer

    International Nuclear Information System (INIS)

    A Lund type Monte Carlo program (LUCIFER) is used to describe in perturbative QCD the pointlike component of the photon interacting on a hydrogen target. Kinematical and topological variables are developed to enhance higher twist events on the lowest order minimum twist background. The emphasis is laid on ?±, K± higher twist mesons. (orig.)

  16. Physical and chemical mutagenesis of early mutant of indica restorers in ''WA'' (wild abortion) hybrid rice system and genetic analysis of mutants in heterosis utilization

    International Nuclear Information System (INIS)

    The four indica restorers in the wild abortion hybrid rice system were treated with physical and chemical mutagens, and the mutation frequency in the M2 generation and the correlation between the heading date of the mutants and other characters were investigated

  17. Directional wave and temperature data from three buoys at Grays Harbor, WA, Pt. Reyes, CA, and Diablo Canyon, CA, 2002 - 2003 (NODC Accession 0001058)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Data Information Program (CDIP) is an extensive network for monitoring waves along the coastlines of the United States, with a strong emphasis on our...

  18. Puget Sound, WA (P290) Bathymetric Digital Elevation Model (30meter resolution) Derived From Source Hydrographic Survey SoundingsCollected by NOAA

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry for Puget Sound was derived from eighty-eight surveyscontaining 930,967 soundings. There were thirty-nine older,overlapping, less accurate surveys that...

  19. Hanford facility dangerous waste Part A, Form 3, and Part B permit application documentation for the Central Waste Complex (WA7890008967) (TSD: TS-2-4)

    International Nuclear Information System (INIS)

    The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating, treatment, storage, and/or disposal units, such as the Central Waste Complex (this document, DOE/RL-91-17). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needed by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. A checklist indicating where information is contained in the Central Waste Complex permit application documentation, in relation to the Washington State Department of Ecology guidance, is located in the Contents section. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the Central Waste Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this Central Waste Complex permit application documentation is current as of May 1998

  20. Current Problems of Education and Proposals for Improvement in Tai Nationality Schools in Gengma Tai-Wa Nationalities Autonomous County, Yunnan.

    Science.gov (United States)

    Zhang, Yuanqing

    1989-01-01

    Identifies current problems of education and proposes means for improving Tai nationality schools. Discusses the language problem, the quality of teachers, budgeting concerns, and effects caused by cultural uniqueness. Offers specific ways to overcome these problems and improve the educational level of Tai nationality students. (KO)

  1. NOAA Office for Coastal Management Coastal Inundation Digital Elevation Model: Seattle (WA) WFO - Whatcom, San Juan, Skagit, Island, Snohomish, and King Counties

    National Oceanic and Atmospheric Administration, Department of Commerce — This digital elevation model (DEM) is a part of a series of DEMs produced for the National Oceanic and Atmospheric Administration Office for Coastal Management's...

  2. ‘Al?qat ?arakat Nashr al-Isl?m wa al-Tarb?yah al-Isl?miyyah f? ?ultanah Aceh

    Directory of Open Access Journals (Sweden)

    Eri Rosatria

    2014-03-01

    Full Text Available The emergence of such great 'ulama' in the Sultanate of Aceh, north of Sumatra, as Hamzah Fansuri (Hamzah al-Fansuri, Syamsuddin Sumatrani (Shams al-Din al-Sumatrani, Nuruddin Arraniri (Nur al-Din al-Raniri and Abdurrauf Singkel ('Abd al-Rauf al-Sinkili could lead one to pose an important questions. Why they emerged in the Sultanate of Aceh and not in other part of Nusantara. This study argues that that their emergence had closely to do with the fact that activity of Islamic learning was strongly supported by the Acehnese sultans.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v3i1.815

  3. Al-Madh?hib al-??f?yah f? Falimb?nj f? al-Qarnayn al-Th?min ‘Ashr wa al-T?si’ ‘Ashr

    Directory of Open Access Journals (Sweden)

    Ahmad Syahid

    2014-03-01

    Full Text Available This article attempts to trace the Islamic intellectual tradition of Palembang praying particular attention to the scholarly form that was shaped and molded by the Ulama. In addition, this article attempts to identify the characteristics of the Palembang Ulama, and draw comparisons between this group and the Ulama of the earlier Sufi period in Aceh. Of the several Ulama of Palembang who are the focus of this article, the most important are Shihab al-Din bin 'Abd Allah Muammad, Kemas Fakbr al-Din, Muhammad Muhyi al-Din, and of course, the most prominent, 'Abd al-Samad al-Falimbaani.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v8i2.690

  4. Directional wave and temperature data from four buoys at Grays Harbor, WA and Point Reyes, Harvest and Diablo Canyon, CA, January - December 2003 (NODC Accession 0001291)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Coastal Data Information Program (CDIP) is an extensive network for monitoring waves along the coastlines of the United States, with a strong emphasis on our...

  5. R?bi?ah al-Muthaqqaf?n al-Muslim?n al-Ind?n?s?yah: Khalf?yatuh? wa Tum?h?tuh?

    Directory of Open Access Journals (Sweden)

    Badri Yatim

    2014-05-01

    Full Text Available The Islamization of the legislative and the cabinet in Indonesia after the general election in 1992 has indeed provided interesting news. This is because of the old myth that the Muslim ummah are always opposed to the goverment. What is the driving force behind the change?Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v1i1.870

  6. Annual Report: 2011-2012 Storm Season Sampling, Non-Dry Dock Stormwater Monitoring for Puget Sound Naval Shipyard, Bremerton, WA

    Energy Technology Data Exchange (ETDEWEB)

    Brandenberger, Jill M.; Metallo, David; Rupert, Brian; Johnston, Robert K.; Gebhart, Christine

    2013-07-03

    Annual PSNS non-dry dock storm water monitoring results for 2011-2012 storm season. Included are a brief description of the sampling procedures, storm event information, laboratory methods and data collection, a results and discussion section, and the conclusions and recommendations.

  7. Annual Report: 2010-2011 Storm Season Sampling For NON-DRY DOCK STORMWATER MONITORING FOR PUGET SOUND NAVAL SHIPYARD, BREMERTON, WA

    Energy Technology Data Exchange (ETDEWEB)

    Brandenberger, Jill M.; Metallo, David; Johnston, Robert K.; Gebhardt, Christine; Hsu, Larry

    2012-09-01

    This interim report summarizes the stormwater monitoring conducted for non-dry dock outfalls in both the confined industrial area and the residential areas of Naval Base Kitsap within the Puget Sound Naval Shipyard (referred to as the Shipyard). This includes the collection, analyses, and descriptive statistics for stormwater sampling conducted from November 2010 through April 2011. Seven stormwater basins within the Shipyard were sampled during at least three storm events to characterize non-dry dock stormwater discharges at selected stormwater drains located within the facility. This serves as the Phase I component of the project and Phase II is planned for the 2011-2012 storm season. These data will assist the Navy, USEPA, Ecology and other stakeholders in understanding the nature and condition of stormwater discharges from the Shipyard and inform the permitting process for new outfall discharges. The data from Phase I was compiled with current stormwater data available from the Shipyard, Sinclair/Dyes Inlet watershed, and Puget Sound in order to support technical investigations for the Draft NPDES permit. The permit would require storm event sampling at selected stormwater drains located within the Shipyard. However, the data must be considered on multiple scales to truly understand potential impairments to beneficial uses within Sinclair and Dyes Inlets.

  8. Al-Shaykh A?mad al-Rif?‘? wa Siy?q?yat al-Shar?‘ah al-Islam?yah: Dir?sah ‘alá Kitab Takhyirah

    Directory of Open Access Journals (Sweden)

    M. Adib Misbachul Islam

    2012-04-01

    Full Text Available Kitab Takhyirah is a tarjumah book comprises of Kiai Ahmad Rifa'i Kalisalak's thoughts on Islam from its various aspects, such as 'aqidah, shari'ah, and akhlaq. The book consists about ideas that can be considered provocative in the context of Islamic thinking in the nineteenth century especially in Java and generally in Nusantara. Through Takhyirah, Kiai Ahmad Rifa'i has disseminated his notions on the unification of the various doctrinal aspects of Islam. He is different from the general ulama who tend to separate one aspect of Islam with other aspects. For example, Kiai Ahmad Rifa'i argued that Islamic syariah includes usul (akidah aspect, fiqh (Islamic law aspect, and tasawuf (akhlak and spiritual aspect.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v19i1.372 

  9. Columbia River, WA/OR (P260) Bathymetric Digital ElevationModel (30 meter resolution) Derived From Source Hydrographic SurveySoundings Collected by NOAA

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry for the Columbia River was derived from forty-five surveys containing306,711 soundings. Nine older, overlapping, less accurate surveys wereomitted before...

  10. Hanford facility dangerous waste Part A, Form 3 and Part B permit application documentation, Central Waste Complex (WA7890008967)(TSD: TS-2-4)

    Energy Technology Data Exchange (ETDEWEB)

    Saueressig, D.G.

    1998-05-20

    The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating, treatment, storage, and/or disposal units, such as the Central Waste Complex (this document, DOE/RL-91-17). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needed by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. A checklist indicating where information is contained in the Central Waste Complex permit application documentation, in relation to the Washington State Department of Ecology guidance, is located in the Contents section. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the Central Waste Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this Central Waste Complex permit application documentation is current as of May 1998.

  11. Willapa Bay, WA (P270) Bathymetric Digital Elevation Model(30 meter resolution) Derived From Source Hydrographic SurveySoundings Collected by NOAA

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry for Willapa Bay was derived from eleven surveys containing 75,491soundings. Four older, less accurate, overlapping surveys were entirelyomitted before...

  12. Molao wa thireletso ya leago ka mo go ditshaba tšeo di hlabologago ta borwa bja Afrika / Code on social security in the Southern African development community

    Scientific Electronic Library Online (English)

    Letlhokwa George, Mpedi.

    Full Text Available The Code on Social Security in the Southern African Development Community (Code) was approved by the Integrated Committee of Ministers in June 2007 in Windhoek Namibia. This contribution critically examines how the Code attempts to develop sound social security systems in the Southern African Develo [...] pment Community (SADC) region. It pays special attention to the approach adopted by the Code in its quest to address pertinent issues such as the right to social security, social protection framework, and social risks as well as vulnerable groups and categories of persons protected. It concludes by observing that the ratification record of SADC member states of the officially current conventions in the field of social security is unsatisfactory. Accordingly, member states must be encouraged to ratify these important instruments. Secondly, preventative and (re)integrative measurers are a part and parcel of a social security system. Thus, the call by the Code for the introduction of these measures is to be welcomed. Furthermore, social security coordination is an integral part of regional integration and the free movement of labour and persons. To this end, the provisions in the Code aimed at these matters are timely. Finally, the Code is not legally binding. Nonetheless, its adoption is commendable for it is a right step towards the improvement of social security systems in the SADC region which are largely undeveloped and, in some instances, underdeveloped.

