Therapeutic Potential of Ginsenosides as an Adjuvant Treatment for Diabetes

Science.gov (United States)

Bai, Litao; Gao, Jialiang; Wei, Fan; Zhao, Jing; Wang, Danwei; Wei, Junping

2018-01-01

Ginseng, one of the oldest traditional Chinese medicinal herbs, has been used widely in China and Asia for thousands of years. Ginsenosides extracted from ginseng, which is derived from the roots and rhizomes of Panax ginseng C. A. Meyer, have been used in China as an adjuvant in the treatment of diabetes mellitus. Owing to the technical complexity of ginsenoside production, the total ginsenosides are generally extracted. Accumulating evidence has shown that ginsenosides exert antidiabetic effects. In vivo and in vitro tests revealed the potential of ginsenoside Rg1, Rg3, Rg5, Rb1, Rb2, Rb3, compound K, Rk1, Re, ginseng total saponins, malonyl ginsenosides, Rd, Rh2, F2, protopanaxadiol (PPD) and protopanaxatriol (PPT)-type saponins to treat diabetes and its complications, including type 1 diabetes mellitus, type 2 diabetes mellitus, diabetic nephropathy, diabetic cognitive dysfunction, type 2 diabetes mellitus with fatty liver disease, diabetic cerebral infarction, diabetic cardiomyopathy, and diabetic erectile dysfunction. Many effects are attributed to ginsenosides, including gluconeogenesis reduction, improvement of insulin resistance, glucose transport, insulinotropic action, islet cell protection, hepatoprotective activity, anti-inflammatory effect, myocardial protection, lipid regulation, improvement of glucose tolerance, antioxidation, improvement of erectile dysfunction, regulation of gut flora metabolism, neuroprotection, anti-angiopathy, anti-neurotoxic effects, immunosuppression, and renoprotection effect. The molecular targets of these effects mainly contains GLUTs, SGLT1, GLP-1, FoxO1, TNF-α, IL-6, caspase-3, bcl-2, MDA, SOD, STAT5-PPAR gamma pathway, PI3K/Akt pathway, AMPK-JNK pathway, NF-κB pathway, and endoplasmic reticulum stress. Rg1, Rg3, Rb1, and compound K demonstrated the most promising therapeutic prospects as potential adjuvant medicines for the treatment of diabetes. This paper highlights the underlying pharmacological mechanisms of the

The treatment implementation advisor: a component of the GypsES project

Science.gov (United States)

Michael C. Saunders; Michael A. Foster

1991-01-01

The treatment implementation advisor is one of the knowledge based advisory modules of GypsES, a knowledge system environment for decision support in gypsy moth management. Its function is to provide detailed advice on intervention tactics for gypsy moth: e.g. aerial and ground application of insecticides and microbials, inundative or augmentative releases of...

Fermentation of protopanaxadiol type ginsenosides (PD) with probiotic Bifidobacterium lactis and Lactobacillus rhamnosus.

Science.gov (United States)

Tan, Joanne Sh; Yeo, Chia-Rou; Popovich, David G

2017-07-01

Ginsenosides are believed to be the principal components behind the pharmacological actions of ginseng, and their bioactive properties are closely related to the type, position, and number of sugar moieties attached to the aglycone; thus, modification of the sugar chains may markedly change their biological activities. In this study, major protopanaxadiol type ginsenosides (PD) Rb1, Rc, and Rb2 were isolated from Panax ginseng and were transformed using two probiotic strains namely Bifidobacterium lactis Bi-07 and Lactobacillus rhamnosus HN001 to obtain specific deglycosylated ginsenosides. It was demonstrated that B. lactis transformed ginsenosides Rb1, Rc, and Rb2 to Rd within 1 h of fermentation and rare ginsenoside F2 by the conversion of Rd after 12-h fermentation. The maximum Rd concentration was 147.52 ± 1.45 μg/mL after 48-h fermentation as compared to 45.85 ± 0.71 μg/mL before fermentation. In contrast, L. rhamnosus transformed Rb1, Rc, and Rb2 into Rd as the final metabolite after 72-h fermentation. B. lactis displayed significantly (p fermentation. The present study suggests that the fermentation of major PD type ginsenosides with B. lactis Bi-07 may serve as an effective means to afford bioactive deglycosylated ginsenosides and to create novel ginsenoside extracts.

Comparative analysis of