  13. Studies on the reaction ?p ? ?+?-p at the experiment WA69 in the energy range from 60 to 170 GeV

    International Nuclear Information System (INIS)

    In the present thesis the reaction ?p ? ?+?-p was studied. The ?(770) was analyzed by means of events in which the detectors and the reconstruction programs have detected the recoil proton. The cross section of the ? production process was determined. The values for the cross section ? (p ? ?(770)p) lie typically at (5.3(+1.6-0.5) ?b. The extrapolation of the differential cross section d?/dt to t=0 yields at a slope parameter b of (6.9±1) GeV2 a value of 65±20) ?b/GeV2 a value of (65±20) ?b/GeV2 and a cross section of ?(?p ? ?(770)p) (9.3±3) ?b. The decay angular conservation. The spin-density matrix elements ?1,-1 and Re(?1,0) are in the mass range of the ? in the framework of the measuring accuracy equal to zero, the ?0,0 lies with a value of 0.09±0.02 a little above. The reaction ? p ? ?p studied with the same data on the decay into 2 kaons was measured with a cross section ?(? p ? ?(? K+K-)p) of (107(+35-12) nb. In the mass range of the ?(1600) both in the data with reconstructed proton and in the data where only the 2 pions were to be detected a significant signal is to see. (orig./HSI)

  14. Impact of afforestation on long term 137Cs and 90Sr recycling from a wa burial in the Chernobyl Red Forest

    International Nuclear Information System (INIS)

    Following the Chernobyl reactor fire in April 1986, acute irradiation caused complete decay of pine trees in forest located in direct vicinity of ChNPP. The so-called 'Red Forest' is still today one of the most contaminated terrestrial ecosystems on earth. Emergency clean-up activities consisted of in situ burial of contaminated topsoil layers and dead trees in about two hundred sub-surface trenches involving 1 million m3 of radioactive materials. The trenches of Red Forest waste dump were then covered with 20-30 cm layer of 'clean' sand and the site was revegetated with a mixture of pine, birch and bushes to prevent secondary contamination due to soil erosion or wind resuspension. Large uncertainties are associated with the functioning of that improvised repository which remains a source of radio-nuclides (RN) dispersion into the environment. In particular, the role of new forest plantations as a long term stabilization factor of the radioecological situation in the afforested waste burial zone is questioned. With forest growth, future risk of radioactivity dissemination may involve the root uptake of bio-available radio-nuclides from deep layers in addition to the leaching of RN with downwards water fluxes. Our investigation aimed to assess the fraction of activity which could be extracted from the trenches due to root uptake by trees and further involved in natural biological cycles. For that purpose, we compared the transfer of 90Sr and the transfer of 90Sr and 137Cs to 15 years-old Scots pine trees (Pinus sylvestris L.) growing at the Chernobyl Pilot, Site, directly on the trench no.22 and outside the trench. The radio-nuclide flux and migration were studied and annual fluxes for 137Cs and 90Sr determined (author)(tk)

  15. WA40?The good neighbour partnership: why do we need it? who is going to do it? how on earth are we going to evaluate it?

    Science.gov (United States)

    McLoughlin, Kathleen; Rhatigan, Jim; McGilloway, Sinead; Callinan, Joanne; Wright, Marie; Kellehear, Allan; Lucey, Michael; Conroy, Marian; Twomey, Feargal; Kumar, Suresh; Herrera-Mollina, Emillio; Furlong, Mairead; Watson, Max; Currow, David; Bailey, Christopher

    2015-04-01

    : This one-hour symposium considers Milford Care Centre's Compassionate Communities Good Neighbour Partnership and it's evaluation by an international team, led by Maynooth University and funded by the All Ireland Institute of Hospice and Palliative Care, The Irish Cancer Society, The Irish Hospice Foundation and Milford Care Centre. The symposium will be divided into three sections: 1. The Good Neighbour Partnership: Why do we need it? In this section we will describe the findings from a recent scoping study to determine the social and practical needs of community dwelling adults (and their families) living with advanced life limiting illness at home. We will consider the rationale for specialist palliative care services, working with community groups, to lead the development of a volunteer-based social model of care to address unmet need. 2. The Good Neighbour Partnership: How do we recruit and train volunteers? We will share our process and experience of recruiting and training 15 Compassionate Communities Volunteers to assess unmet social and practical need, and to mobile the person's circle of community to meet those needs. An understanding of the motivating factors of volunteers will be shared. 3. The Good Neighbour Partnership: How on earth are we going to evaluate it? Here we describe the INSPIRE study - Investigating Social and Practical Supports at the End of life. An exploratory delayed intervention randomised controlled trial (framed by the MRC Framework for Complex Interventions) to assess the feasibility, acceptability and potential effectiveness of the Good Neighbour Partnership. PMID:25960462

  16. OR/WA Environmental contaminants in fish eating birds from the Lewis and Clark NWR and Ridgefield NWR along the Columbia River

    US Fish and Wildlife Service, Department of the Interior — Great blue heron Ardea herodias eggs and prey items were collected from six colonies on the Columbia and Willamette rivers and Puget Sound during 199495....

  17. WA - Investigation of contaminants in feeds and fish at FWS Pacific Region National Fish Hatcheries and the ramifications to human and ecological health

    US Fish and Wildlife Service, Department of the Interior — Returning adult salmon and steelhead were sampled at three National Fish Hatcheries NFHs; Warm Springs NFH spring Chinook, Oncorhynchus tshawytscha, Quilcene NFH...

  18. [Cloning and expression analysis of drought-tolerant and wa-ter-saving related gene PmMYB in broomcorn millet].

    Science.gov (United States)

    Hu, Yin-Gang; Lin, Fan-Yun; Wang, Shi-Qiang; He, Bei-Ru

    2008-03-01

    Exploring novel genes and gene combinations are of primary importance in plant drought-tolerance and water-saving research. Based on the EST sequence of MYB gene obtained in the research on molecular basis of drought-tolerance and water-saving in broomcorn millet (Panicum miliaceum L.), a 1 739 bp genomic sequence of MYB gene, designated PmMYB, was amplified using primers based on this EST sequence and that of rice MYB18. Sequence analysis indicated that PmMYB consisted of 2 introns, 121 bp (347-467 bp) and 93 bp (599-691 bp) in length respectively, and 3 extrons. The full-length cDNA sequence of PmMYB is 1 525 bp, which includes 212 bp 3' untranslated region, 41 bp 5' untranslated region, and 1 272 bp coding region which encodes 424 amino acids with a serine-rich region. PmMYB is a typical R2, R3-MYB transcription factor with its 2 typical DNA-binding domains (amino acid sites of 13-63 and 66-114). The multiple alignment of R2, R3 amino acid repeat regions of MYB genes among broomcorn millet, rice, corn, loblolly pine, Arabidopsis, capsicum, upland cotton, barley and aubergine indicates that R2, R3 repeat regions are very conserved. The phylogenetic analysis based on amino acid sequence shows that MYB genes are highly divergent with similarity ranging from 32% to 84%. PmMYB has the highest similarity (84%) with MYB18 gene of rice, whereas 46% and 41% with barley and corn, respectively. Semi-quantitative RT-PCR confirmed that PmMYB was upregulated by water stress and re-watering in broomcorn millet. Cloning this gene may provide a good foundation to improve the drought-tolerance and water-saving in broomcorn millet as well as in other plants. PMID:18332009

  19. AFSC/ABL: Chum salmon length and weight monitoring at Fish Creek (Hyder, AK), Chilkat River (Haines, AK), Olsen Creek (Cordova, AK), and Quilcene River (Quilcene, WA)

    National Oceanic and Atmospheric Administration, Department of Commerce — Changes in size and age at maturity of chum salmon (Oncorhynchus keta) were monitored for two locations in North America. Chum salmon spawners returning to Fish...

  20. MULTIDISCIPLINARY APPROACH TO STUDY MIGMATITES: ORIGIN AND TECTONIC HISTORY OF THE NASON RIDGE MIGMATITIC GNEISS, WENATCHEE BLOCK, CASCADES CRYSTALLINE CORE, WA, USA

    Scientific Electronic Library Online (English)

    Carlos A., Zuluaga C.; Harold H., Stowell.

    2008-12-01

    Full Text Available La unidad "Nason Ridge Migmatitic Gneiss" del "Cascades Core" (NW de los Estados Unidos) es una unidad migmatítica que comprende esquisto y gneis pelítico, anfibolita, gneis tonalítico y tonalita concordantes y tonalita, granitoide cuarzoso y pegmatita discordantes. Hay varias generaciones de litolo [...] gías ígneas (leucosomas = tonalita, granitoide cuarzoso, y pegmatita) algunos de las cuales son concordantes; otras claramente cortan la roca caja que está fuertemente deformada. La roca caja se interpreta ser la unidad "Chiwaukum Schist" que es una unidad metasedimentaria (esquisto pelítico y algunos gneises) y metavolcánica (anfibolitas). La fábrica metamórfica en el Nason Ridge Migmatitic Gneiss está caracterizada por la orientación preferencial de minerales micáceos (esquistosidad continua), bandeamiento composicional, lineación mineral (granos y agregados elongados), y rasgos de deformación no-coaxial (augen asimétrico, granos cortados y desplazados, porfiroblastos rotados, etc.). El bandeamiento composicional está caracterizado por lentes y parches (a escala milimétrica y centimétrica) de cuarzo y plagioclasa y por variaciones grandes en contenido de biotita. Esta fabrica compuesta esta fallada y plegada por estructuras mesoscópicas. Los leucosomas con foliación más pronunciada (tonalitas gnéisicas) son generalmente concordantes con la tendencia regional de la foliación, mientras que los leucosomas débilmente foliados (tonalitas) y las venas de pegmatita cortan la roca caja y el gneis tonalítico. Capas delgadas de melanosoma (esquisto de biotita y de anfíbol) se desarrollan localmente alrededor de los lentes y parches de cuarzo y plagioclasa. El pico del metamorfismo en el Nason Ridge Migmatitic Gneiss y en el Chiwaukum Schist probablemente ocurrió después de la intrusión del batolito "Mt. Stuart" (ca. 91-94 Ma.). Las temperaturas y las presiones del pico del metamorfismo en las regiones de "Wenatchee Ridge" y del "Pacific Crest" fueron 650-720 °C y 6-9 kbar con un aumento de presión de ? 2.0 kbar durante el metamorfismo. El modelamiento termodinámico indica que la fusión parcial acuosa comenzaría aproximadamente a 660 °C y que esta temperatura es relativamente independiente de la presión. Observaciones de campo y petrográficas, química mineral y estimaciones termobarométricas, y la química de roca total y modelos termodinámicos de equilibrios de fases (pseudosecciones) aplicados al Nason Ridge Migmatitic Gneiss indican que por lo menos algunos de los cuerpos de leucosoma fueron derivados por fusión parcial local. El carácter claramente intrusivo y los contactos abruptos entre algunos cuerpos de tonalita y la roca caja apoyan un origen externo para estos fundidos de tonalita. Sin embargo, algunos de estos cuerpos pudieron haberse originado por fusión parcial del Chiwaukum Schist y haber viajado una distancia corta antes de la cristalización, o pueden haber sido modificados por deformación y así oscurecer la evidencia textural que indicaría derivación local. Los resultados mostrados aquí son compatibles con derivación de leucosomas en el Nason Ridge Migmatitic Gneiss a partir de dos procesos no exclusivos: fusión parcial de la roca caja e intrusión de fundidos tonaliticos derivados externamente. Abstract in english The Nason Ridge Migmatitic Gneiss of the Cascades Core is a migmatitic unit comprising concordant pelitic schist and gneiss, amphibolite, and tonalite gneiss, and cross cutting tonalite, quartz-rich granitoid, and pegmatite. There are several generations of 'igneous' lithologies (leucosomes = tonali [...] te, quartz-rich granitoid, and pegmatite) some of which are concordant; others clearly crosscut the strongly deformed host rocks. The host rocks are interpreted to be Chiwaukum Schist with metasedimentary (pelitic schist and some gneiss) and metavolcanic (amphibolites) origins. Metamorphic fabric in the Nason Ridge Migmatitic Gneiss is characterized by preferred orientation of platy minerals (continuous schistosity), composition

  1. 1998 BPA habitat projects completed within the Asotin Creek Watershed, WA; Ridge-Top to Ridge-Top Habitat Projects; 1998 BPA Completion Report - November 1999

    International Nuclear Information System (INIS)

    The Asotin Creek Model Watershed Program (ACMWP) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The Asotin Creek watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington. Snake River spring chinook salmon, summer steelhead and bull trout, which are listed under the Endangered Species Act (ESA), are present in the watershed. The ACMWP began coordinating habitat projects in 1995. Approximately two hundred forty-six projects have been implemented through the ACMWP as of 1998. Fifty-nine of these projects were funded in part through Bonneville Power Administration's 1998 Columbia Basin Fish and Wildlife Program. These projects used a variety of methods to enhance and protect watershed conditions. In-stream work for fish habitat included construction of hard structures (e.g. vortex rock weirs), meander reconstruction, placement of large woody debris (LWD) and whole trees and improvements to off-channel rearing habitat; one hundred thirty-nine pools were created with these structures. Three miles of stream benefited from riparian improvements such as fencing, vegetative plantings, and noxious weed control. Two alternative water developments were completed, providing off-stream-watering sources for livestock. 20,500 ft of upland terrace construction, seven sediment basin construction, one hundred eighty-seven acres of grass seeding, eight hundred fifty acres of dis seeding, eight hundred fifty acres of direct seeding and eighteen sediment basin cleanouts were implemented to reduce sediment production and delivery to streams in the watershed

  2. 77 FR 63829 - Product Cancellation Order for Certain Pesticide Registrations

    Science.gov (United States)

    2012-10-17

    ...Inc., P.O. Box 18300, Greensboro, NC 27419- 8300. OR000023; WA000003..................... GB Biosciences Corporation, 410 Swing Road, P.O. Box 18300, Greensboro, NC 27419-5458. WA030013; WA030017;...

  3. Lake Roosevelt White Sturgeon Recovery Project : Annual Progress Report, January 2003 – March 2004.

    Energy Technology Data Exchange (ETDEWEB)

    Howell, Matthew D.; McLellan, Jason G. [Washington Department of Fish and Wildlife

    2009-07-15

    This report summarizes catch data collected from white sturgeon Acipenser transmontanus in Lake Roosevelt during limited setlining and gill netting activities in the fall of 2003, and documents progress toward development of a U.S. white sturgeon conservation aquaculture program for Lake Roosevelt. From 27-30 October, 42 overnight small mesh gill net sets were made between Marcus and Northport, WA for a total catch of 15 juvenile white sturgeon (275-488 mm FL). All sturgeon captured were of Canadian hatchery origin. These fish had been previously released as sub-yearlings into the Canadian portion (Keenleyside Reach) of the Transboundary Reach of the Columbia River during 2002 and 2003. Most sturgeon (n=14) were caught in the most upstream area sampled (Northport) in low velocity eddy areas. Five fish exhibited pectoral fin deformities (curled or stunted). Growth rates were less than for juvenile sturgeon captured in the Keenleyside Reach but condition factor was similar. Condition factor was also similar to that observed in juvenile sturgeon (ages 1-8) captured in the unimpounded Columbia River below Bonneville Dam between 1987-92. From 10-14 November, 28 overnight setline sets were made in the Roosevelt Reach between the confluence of the Spokane River and Marcus Island for a total catch of 17 white sturgeon (94-213 cm FL). Catch was greatest in the most upstream areas sampled, a distribution similar to that observed during a WDFW setline survey in Lake Roosevelt in 1998. The mean W{sub r} index of 110% for fish captured this year was higher than the mean W{sub r} of 91% for fish captured in 1998. Excellent fish condition hindered surgical examination of gonads as lipid deposits made the ventral body wall very thick and difficult to penetrate with available otoscope specula. Acoustic tags (Vemco model V16 coded pingers, 69 kHz, 48-month life expectancy) were internally applied to 15 fish for subsequent telemetry investigations of seasonal and reproductively motivated movements. In August 2003, three Vemco VR2 fixed station acoustic receivers, supplied by the UCWSRI Transboundary Telemetry Project, were deployed in the vicinities of Kettle Falls Bridge, Marcus Island, and Northport, WA. Data downloaded from these receivers through December 2003 confirmed the findings of a previous telemetry study that the Marcus area is an important overwintering habitat for white sturgeon. On 18 February 2004, juvenile white sturgeon (n=2,000) were transported from Kootenay Sturgeon Hatchery in British Columbia to WDFW Columbia Basin Hatchery (CBH) in Moses Lake, WA. Fish were reared at CBH to approximately 30 g and individually outfitted with PIT tags and scute marked. On 11 May 2004, fish were released into Lake Roosevelt in the vicinities of Kettle Falls Bridge, North Gorge, and Northport.

  4. 40 CFR 80.215 - What is the scope of the geographic phase-in program?

    Science.gov (United States)

    2010-07-01

    ...Valley, Ely Colony, Fort Apache, Fort McDermitt, Goshute, Haulapai, Havasupai, Hopi, Kalispel, Navajo, Pine Ridge, Rosebud, Yakama, San Carlos, Spokane, Standing Rock, Summit Lake, Te-Moak, Umatilla, Winnemucca. (3) Contiguous tribal...

  5. 75 FR 47681 - Migratory Bird Hunting; Proposed Migratory Bird Hunting Regulations on Certain Federal Indian...

    Science.gov (United States)

    2010-08-06

    ...was primarily a salmon people; upon completion of Grand Coulee Dam creating Lake Roosevelt, the development of hydroelectricity without passage ultimately removed salmon access from historical fishing areas for the Spokane Tribe for the...

  6. Habitat Evaluation Procedures (HEP) Report : Grand Coulee Dam Mitigation, 1996-1999 Technical Report.

    Energy Technology Data Exchange (ETDEWEB)

    Kieffer, B.; Singer, Kelly; Abrahamson, Twa-le

    1999-07-01

    The purpose of this Habitat Evaluation Procedures (HEP) study was to determine baseline habitat units and to estimate future habitat units for Bonneville Power Administration (BPA) mitigation projects on the Spokane Indian Reservation. The mitigation between BPA and the Spokane Tribe of Indians (STOI) is for wildlife habitat losses on account of the construction of Grand Coulee Dam. Analysis of the HEP survey data will assist in mitigation crediting and appropriate management of the mitigation lands.

  7. Jadwal A‘m?l al-A?z?b al-Isl?m?yah f? Indonesia al-Mu‘??irah: Bayn al-Shar?‘ah wa al-D?m?qrat?yah

    Directory of Open Access Journals (Sweden)

    Tasman Tasman

    2013-04-01

    Full Text Available This article discusses the responses of the proponents of political Islam toward the downfall of New Order regime and in creating political power at grassroots level. This trend has been marked by the demand to include those ‘seven words’ of the Jakarta Chapter of 1945 into the constitution. This aspiration has been represented by three major Islamic parties: United Development Party (PPP; the Crescent Star Party (PBB; and the Justice Party (PK. However, this political Islam aspiration has also been expressed by Muslim–based parties, namely the Nation’s Awakening Party (PKB and the National Mandate Party (PAN. These two parties represent Indonesia’s largest Muslim organisations, Nahdlatul Ulama (NU and Muhammadiyah respectively. PKB and PAN do not have agendas to implement Islamic shar?‘ah. The two parties consider that, theoretically, a relation between Islam and politics exists but not in the formal sense of a governmental system.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v20i1.351 

  8. POPs and stable isotopes in bird and forage fish tissues (Persistent organic pollutant levels in juvenile salmonids, forage fish and their avian predators from Puget Sound and the outer WA coast)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is examining contaminant loads of fish prey species of a resident marine bird (Rhinoceros Auklet) breeding in inland waters (Puget Sound) and in the...

  9. Al-Jinr?l S?dirm?n wa Ar?’uhu f? al-Dif?’ ‘an al-Dawlah al-Jumh?r?yah al-Ind?n?s?yah

    Directory of Open Access Journals (Sweden)

    Faruq Nasution

    2007-04-01

    Full Text Available This article provides biography of the great General Soedirman (born 24 January 1916, one of the key figures in the fight for Indonesia's independence. one of the more interesting aspects of this article is how it looks at Soedirman's youth and education in Muhammadiyah circles. It was Muhammadiyah - or Hizbul Wathan, a scouting organization underneath the umbrella of Muhammadiyah, to be precise - that provided the young Soedirman with critical experience and lessons that were aimed at giving Muhammadiyah youth physical and mental training. Furthermore, particularly in the period of the fight for Independence, this training prepared them for becoming deeply involved in the fight for Indonesia's independence.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v14i1.563

  10. B747/JT9D flight loads and their effect on engine running clearances and performance deterioration; BCAC NAIL/P and WA JT9D engine diagnostics programs

    Science.gov (United States)

    Olsson, W. J.; Martin, R. L.

    1982-01-01

    Flight loads on the 747 propulsion system and resulting JT9D blade to outer airseal running clearances during representative acceptance flight and revenue flight sequences were measured. The resulting rub induced clearance changes, and engine performance changes were then analyzed to validate and refine the JT9D-7A short term performance deterioration model.

  11. Recent progress in 'bioelectronics' research. Part 2. ; Biocomputer (biological artificial neural networks formed by cultured neurons). Baioerekutoronikusu eno michi (shorai wa saibogu mo) 2. ; Baiokonpyuta (baiyo shinkei saibo ni yoru jinko shinkei kairo)

    Energy Technology Data Exchange (ETDEWEB)

    Kawana, A. (Nippon Telegraph and Telephone Corp., Tokyo (Japan))

    1994-02-20

    A report is made on the study on the functions of neural networks in which cultured neurons are used. A group of brain neurons is taken to pieces once, and restructured in a dish into a neural network. It is possible to observe the behavior of such a neural network. A neurite starts extending from each cell in about a week to form a neural network. The activity of the neural network is then investigated. Many flat microelectrodes are formed instead of acicular electrodes on the substrate where cells are cultivated by microprocessing, and measurement of electrical activity of cells through the electrodes is attempted. In the cultured neural network formed on a micro electrode array, electrical signals can be exchanged with the outside through this electrode. This method seems to be effective for the study of the effect of prolonged stimuli on the functions of the neural network, i.e. mechanism of learning. Formation of a simple neural network is attempted wherein cells exist only on the electrode to form mutual joining. 9 refs., 8 figs.

  12. Programmatic agreement among the USDOE/RL Operations Office, the Advisory Council on Historic Preservation, and the WA State Historic Preservation Office for the maintenance, deactivation, alteration and demolition of the built environment on the Hanford Site, Washington

    International Nuclear Information System (INIS)

    This Programmatic Agreement (PA) addresses the built environment (i.e., buildings and structures) constructed during the Manhattan Project and Cold War Era periods of Hanford's operational history. As such it encompasses the years 1943 through 1990. The identification, evaluation, and treatment of buildings and historic archeological remains on the Hanford Site predating 1943 will be accomplished through Sections 800.4 through 800.6 of the Council's regulations. This PA will be in effect from the date of signature until September 30, 2000. Completion of the Sitewide Treatment Plan established under this PA satisfies all Section 106 requirements for identification, evaluation, and treatment necessary for all undertakings, up to and including demolition which may affect Manhattan Project and Cold War Era properties. This PA may be extended if the Sitewide Treatment Plan has not been completed by the end of FY 2000. Identification, evaluation, and treatment of properties constructed on the Hanford Site after 1990 will be handled pursuant to the regulations in effect at the time such properties are eligible for review

  13. Bayn ma‘had Tebuireng wa Madrasat Manba‘ al-‘Ul?m: Dir?sah t?r?kh?yah ‘an nash’at mafh?m “Al-Madrasah f? al-Ma‘had”

    Directory of Open Access Journals (Sweden)

    Toto Suharto

    2014-07-01

    Full Text Available This article discusses the history of modernization in Indonesian Islamic education, and how its traditional education system is open to modernizing forces. By examining Pesantren Tebuireng and Pesantren Mambaul Ulum, Java’s two old Islamic boarding schools  this study explains how the two pesantrens had become the subject of modernization to introduce “madrasah” system. The existing literature in the field suggests that there are two different opinions as to who was the first institution to develop the madrasah model—Pesantren Tebuireng or Pesantren Mambaul Ulum? This study reveals that, historically, Pesantren Tebuireng was the first pesantren that implemented the madrasah model; Pesantren Mambaul Ulum was not, given the fact that the latter is, institutionally, not a boarding school. There are two reasons why Mambaul Ulum is not considered as an Islamic boarding school. Firstly, the main founder of Mambaul Ulum was a King; therefore, intellectually, he did nothave a tradition with the Islamic boarding school system. Secondly, Mambaul Ulum was established with different motives, compared to other Islamic boarding schools established in Java at the time.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v21i1.882

  14. Ma?m?d Y?nus wa Ittij?h?tuhu f? Tahd?d Ta‘l?m al-lughah al-‘Arab?yah bi Ind?n?s?y?

    Directory of Open Access Journals (Sweden)

    Didin Syafruddin

    2014-03-01

    Full Text Available Mahmud Yunus is one of the Indonesian students who was in Cairo in the thirties and is seen to have made a great contribution to the development of national Islamic education since the time of Indonesian independence. Having finished his studies at al-Azhar University 1927, Yunus studies at Darul Ulum to widden his intellectual horizon untul he obtained his certificate in 1930. As a graduate of one of the most important centers of Islamic learning, he had a lofty status in the Muslim community. Yunus served as a teacher in an Islamic teacher training school (Normal Islam, in padang, West Sumatra and later he was appointeed as a goverment official, seeking to establish and improve Islamic school in Indonesia. He was also a rector and professor of Islamic education at the State Institute of Islamic Studies in Padang.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v2i3.831

  15. Temperature, salinity, oxygen, pressure, and density profiles from CTD casts from chartered fishing boats taken along line off Grays Harbor, WA from 2000-11-15 to 2005-10-20 (NODC Accession 0119769)

    National Oceanic and Atmospheric Administration, Department of Commerce — This set of CTD profiles are from 10 cruises. These cruises were part of the NOAA sponsored program entitled Olympic Region Harmful Algal Blooms (ORHAB). The aim of...

  16. Al-Tij?rah wa al-Da’wah al-Isl?m?yah: Dir?sah li Qa?iyati Dukh?l al-Isl?m f? Ind?n?s?y?

    Directory of Open Access Journals (Sweden)

    Kusmana Kusmana

    2014-03-01

    Full Text Available Among other things trade, politics, education, sufism and marriage are often deemed responsible for the spread of Islam. In the Indonesian context, however, trade is one of the most important methods. In the early period of maritime trade, the establishment of the Muslim community (ummah and sate formation constitute the main characteristics-tightly linked to each other-of the Islamization of Nusantara. Muslims from different countries acted not only as trader but also ds propagators of Islam in some parts of Nusantara which later became centers of Islamic kingdoms.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v7i3.704

  17. Al-Isl?m wa al-Thaq?fah al-Mahl?yah: Dir?sah f? Mujtama’ “Embau” f? Kapuas Hulu K?limant?n al-Gharb?yah

    Directory of Open Access Journals (Sweden)

    Hermansyah .

    2008-04-01

    Full Text Available The research for this piece was carried out in Embau - one of the sub districts of the region of Kapuas Hulu. Socio - demo graphically, this region is inhabited by n community of Muslims that that continues to grow in numbers. Further to the Muslims, the area is inhabited by considerable numbers of non-Muslim Dayaks and other migrants to the area. What is interesting to note is the process of Islamization of the Dayak community, which has occurred naturally as a result of its intersection with the Muslim community. It was the Malays, who appeared in the area hundreds of years ago, who brought Islam to the area. The introduction of Islam to the area has brought with it a number of changes to the Dayak community in West Kalimantan. Not only did many Dayaks adopt Islam as their religion, they further adopted the culture typical of other Muslims.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v15i1.539

  18. Al-Naz‘ah al-Kh?rij?yah f? Afk?ri wa ?arak?ti al-Shaykh Ahmad Rif?‘i bi K?l? S?l?k

    Directory of Open Access Journals (Sweden)

    Muhlisin Sa'ad

    2014-03-01

    Full Text Available Rifa'i is a 'scholar who spent over 20 years old to study in the Middle East, particularly in Mecca and Cairo. Upon returning from the Middle East, Rifa'i settled in Kaliwungi, Kendal, Central Java. There he devote attention to teaching religious sciences as well write the book. He also actively engage students and the general public to raise awareness of the socio-religious people in order to erode the moral crisis is the result of the work of the Dutch colonial behavior. To that end, Ahmad Rifa'i critique of the colonial government and also the traditional feudal aristocracy became agents.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v2i2.837

  19. Programmatic agreement among the USDOE/RL Operations Office, the Advisory Council on Historic Preservation, and the WA State Historic Preservation Office for the maintenance, deactivation, alteration and demolition of the built environment on the Hanford Site, Washington

    Energy Technology Data Exchange (ETDEWEB)

    Lloyd, D.W.

    1997-08-01

    This Programmatic Agreement (PA) addresses the built environment (i.e., buildings and structures) constructed during the Manhattan Project and Cold War Era periods of Hanford`s operational history. As such it encompasses the years 1943 through 1990. The identification, evaluation, and treatment of buildings and historic archeological remains on the Hanford Site predating 1943 will be accomplished through Sections 800.4 through 800.6 of the Council`s regulations. This PA will be in effect from the date of signature until September 30, 2000. Completion of the Sitewide Treatment Plan established under this PA satisfies all Section 106 requirements for identification, evaluation, and treatment necessary for all undertakings, up to and including demolition which may affect Manhattan Project and Cold War Era properties. This PA may be extended if the Sitewide Treatment Plan has not been completed by the end of FY 2000. Identification, evaluation, and treatment of properties constructed on the Hanford Site after 1990 will be handled pursuant to the regulations in effect at the time such properties are eligible for review.

  20. Al-Dir?sah f? Ta’addud?yah al-Mujtama’ al-Banj?r? wa al-Ta’l?m al-??f?yah li al-Shaykh Mu?ammad Nafis al-Banj?r?

    Directory of Open Access Journals (Sweden)

    Artani Hasbi

    2006-04-01

    Full Text Available The book begins by looking at the development of democracy in Islamic countries in both the Arab and non-Arab world. One global trend that has become evident following the Cold War, as Azra points out, has been the gradual increase in the numbers of countries that have adopted democracy. This phenomenon is not exclusive to Muslim countries. In this study, Azra cites the report, Freedom in the World 2000: The Democracy Cap, which explains the growth of democracy in lslamic countries in the Arab world where the impact has been quite clear.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v13i1.578

  1. Al-Lughah al-Mal?yuw?yah wa takw?n al-Isl?m al-Ind?n?s?: Na?rah t?r?kh?yah ijtim?‘?yah

    Directory of Open Access Journals (Sweden)

    Jajat Burhanudin

    2015-03-01

    Full Text Available The Malay language is of great importance in understanding Indonesian society and history. As the root of Indonesia’s national language, Bahasa Indonesia, the language has become part and parcel of the social-political and cultural formation of the diverse communities throughout Indonesia. Also, the role of the Malay language in Indonesian nation building proceeded alongside the historical course of Islamic development there. In line with the development of Islam in parts of Indonesia and the Southeast Asia region at large, Malay emerged as a lingua franca that was widely used as a media of social interaction, political diplomacy, commerce and, more importantly, Islamic expression. This article discusses the history of the Malay language in relation to its role as the language of Indonesian Muslims. The article also examines the contribution that the language has made, through the course of history, in uniting the people into a single nation-state—Indonesia.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v21i3.1219

  2. Power demand with lowest growth since yen appreciation recession. ; Power facility plan For fiscal 1993. Denryoku juyo wa endaka fukyo irai no hikui nobi. ; 1993 nendo denryoku shisetsu keikaku ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    1993-05-05

    The Power facility plan for fiscal 1993 has been worked on with 15 electric power operators and public corporations participating to achieve assurance on stable power supply. This paper describes estimation on power demand, power source development plans and power demand and supply balance, and diversifying power structures. The total power demand for the fiscal 1992 was 799.9 billion kWh with as low growth as 1.3% over that in the previous year. However, on a medium to long term basis, an increase can be anticipated reflecting the growth in the economic societies. The power source development plans need to correspond to the increase in the maximum power demand, and power companies have made development plans for 35 units with a total output of 7.29 million kW for the fiscal 1993, and 43 units with 23.69 million kW for the fiscal 1994. The power supply mix in 2002 assumes petroleum substituting power sources comprising mainly nuclear power, coal burning and LNG burning plants. The Plan intends to promote nuclear power generation as a representative of non-fossil fuel power generation particularly from a viewpoint of dealing with global environmental problems. 6 tabs.

  3. 77 FR 75434 - Radio Broadcasting Services; AM or FM Proposals To Change the Community of License

    Science.gov (United States)

    2012-12-20

    ...AZ, To SPRINGDALE, UT; MCC RADIO, LLC, Station KWOK, Facility ID 68057, BP-20121114AGE...WA, To ABERDEEN, WA; MCC RADIO, LLC, Station KDUX-FM, Facility ID 52676...Bureau's Consolidated Data Base System,...

  4. 75 FR 14462 - Notice of Inventory Completion: Central Washington University, Department of Anthropology...

    Science.gov (United States)

    2010-03-25

    ...Washington University, Department of Anthropology, Ellensburg, WA, and Thomas Burke...Washington University, Department of Anthropology, Ellensburg, WA, and the Thomas...NAGPRA Program Director, Department of Anthropology, Central Washington University,...

  5. 77 FR 37658 - Procurement List; Additions

    Science.gov (United States)

    2012-06-22

    ...Defense Commissary Agency. Services Service Type/Locations: Latrine Services, Stryker Overflow Lot, Railroad Avenue, Joint Base Lewis-McChord, WA. Stryker National Logistics Center, Building 2701 C Street, SW., Auburn, WA....

  6. 77 FR 22289 - Procurement List Proposed Additions

    Science.gov (United States)

    2012-04-13

    ...Const Engrg Lab, Champaign, IL. Service Type/Locations: Latrine Services, Stryker Overflow Lot, Railroad Avenue, Joint Base Lewis-McChord, WA. Stryker National Logistics Center, Building 2701 C Street SW., Auburn, WA. NPA:...

  7. 50 CFR Table 1 to Subpart H of... - Pacific Salmon EFH Identified by USGS Hydrologic Unit Code (HUC)

    Science.gov (United States)

    2010-10-01

    ...and pink salmon n/a 17110012 WA Lake Washington Chinook and coho salmon ...17070101 OR/WA Mid. Columbia - Lake Wallula Chinook and coho salmon n...Umpqua River Chinook and coho salmon Soda Springs Dam 17100302 OR S....

  8. Philosophy in Utenzi metre

    OpenAIRE

    Rettova?, Alena

    2012-01-01

    Makala haya yanachanganua jinsi dhana za kifalsafa zinavyoakisiwa katika ushairi wa Kiswahili yakizingatia hasa tenzi zilizoandikwa kuhusu historia za dola za Kiafrika baada ya kupatikana kwa Uhuru. Tenzi nyingi za kundi hili zilitungwa Tanzania wakati wa ujamaa, ndiyo maana itikadi zinazoelezwa zaidi katika tenzi hizi zinahusiana na falsafa ya ujamaa. Uelekeo huu unaonyeshwa katika uchambuzi wa Utenzi wa Pambazuko la Afrika uliotungwa na Mohammed Seif Khatib na kuchapishwa mwaka 1982, ambao ...

  9. Historic Neighborhood Schools Deliver 21st Century Educations.

    Science.gov (United States)

    Beaumont, Constance E.

    Noting the benefits of small neighborhood schools, this article asserts that recent renovations of historic schools in Spokane, Washington; San Antonio, Texas; and Boise, Idaho, illustrate these points and challenge the notion that well-renovated historic schools cannot meet modern standards. The article recounts the stories of these schools and…

  10. REGION 10 (EXCEPT ALASKA) GROUNDWATER ACTIVITIES MAP

    Science.gov (United States)

    This is a map of Washington, Oregon and Idaho, with inset blow ups of the Puget Sound area, Portland, and Spokane. The map shows RCRA treatment, storage, disposal, and incineration sites, CERCLA sites, TRI sites, NPDES majors, and Sole Source Aquifers Streams and county boundarie...

  11. Teaching Sherman Alexie's "Every Little Hurricane."

    Science.gov (United States)

    Robins, Barbara K.

    2003-01-01

    Discusses how Sherman Alexie's characters, mostly created from his experience on the Spokane Indian Reservation, embody dignity, spirit, ambiguity, fragility, and never hesitate to comment on current states of affairs from their own tough but battered perspectives. Notes the author leads a class discussion to further develop examples that…

  12. Blue Creek Winter Range : Wildlife Mitigation Project : Final Environmental Assessment.

    Energy Technology Data Exchange (ETDEWEB)

    United States. Bonneville Power Administration; United States. Bureau of Indian Affairs; Spokane Tribe of the Spokane Reservation, Washington

    1994-11-01

    Bonneville Power Administration (BPA) proposes to fund that portion of the Washington Wildlife Agreement pertaining to the Blue Creek Winter Range Wildlife Mitigation Project (Project) in a cooperative effort with the Spokane Tribe, Upper Columbia United Tribes, and the Bureau of Indian Affairs (BIA). If fully implemented, the proposed action would allow the sponsors to protect and enhance 2,631 habitat units of big game winter range and riparian shrub habitat on 2,185 hectares (5,400 acres) of Spokane Tribal trust lands, and to conduct long term wildlife management activities within the Spokane Indian Reservation project area. This Final Environmental Assessment (EA) examines the potential environmental effects of securing land and conducting wildlife habitat enhancement and long term management activities within the boundaries of the Spokane Indian Reservation. Four proposed activities (habitat protection, habitat enhancement, operation and maintenance, and monitoring and evaluation) are analyzed. The proposed action is intended to meet the need for mitigation of wildlife and wildlife habitat adversely affected by the construction of Grand Coulee Dam and its reservoir.

  13. Campus Kids Mentoring Program: Fifteen Years of Success

    Science.gov (United States)

    Shepard, Jerri

    2009-01-01

    This article features Campus Kids, a mentoring program located at Gonzaga University in Spokane, Washington. Gonzaga is a Jesuit University with a strong commitment to social justice and humanistic education. Campus Kids began, in the true sense of a community partnership, as an attempt to connect community resources (potential university…

  14. Heart to Heart Art: Empowering Homeless Children and Youth

    Science.gov (United States)

    Shepard, Jerri; Booth, Deborah

    2009-01-01

    This article describes Heart to Heart Art, an after-school program developed for homeless children and youth at the YWCA in Spokane, Washington. Pre-service teacher candidates from a local university create meaningful activities that engage homeless students in visual art, music, drama, cooking, and community service. Heart to Heart Art was…

  15. Ham on Regal.

    Science.gov (United States)

    Hubbard, Russ

    1985-01-01

    Teachers at Ferris High School in Spokane, Washington, are joined by the parents of high school students in the production of elaborate annual shows that both create a sense of community and raise approximately $10,000 a year for the school. (PGD)

  16. Educational Training in a Pre-Release Correctional Center/A Collaborative Model.

    Science.gov (United States)

    Langan, A. Bud

    A prerelease program was developed to provide job training to persons who were within 90 to 120 days of their scheduled release date from a Washington State prison. The Geiger program was sponsored and operated jointly by Spokane County and State agencies. Because it was determined that the 84-bed unit would handle approximately 30 arrivals and 30…

  17. Competency Based Curriculum. Revised Delivery Systems for Culinary Arts Program. Project Report.

    Science.gov (United States)

    Spokane Community Coll., WA.

    Developed through a grant that enabled faculty members to work together to define goals and set objectives, this curriculum guide contains course objectives for the culinary arts program at Spokane Community College in Washington. Objectives are provided for the following courses: culinary techniques and skill development (two levels),…

  18. Blue Creek Winter Range: Wildlife Mitigation Project. Final environmental assessment

    International Nuclear Information System (INIS)

    Bonneville Power Administration (BPA) proposes to fund that portion of the Washington Wildlife Agreement pertaining to the Blue Creek Winter Range Wildlife Mitigation Project (Project) in a cooperative effort with the Spokane Tribe, Upper Columbia United Tribes, and the Bureau of Indian Affairs (BIA). If fully implemented, the proposed action would allow the sponsors to protect and enhance 2,631 habitat units of big game winter range and riparian shrub habitat on 2,185 hectares (5,400 acres) of Spokane Tribal trust lands, and to conduct long term wildlife management activities within the Spokane Indian Reservation project area. This Final Environmental Assessment (EA) examines the potential environmental effects of securing land and conducting wildlife habitat enhancement and long term management activities within the boundaries of the Spokane Indian Reservation. Four proposed activities (habitat protection, habitat enhancement, operation and maintenance, and monitoring and evaluation) are analyzed. The proposed action is intended to meet the need for mitigation of wildlife and wildlife habitat adversely affected by the construction of Grand Coulee Dam and its reservoir

  19. Echoes from Si gang lih: Burao Yilu's 'Moon Mountain'

    Directory of Open Access Journals (Sweden)

    Mark Bender

    2011-12-01

    Full Text Available Wa poet Burao Yilu's utilization of myth, ritual, and folk customs in representing the Wa ethnic group in the poem 'Moon Mountain' is discussed. Negative stereotypes of the Wa, an indigenous people of southwestern Yunnan Province, China, include the now forbidden practice of headhunting. By referencing the origin myth 'Si gang lih' and evoking images of ancient cliff paintings, rituals, and agricultural practices, Burao offers a nuanced view of Wa culture while affirming deep-rooted aspects of the Wa worldview. As a literary work, 'Moon Mountain' is an example of the Chinese language (Sinophone poetry being produced by ethnic minority writers in southwest China today.

  20. Suite of experiments in beam H3

    CERN Multimedia

    1977-01-01

    The H3 beam runs from bottom to top, in the middle of the photo. On its left preparation is going on for WA10 in beam H5, on its right, behind the concrete wall, the S3 beam runs to BEBC. The H3 beam first meets the IKAR target of the experiment WA9 (right, bottom corner) then crosses the polarized hydrogen target of experiment WA6 sitting inside the large green magnet (centre, also visible the yellow support of the recoil chamber telescope). Finally the beam reaches WA11 and the Goliath magnet (under the white passerelle). The WA9 (left) and the WA5/11 (right) huts stand on top of the photo, the WA6 stands at the right, centre. The three experiments were running in alternance.

  1. Effectiveness of a lifestyle exercise program for older people receiving a restorative home care service: a pragmatic randomized controlled trial

    OpenAIRE

    Burton E; Lewin G; Clemson L; Boldy D

    2013-01-01

    Elissa Burton,1,2 Gill Lewin,1,2 Lindy Clemson,3 Duncan Boldy41Faculty of Health Sciences, Curtin University, Perth, WA, Australia; 2Research Department, Silver Chain, Perth, WA, Australia; 3Health and Work Research Unit, The University of Sydney, Sydney, NSW, Australia; 4School of Nursing and Midwifery, Curtin University, Perth, WA, AustraliaBackground: Restorative home care services are short-term and aimed at maximizing a person’s ability to live independently. They are multidimensio...

  2. Foot care education and self management behaviors in diverse veterans with diabetes

    OpenAIRE

    Jonathan M Olson; Molly T Hogan; Leonard M Pogach; Mangala Rajan; Raugi, Gregory J; Reiber, Gayle E.

    2009-01-01

    Jonathan M Olson1, Molly T Hogan2, Leonard M Pogach3, Mangala Rajan3, Gregory J Raugi4, Gayle E Reiber51University of Washington School of Medicine, Seattle, WA, USA; 2Department of Internal Medicine, University of Washington School of Medicine, Seattle, WA, USA; 3Department of Veterans Affairs, New Jersey Healthcare System, Center for Healthcare Knowledge Management, East Orange, NJ, USA; 4Division of Dermatology, VA Puget Sound Healthcare System, Department of Veterans Affairs, Seattle, WA,...

  3. Gabapentin enacarbil – clinical efficacy in restless legs syndrome

    OpenAIRE

    Pinky Agarwal; Alida Griffith; Costantino, Henry R.; et al, ...

    2010-01-01

    Pinky Agarwal1, Alida Griffith1, Henry R Costantino2, Narendra Vaish31Booth Gardner Parkinson’s Center, Kirkland, WA, USA; 2Costantino Consulting, Woodinville, WA, USA; 3Kirkland, WA, USAAbstract: Restless legs syndrome (RLS) is a sleep-related movement disorder commonly involving an unpleasant urge to move the limbs, typically the legs. Dopaminergic agents represent the first-line therapy for RLS; however, long-term use of such drugs results in worsening symptoms due to “...

  4. Health psychology in primary care: recent research and future directions

    OpenAIRE

    Thielke S; Thompson A; Stuart R

    2011-01-01

    Stephen Thielke1, Alexander Thompson2, Richard Stuart31Psychiatry and Behavioral Sciences, University of Washington, Geriatric Research, Education, and Clinical Center, Puget Sound VA Medical Center, Seattle, WA, USA; 2Group Health Cooperative, Seattle, WA, USA; 3Psychiatry and Behavioral Sciences, University of Washington, Seattle, WA, USAAbstract: Over the last decade, research about health psychology in primary care has reiterated its contributions to mental and physical health promotion, ...

  5. Water Accounting Plus for Water Resources Reporting and River Basin Planning:

    OpenAIRE

    Karimi, P.

    2014-01-01

    This thesis introduces Water Accounting Plus (WA+), which is a new framework designed to provide explicit spatial information on water depletion and net withdrawal processes in complex river basins. WA+ is a simple, yet comprehensive and understandable water accounting framework that provides a standardized way of data collection and a presentation system that describes the overall land and water management situation in complex river basins. WA+ tracks water depletions rather than withdrawals...

  6. Wheel loader round up

    Energy Technology Data Exchange (ETDEWEB)

    Fiscor, S.

    2007-02-15

    Operator comfort and serviceability remain important features of front-end loaders or wheel loaders. The article reports on features of the latest large loaders from three companies: Caterpillar (the 992G and 994F), Komatsu (the WA800-3, WA900-3 and WA1200-3), and Le Tourneau (the L-950, L-1350, L-1850 and L-2350). 1 tab., 4 photos.

  7. Increasing access to dental care for medicaid preschool children: the Access to Baby and Child Dentistry (ABCD) program.

    OpenAIRE

    Grembowski, D; Milgrom, P M

    2000-01-01

    OBJECTIVE: Washington State's Access to Baby and Child Dent stry (ABCD) Program, first implemented in Spokane County in 1995, offers extended dental benefits to participating Medicaid-enrolled children and higher fees for certified providers. This study aimed to determine the program's effect on children's dental utilization and dental fear, and on parent satisfaction and knowledge. METHODS: The study used a posttest-only comparison group design. Trained interviewers conducted telephone inter...

  8. Pharmacology, efficacy and safety of liraglutide in the management of type 2 diabetes

    OpenAIRE

    Neumiller, Joshua J.; Sonnett, Travis E.; Wood, Lindy D.; et al, ...

    2010-01-01

    Joshua J Neumiller1, Travis E Sonnett2, Lindy D Wood1, Stephen M Setter1, R Keith Campbell21Department of Pharmacotherapy, College of Pharmacy, Washington State University, Spokane, Washington; 2Department of Pharmacotherapy, College of Pharmacy, Washington State University, Pullman, Washington, USAAbstract: Liraglutide is a glucagon-like peptide-1 analog with pharmacokinetic properties suitable for once-daily administration approved by the Food and Drug Administration for the treatment of pa...

  9. Blue Creek Winter Range: Wildlife Mitigation Project

    International Nuclear Information System (INIS)

    This preliminary Environmental Assessment examines the potential environmental effects of securing land and conducting wildlife habitat enhancement and long term management activities within the boundaries of the Spokane Indian Reservation. Four proposed activities are analyzed: Habitat protection; Habitat enhancement; Operation and maintenance; and Monitoring and evaluation. The proposed action is intended to meet the need for mitigation of wildlife and wildlife habitat adversely affected by the construction of Grand Coulee Dam and its reservoir

  10. 78 FR 39326 - Notice Pursuant To the National Cooperative Research and Production Act of 1993-Opendaylight...

    Science.gov (United States)

    2013-07-01

    ...Inc., San Jose, CA; Ciena Corporation, Hanover, MD; Cisco Systems...Quebec City, CANADA; Intel Corporation, Santa Clara, CA; Juniper Networks, Sunnyvale, CA; Microsoft Corporation, Redmond, WA; NEC...

  11. 78 FR 36232 - Announcement of Funding Awards; Service Coordinators in Multifamily Housing Program, Fiscal Year...

    Science.gov (United States)

    2013-06-17

    ...Rural Economic Casa Real...... 1300 Wyoming St Alice..................... 68 235,264 Assistance...Road East. WA....... Blue Mountain Whitman Court.. 305 Ash St..... Walla Walla............... 49...

  12. Uudised : Detsembri tähed ja debüüdid. Uued muusikafilmid / Mare Põldmäe

    Index Scriptorium Estoniae

    Põldmäe, Mare, 1955-2002

    1999-01-01

    Kontsertidest detsembris ? Flying Pickets, B. Hendricks, P. Rozario, Vanemuise Sümfoonikud. Uutest eesti muusikafilmidest "Te Deum" (A. Pärt), "Cyrano de Bergerac" (E. Tamberg) ja "Requiem" (W.A. Mozart)

  13. Lake Roosevelt Fisheries Evaluation Program; Movements and Growth of Marked Walleye Recaptured in Lake Roosevelt, 2000-2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    McLellan, Holly; Scholz, Allan

    2002-03-01

    Walleye (Stizostedion vitreum) have been marked with floy tags in Lake Roosevelt since 1997 to estimate abundance, distribution and movement trends. In 2000, walleye were collected and marked during the spawning run in the Spokane River through electrofishing and angling to supplement movement and growth data collected in previous years. Walleye were also collected and marked during the 2000 and 2001 Kettle Falls Governor's Cup Walleye Tournaments. Seventy-six tag returns were recovered in 2000 and twenty-three in 2001. Walleye migrated into the Spokane River to spawn in mid April and early May. The majority of marked walleye were recovered within 25 km of their original marking location, with a few traveling long distances between recovery locations. Data also verified earlier results that walleye establish summer home ranges. Some walleye remained in the Spokane River, while others moved downstream, or upstream after entering the mainstem of Lake Roosevelt. Those moving upstream moved as far north as Keenlyside Dam in British Columbia (245 km). Growth data indicated similar trends exhibited in the past. Walleye growth and mortality rates were consistent with other walleye producing waters. Walleye condition was slightly below average when compared to other systems.

  14. Water Budgets for Coeur d'Alene Lake, Idaho, Water Years 2000-2005

    Science.gov (United States)

    Maupin, Molly A.; Weakland, Rhonda J.

    2009-01-01

    The U.S. Geological Survey, in cooperation with the Idaho Department of Water Resources, calculated annual water budgets and a mean annual water budget for Coeur d'Alene Lake, Idaho, for water years 2000 through 2005. Mean annual inflow to Coeur d'Alene Lake, including precipitation, was about 167,110 million cubic feet. Mean annual outflow, including evaporation, but excluding wastewater effluent to the Spokane River, was about 167,850 million cubic feet. The amount of water lost from Coeur d'Alene Lake and the Spokane River to the Spokane Valley-Rathdrum Prairie aquifer was estimated at 7,250 million cubic feet. Mean annual precipitation into Coeur d'Alene Lake was 3,267 million cubic feet, which exceeded mean annual evaporation of 2,483 million cubic feet. Withdrawals directly from the lake and from wells within a 1,000 foot buffer of the lakeshore for domestic and municipal water uses were reported. However, only the estimate for the consumptive use part of the withdrawals, 265 million cubic feet, was considered in the budget. Mean annual change in lake storage resulted in a net loss of about 49 million cubic feet. The mean annual residual value was about -8,310 million cubic feet.

  15. Id‘?’ al-?aq wa ?ud?d al-tas?mu? f? tarb?yat al-Isl?m?yah: Dir?sah awwal?yah fi al-kutub al-muqarrarah li tadr?s m?ddah al-Isl?m?yah bi al-j?mi‘?t al-Ind?n?s?ya

    Directory of Open Access Journals (Sweden)

    Dody S. Truna

    2013-12-01

    Full Text Available This article focuses on investigating the statement on truth claim and religious tolerance of the Muslim writers of Islamic Education textbooks for students at tertiary level in Indonesia. The purpose is to study how Islamic teachings, according to their points of view, formulate limits of tolerance in the interaction among adherents of different religions. They believe that the formulation is meant to defend Islam from syncretism, hypocrisy, and heresy and to argue against the concept of unlimited tolerance in the view of the advocates of pluralism and multiculturalism. The first side is ‘defenders’, to call them as groups opposing pluralism and multiculturalism, and the second is ‘the advocates’ of pluralism and multiculturalism.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v20i3.514

  16. Tan??m al-Taq?lid al-‘Ilm?yah Isl?m?yah f? J?wah f? al-Qarn al-T?si‘ ‘Ashar wa Nuf??uh Na?w al-Ta?awwur al-Isl?m? f? Ind?n?s?y?

    Directory of Open Access Journals (Sweden)

    Nurhakim Nurhakim

    2014-03-01

    Full Text Available Special study of the development of scientific tradition of Islam in Java in the 19th century has not been done yet this area is the center of religious institutions and traditional Islamic education. If in the early centuries of Islamic science centers has given rise to a number of 'scholars' and major works are in Pasai, Malacca then Aceh, the 19th century it has been shifted to the center of Java.This paper intends to describe about the formation, development and influence of the Islamic intellectual tradition that includes institutional elements such as mosques, actors such as students-chaplain, system, method, process of transmitting knowledge, books and software facilities used in the 19th century.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v2i4.822

  17. Kit?b al-Tu?fah al-R?gib?n wa al-Radd ‘al? ‘Aq?dah al-Wuj?d?yah bi F?limb?nj fi al-Qarn al-Th?min ‘Ashar al-M?l?d?

    Directory of Open Access Journals (Sweden)

    Nyimas Umi Kalsum

    2004-12-01

    Full Text Available This article tries to discuss one of religion waorks written by al-Palimbani, Tuhfah al-Ragibin, presented the discussion of the author's response towards wujudiyyah, a text that widely spread in Palembang at the time. In line with al-Raniri in Aceh, al-Palimbani divided wujudiyyah's doctrine into two categories: wujudiyyah mulhid and wujudiyyah muwahhid.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v11i3.597

  18. Study on the mechanism of flower color variation by using proton selective micro-electrode. Why the petal of morning glory turns blue; Saibonai bisho denkyokuho ni yoru hanairo hen`i no kaimei. Asagao no hana wa naze aoiro ni narunoka

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-11-05

    Description is given about the application of the intracellular microelectrode method to the direct measurement of pH in the ipomoea tricolor vacuole and about the mechanism of the changing of flower petal color. For the determination of changes in liquid in ipomoea tricolor vacuoles accompanied by flower blooming, a microelectrode was allowed to move on in flower petal sections under a microscope for the measurement of pH. To be sure of the entry of the electrode tip into a live vacuole, the membrane potential was monitored simultaneously. In case of a blue flower petal, pH was as high as 7.7 in the first vacuole. The electrode proceeded to measure 5.8, and proceeded further to measure 7.7 again. In case of a purple bud petal, pH changed from 6.6 to 5.8, and then to 6.6. The figures are quite persuasive when they are referred to the flower petal constitutional structures, which establishes that there is a significant difference between the vacuole pH of a blue flower petal and that of a purple bud petal, and that the change in petal color at blooming is attributed to the sharp rise in vacuole pH to 7.7. 22 refs., 9 figs., 2 tabs.

  19. Al-Tur?th al-‘Ilm? al-Isl?m? bi Ind?n?siy?: Dir?sat f? Tafs?ray Malja’ al-??lib?n wa Tamsh?y?h al-Muslim?n li al-Shaykh al-?ajj A?mad San?s?

    Directory of Open Access Journals (Sweden)

    Hasan Husain Umar

    2014-03-01

    Full Text Available Haji Ahmad Sanusi, the main figure with whom this article is concerned, is an activist and a productive writer. Born in Sukabumi from a Kyai family, he spent the first 20 years of his life in West Java, moving from one pesantren to another in pursuit of religious knowledge. He spent the next 5 years in Mecca, studying under the supervision of famous scholars. It was during his stay in Mecca that he became associated with not only the intellectual network in the Islamic world but also with the Ind (political world. He became d supporter of Sarekat Islam (SI and wrote a book, his first book, to defend it.Copyright (c 2014 by SDI. All right reserved.DOI: 10.15408/sdi.v8i1.698

  20. Growth Arrest by the Antitumor Steroidal Lactone Withaferin A in Human Breast Cancer Cells Is Associated with Down-regulation and Covalent Binding at Cysteine 303 of ?-Tubulin*

    Science.gov (United States)

    Antony, Marie L.; Lee, Joomin; Hahm, Eun-Ryeong; Kim, Su-Hyeong; Marcus, Adam I.; Kumari, Vandana; Ji, Xinhua; Yang, Zhen; Vowell, Courtney L.; Wipf, Peter; Uechi, Guy T.; Yates, Nathan A.; Romero, Guillermo; Sarkar, Saumendra N.; Singh, Shivendra V.

    2014-01-01

    Withaferin A (WA), a C5,C6-epoxy steroidal lactone derived from a medicinal plant (Withania somnifera), inhibits growth of human breast cancer cells in vitro and in vivo and prevents mammary cancer development in a transgenic mouse model. However, the mechanisms underlying the anticancer effect of WA are not fully understood. Herein, we report that tubulin is a novel target of WA-mediated growth arrest in human breast cancer cells. The G2 and mitotic arrest resulting from WA exposure in MCF-7, SUM159, and SK-BR-3 cells was associated with a marked decrease in protein levels of ?-tubulin. These effects were not observed with the naturally occurring C6,C7-epoxy analogs of WA (withanone and withanolide A). A non-tumorigenic normal mammary epithelial cell line (MCF-10A) was markedly more resistant to mitotic arrest by WA compared with breast cancer cells. Vehicle-treated control cells exhibited a normal bipolar spindle with chromosomes aligned along the metaphase plate. In contrast, WA treatment led to a severe disruption of normal spindle morphology. NMR analyses revealed that the A-ring enone in WA, but not in withanone or withanolide A, was highly reactive with cysteamine and rapidly succumbed to irreversible nucleophilic addition. Mass spectrometry demonstrated direct covalent binding of WA to Cys303 of ?-tubulin in MCF-7 cells. Molecular docking indicated that the WA-binding pocket is located on the surface of ?-tubulin and characterized by a hydrophobic floor, a hydrophobic wall, and a charge-balanced hydrophilic entrance. These results provide novel insights into the mechanism of growth arrest by WA in breast cancer cells. PMID:24297176

  1. Role of mitogen-activated protein kinases and Mcl-1 in apoptosis induction by withaferin A in human breast cancer cells.

    Science.gov (United States)

    Hahm, Eun-Ryeong; Lee, Joomin; Singh, Shivendra V

    2014-11-01

    Withaferin A (WA), a bioactive constituent of Ayurvedic medicine plant Withania somnifera, is a potent apoptosis inducer in cancer cells but the mechanism of cell death induction is not fully characterized. The present study was undertaken to determine the role of mitogen-activated protein kinases (MAPK), including c-jun NH2 -terminal kinase (JNK), extracellular signal-regulated kinase (ERK), and p38 MAPK, and anti-apoptotic protein myeloid cell leukemia-1 (Mcl-1) in regulation of WA-induced apoptosis using human breast cancer cells. Exposure of MCF-7 (estrogen responsive) and SUM159 (triple negative) human breast cancer cells to WA resulted in increased phosphorylation of ERK, JNK, and p38 MAPK, but these effects were relatively more pronounced in the former cell line than in SUM159. Overexpression of manganese-superoxide dismutase conferred partial protection against WA-mediated hyperphosphorylation of ERK, but not JNK or p38 MAPK. Cell death resulting from WA treatment in MCF-7 cells was significantly augmented by pharmacological inhibition of ERK and p38 MAPK. Interestingly, the WA-induced apoptosis in MCF-7 cells was partially but significantly blocked in the presence of a JNK-specific inhibitor. Pharmacological inhibition of ERK or JNK had no effect on WA-induced apoptosis in SUM159 cells. The WA-treated cells exhibited induction of long and short forms of Mcl-1. RNA interference of Mcl-1 alone triggered apoptosis. Furthermore, the WA-induced cell death in MCF-7 cells was modestly but significantly augmented by knockdown of the Mcl-1 protein. These observations indicate that: MAPK have cell line-specific role in cell death by WA, and Mcl-1 induction confers modest protection against WA-induced apoptosis. PMID:24019090

  2. Withaferin A inhibits experimental epithelial-mesenchymal transition in MCF-10A cells and suppresses vimentin protein level in vivo in breast tumors.

    Science.gov (United States)

    Lee, Joomin; Hahm, Eun-Ryeong; Marcus, Adam I; Singh, Shivendra V

    2015-06-01

    We have shown previously that withaferin A (WA), a bioactive component of the medicinal plant Withania somnifera, inhibits growth of cultured and xenografted human breast cancer cells and prevents breast cancer development and pulmonary metastasis incidence in a transgenic mouse model. The present study was undertaken to determine if the anticancer effect of WA involved inhibition of epithelial-mesenchymal transition (EMT). Experimental EMT induced by exposure of MCF-10A cells to tumor necrosis factor-? (TNF-?) and transforming growth factor-?1 (TGF-?) was partially reversed by treatment with WA but not by its structural analogs withanone or withanolide A. Combined TNF-? and TGF-? treatments conferred partial protection against MCF-10A cell migration inhibition by WA. Inhibition of TNF-? and TGF-?-induced MCF-10A cell migration by WA exposure was modestly attenuated by knockdown of E-cadherin protein. MCF-7 and MDA-MB-231 cells exposed to WA exhibited sustained (MCF-7) or transient (MDA-MB-231) induction of E-cadherin protein. On the other hand, the level of vimentin protein was increased markedly after 24?h treatment of MDA-MB-231 cells with WA. WA-induced apoptosis was not affected by vimentin protein knockdown in MDA-MB-231 cells. Protein level of vimentin was significantly lower in the MDA-MB-231 xenografts as well as in MMTV-neu tumors from WA-treated mice compared with controls. The major conclusions of the present study are that (a) WA treatment inhibits experimental EMT in MCF-10A cells, and (b) mammary cancer growth inhibition by WA administration is associated with suppression of vimentin protein expression in vivo. © 2013 Wiley Periodicals, Inc. PMID:24293234

  3. Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams; 2001 Annual Report.

    Energy Technology Data Exchange (ETDEWEB)

    Connor, Jason M. (Kalispell Department of Natural Resources, Usk, WA); McLellan, Jason G. (Washington Department of Fish and Wildlife, Spokane, WA); O' Connor, Dick (Washington Department of Fish and Wildlife, Olympia, WA)

    2003-01-01

    In 1980, the United States Congress enacted the Northwest Power Planning and Conservation Act (PL 96-501, 1980), which established the Northwest Power Planning Council (NPPC). The NPPC was directed by Congress to develop a regional Power Plan and also the Columbia River Basin Fish and Wildlife Program (FWP) to restore or replace losses of fish caused by construction and operation of hydroelectric dams in the Columbia River Basin. In developing the FWP, Congress specifically directed NPPC to solicit recommendations for measures to be included in the Program from the region's fish and wildlife agencies and Indian tribes. All measures adopted by the Council were also required to be consistent with the management objectives of the agencies and tribes [Section 4.(h)(6)(A)], the legal rights of Indian tribes in the region [Section 4.(h)(6)(D)] and be based upon and supported by the best available scientific knowledge [Section 4.(h)(6)(B)]. The Resident Fish Stock Status above Chief Joseph and Grand Coulee Dams Project, also known as the Joint Stock Assessment Project (JSAP) specifically addresses NPPC Council measure 10.8B.26 of the 1994 program. The Joint Stock Assessment Project is a management tool using ecosystem principles to manage artificial fish assemblages and native fish in altered environments existing in the Columbia River System above Chief Joseph and Grand Coulee Dams (Blocked Area). A three-phase approach of this project will enhance the fisheries resources of the Blocked Area by identifying data gaps, filling data gaps with research, and implementing management recommendations based on research results. The Blocked Area fisheries information is housed in a central location, allowing managers to view the entire system while making decisions, rather than basing management decisions on isolated portions of the system. The JSAP is designed and guided jointly by fisheries managers in the Blocked Area and the Columbia Basin Blocked Area Management Plan (1998). The initial year of the project (1997) identified the need for a central data storage and analysis facility, coordination with the StreamNet project, compilation of Blocked Area fisheries information, and a report on the ecological condition of the Spokane River System. These needs were addressed in 1998 by acquiring a central location with a data storage and analysis system, coordinating a pilot project with StreamNet, compiling fisheries distribution data throughout the Blocked Area, identifying data gaps based on compiled information, and researching the ecological condition of the Spokane River. In order to ensure that any additional information collected throughout the life of this project will be easily stored and manipulated by the central storage facility, it was necessary to develop standardized methodologies between the JSAP fisheries managers. Common collection and analytical methodologies were developed in 1999. In 1999, 2000, and 2001 the project began addressing some of the identified data gaps throughout the Blocked Area. Data collection of established projects and a variety of newly developed sampling projects are ongoing. Projects developed and undertaken by JSAP fisheries managers include investigations of the Pend Orielle River and its tributaries, the Little Spokane River and its tributaries, and water bodies within and near the Spokane Indian Reservation. Migration patterns of adfluvial and reservoir fish in Box Canyon Reservoir and its tributaries, a baseline assessment of Boundary Reservoir and its tributaries, ecological assessment of mountain lakes in Pend Oreille County, and assessments of seven streams and four lakes on the Spokane Indian Reservation were completed by 2000. Assessments of the Little Spokane River and its tributaries, tributaries to the Pend Oreille River, small lakes in southern Pend Oreille County, and water bodies within and near the Spokane Indian Reservation were conducted in 2001. This work was done in accordance with the scope of work approved by Bonneville Power Administration (BPA).

  4. A Qualitative Study of the Teaching of Modern Greek in Western Australia under the "Seconded Teachers from Greece Scheme": Implications for Other Similar Schemes

    Science.gov (United States)

    Evangelinou-Yiannakis, Angela; O'Donoghue, Tom

    2011-01-01

    The aim of the study reported in this paper was to develop an understanding of how the key stakeholders in Western Australia (WA) "dealt with" the teaching of Modern Greek (Greek) as a second language under the "Seconded Teachers from Greece Scheme" (STGS). It addressed a deficit in research in the field not only in relation to WA, but…

  5. AcEST: DK950401 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0008_I23 654 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0008_I23. 5' end seq ... SYGIALPDWALNKRRLAEAVDRIELPPFQPKQGVKIVTDEKATNLSTPASDDS MVINQLI 541 S+G+A+P+WA + +LA+ V++I +P F+PKQGV IVTDE ... SYGIALPDWALNKRRL-AEAVDRIELPPFQPKQGVKIVTDEKATNLSTPASDDS MVINQL 538 ++GI + +WA +L AEAVD++ +P FQPKQGVKIVTDEKA ...

  6. Anti-cancer activity of withaferin A in B-cell lymphoma.

    Science.gov (United States)

    McKenna, M K; Gachuki, B W; Alhakeem, S S; Oben, K N; Rangnekar, V M; Gupta, R C; Bondada, S

    2015-07-01

    Withaferin A (WA), a withanolide from the plant, Ashwagandha (Withania somnifera) used in Ayurvedic medicine, has been found to be valuable in the treatment of several medical ailments. WA has been found to have anticancer activity against various solid tumors, but its effects on hematological malignancies have not been studied in detail. WA strongly inhibited the survival of several human and murine B cell lymphoma cell lines. Additionally, in vivo studies with syngeneic-graft lymphoma cells suggest that WA inhibits the growth of tumor but does not affect other proliferative tissues. We demonstrate that WA inhibits the efficiency of NF-?B nuclear translocation in diffuse large B cell lymphomas and found that WA treatment resulted in a significant decrease in protein levels involved in B cell receptor signaling and cell cycle regulation. WA inhibited the activity of heat shock protein (Hsp) 90 as reflected by a sharp increase in Hsp70 expression levels. Hence, we propose that the anti-cancer effects of WA in lymphomas are likely due to its ability to inhibit Hsp90 function and subsequent reduction of critical kinases and cell cycle regulators that are clients of Hsp90. PMID:26020511

  7. Baseline data on radioactivity in drinking water, groundwater, waste water, sewage sludge, residues, and wastes, referring to annual report 1989 'Environmental radioactivity and radiation exposure'

    International Nuclear Information System (INIS)

    This issue of the WaBoLu series gives a comprehensive survey of the radioactivity in drinking water, groundwater, waste water, sewage sludge, residues and wastes in the FRG, as measured in the year 1989 and compiled by the Leitstelle of the WaBoLu Institute of the Federal Board of Health. (orig.)

  8. 77 FR 38384 - Qualification of Drivers; Exemption Applications; Vision

    Science.gov (United States)

    2012-06-27

    ...Jr. (VA) Spencer N. Haugen (ND) William G. Hix (AR) Ralph E. Holmes (MD...Kennedy (OH) Aaron C. Lougher (OR) William F. Mack (WA) Patrick E. Martin (WA...Andrew W. Schollett (CO) Joseph B. Shaw, Jr. (VA) Wolfgang V. Spekis...

  9. Estimation of stress-dependent anisotropy from P-wave measurements on a spherical sample.

    Czech Academy of Sciences Publication Activity Database

    Nadri, D.; Bóna, A.; Brajanovski, M.; Lokají?ek, Tomáš

    2011-01-01

    Ro?. 76, ?. 3 (2011), WA91-WA100. ISSN 0016-8033 Institutional research plan: CEZ:AV0Z30130516 Keywords : P-wave elastic anisotropy * high confining stress * Thomsen anisotropy Subject RIV: DB - Geology ; Mineralogy Impact factor: 1.418, year: 2011

  10. 78 FR 18917 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2013-03-28

    ...require inspecting for the presence of repairs and measuring...for the Docket Office (phone: 800-647-5527...Renton, WA 98057-3356; phone: (425) 917-6432...detailed inspection for the presence of repairs at the aft...Renton, WA 98057-3356; phone: (425)...

  11. 76 FR 33155 - Safety Zones; Multiple Firework Displays in Captain of the Port, Puget Sound Area of Responsibility

    Science.gov (United States)

    2011-06-08

    ...displays on navigable waters. Under 5 U...WA; Tenold-Jordan Wedding on July...this rule or any policy or action of the...Environmental Policy Act of 1969...Navigation (water), Reporting...4. Tenold-Jordan Wedding, Shilshole...Seattle, WA: All waters of Shilshole...

  12. 77 FR 41931 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2012-07-17

    ...action revises that NPRM by changing the keyway position of certain...address for the Docket Office (phone: 800-647-5527) is in the...Renton, WA 98057- 3356; phone: 425-917-6478; fax...Renton, WA 98057-3356; phone: 425-917-6478; fax:...

  13. Spatial evapotranspiration, rainfall and land use data in water accounting – Part 2: Reliability of water accounting results for policy decisions in the Awash basin

    Directory of Open Access Journals (Sweden)

    P. Karimi

    2014-01-01

    Full Text Available Water Accounting Plus (WA+ is a framework that summarizes complex hydrological processes and water management issues in river basins. The framework is designed to use satellite based measurements of land and water as input data. A concern associated with the use of satellite measurements is their accuracy. This study focuses on the impact of the error in remote sensing measurements on water accounting and information provided to policy makers. The Awash basin in the central rift valley in Ethiopia is used as a case study to explore the reliability of WA+ outputs, in the light of input data errors. The Monte Carlo technique was used for stochastic simulation of WA+ outputs over a period of three years. The results show that the stochastic mean of the majority of WA+ parameters and performance indicators are within 5% deviation from the original values. Stochastic simulation can be used as part of a standard procedure for WA+ water accounting because it provides the error bandwidth for every WA+ output, which is essential information for sound decision making. The majority of WA+ parameters and performance indicators have a Coefficient of Variation (CV of less than 20% which implies that they are reliable. The results also indicate that the "utilized flow" and "basin closure fraction" (the degree to which available water in a basin is utilized have a high margin of error and thus a low reliability. As such it is recommended that they are not used to formulate important policy decisions.

  14. Laboratory Investigation on Compressive Strength and Micro-structural Features of Foamed Concrete with Addition of Wood Ash and Silica Fume as a Cement Replacement

    Directory of Open Access Journals (Sweden)

    Othuman Mydin M.A.

    2014-01-01

    Full Text Available Wood Ash (WA and Silica Fume (SF exhibit good cementation properties and have great potential as supplementary binder materials for the concrete production industry. This study will focus on enhancing the micro-structural formation and compressive strength of foamed concrete with the addition of WA and SF. A total of 3 mixes were prepared with the addition of WA and SF at various cement replacement levels by total binder weight. For this particular study, the combination of WA (5%, 10%, and 15% by binder weight and SF (5%, 10%, and 15% by binder weight were utilized as supplementary binder materials to produce foamed concrete mixes. As was made evident from micrographs obtained in the study, the improvement observed in the compressive strength of the foamed concrete was due to a significant densification in the microstructure of the cement paste matrix in the presence of WA and SF hybrid supplementary binders. Experimental results indicated that the combination of 15% SF and 5% WA by binder weight had a more substantial influence on the compressive strength of foamed concrete compared to the control mix. Furthermore, the addition of WA and SF significantly prolonged the setting times of the blended cement paste of the foamed concrete.

  15. Clinical experience and outcomes of community-acquired and nosocomial methicillin-resistant Staphylococcus aureus in a northern Australian hospital.

    Science.gov (United States)

    Maguire, G P; Arthur, A D; Boustead, P J; Dwyer, B; Currie, B J

    1998-04-01

    Methicillin-resistant Staphylococcus aureus (MRSA) is a well-recognized cause of hospital-acquired sepsis. We reviewed the clinical features of a new variant of community-acquired MRSA originally described from the Kimberley region of northern Western Australia (WA MRSA). This strain has become an increasing cause of community- and hospital-acquired sepsis at Royal Darwin Hospital (RDH) in the Northern Territory, especially in Aboriginal Australians from remote communities. Fifty percent of WA MRSA was community-acquired, with 76% in Aboriginals. Like the MRSA from eastern Australia (EA MRSA), WA MRSA commonly caused skin sepsis but was less likely to cause respiratory or urinary infections compared with EA MRSA. Twelve out of 125 (9.6%) WA MRSA and 7/93 (7.5%) EA MRSA infections were septicaemias. Septicaemia due to WA MRSA occurred in adult medical patients, especially those with temporary haemodialysis catheters, while EA MRSA septicaemia occurred throughout the hospital. Aboriginal people were more likely to develop both community- and hospital-acquired WA MRSA septicaemia [overall relative risk (RR) 12.3 (95% CI 3.7-40.7)]. Control of WA MRSA requires policies to reduce transmission in both hospitals and communities. Community-based control programmes need support for individual patient management, improved housing and hygiene, control of skin sepsis and appropriate use of antibiotics, especially in rural Aboriginal communities in northern Australia. PMID:9602976

  16. Withaferin A inhibits NF-kappaB activation by targeting cysteine 179 in IKK?.

    Science.gov (United States)

    Heyninck, Karen; Lahtela-Kakkonen, Maija; Van der Veken, Pieter; Haegeman, Guy; Vanden Berghe, Wim

    2014-10-15

    The transcription factor NF-?B is one of the main players involved in inflammatory responses during which NF-?B becomes rapidly activated. However to maintain homeostasis, this NF-?B activation profile is only transient. Nevertheless deregulation of NF-?B activity is often observed and can lead to chronic inflammatory diseases as well as cancer. Therefore various research projects focus on the development of therapeutics that target the NF-?B activation pathway. One such compound is Withaferin A from the Ayurvedic plant Withania somnifera. Several reports already described the NF-?B inhibiting, anti-inflammatory capacity of WA, either in vitro as well as in vivo. However the underlying molecular mechanism remains largely unknown. In this paper we demonstrate a direct interaction of WA with the IKK-complex, more specifically with IKK?, a kinase which is indispensable for the nuclear translocation of NF-?B. Hereby WA directly inhibits IKK catalytic activity. By mutation of Cys179 in IKK? we could demonstrate loss of interaction between IKK? and WA indicating that WA exerts its anti-inflammatory effects by targeting the crucial Cys179 residue located in the catalytic site of IKK?. Upon docking of WA to a IKK? homology structure model, WA was found to fit nicely into the groove of IKK? where it can form hydrogen bond to stabilize its interaction with Cys179. PMID:25159986

  17. Bronchial morphometry in smokers: comparison with healthy subjects by using 3D CT

    International Nuclear Information System (INIS)

    The assessment of airway dimensions in patients with airway disease by using computed tomography (CT) has been limited by the obliquity of bronchi, the ability to identify the bronchial generation, and the limited number of bronchial measurements. The aims of the present study were (i) to analyze cross-sectional bronchial dimensions after automatic orthogonal reconstruction of all visible bronchi on CT images, and (ii) to compare bronchial morphometry between smokers and nonsmokers. CT and pulmonary function tests were performed in 18 males separated into two groups: 9 nonsmokers and 9 smokers. Bronchial wall area (WA) and lumen area (LA) were assessed using dedicated 3D software able to provide accurate cross-sectional measurements of all visible bronchi on CT. WA/LA and WA/(WA+LA) ratios were computed and all parameters were compared between both groups. Smokers demonstrated greater WA, smaller LA, and consequently greater LA/WA and LA/(WA+LA) ratios than nonsmokers. These differences occurred downward starting at the fourth bronchial generation. 3D quantitative CT method is able to demonstrate significant changes in bronchial morphometry related to tobacco consumption. (orig.)

  18. Getting ready for SPS beam

    CERN Multimedia

    1977-01-01

    View from downstream of the WA7 experiment along beam H1B. In the foreground are scintillator hodoscopes and immediately behind them, is a threshold Cerenkov counter, standing on its edge. The WA7 control hut is located on the right, over the concrete shielding blocks. Still more right, the other branch of the H1 beam, E1A/H1A, runs towards the Omega Facility. WA7 by the CERN-Genoa-LAPP, Annecy-Niels Bohr Institute, Copenhagen-Oslo, University College, London Collaboration was meant to study two-body reactions at large transverse momentum.

  19. [Effects of thyroid hormone level alterations on the Weberian apparatus ontogeny of cyprinids (Cyprinidae; Teleostei)].

    Science.gov (United States)

    Kapitanova, D V; Shkil', F N

    2014-01-01

    Effects of thyroid hormone (TH) level alterations on the development and definitive morphology of the Weberian apparatus (WA, morphofunctional complex, providing transmission of sound signals from the gas bladder to the labyrinth of inner ear) were experimentally assessed in cyprinid fishes (Labeobarbus intermedius and Danio rerio). Alterations of TH-level were shown to lead to heterochronies, changes of timing and rates of ontogenetic events resulting in changes of definitive morphology of some structures as well as of the WA as a whole. Differences, in reaction of WA structures to the TH-level alterations, and inter- and intraspecific variability of TH-responsiveness were revealed. PMID:25739296

  20. Cardiovascular disease risk score prediction models for women and its applicability to Asians

    OpenAIRE

    Goh LGH; Dhaliwal SS; Welborn TA; Thompson PL; Maycock BR; Kerr DA; Lee AH; Bertolatti D; Clark KM; Naheed R; Coorey R; Della PR

    2014-01-01

    Louise GH Goh,1 Satvinder S Dhaliwal,1 Timothy A Welborn,2 Peter L Thompson,2–4 Bruce R Maycock,1 Deborah A Kerr,1 Andy H Lee,1 Dean Bertolatti,1 Karin M Clark,1 Rakhshanda Naheed,1 Ranil Coorey,1 Phillip R Della5 1School of Public Health, Curtin Health Innovation Research Institute, Curtin University, Perth, WA, Australia; 2Sir Charles Gairdner Hospital, Nedlands, Perth, WA, Australia; 3School of Population Health, University of Western Australia, Perth, WA, Australia; 4Harry Perkins I...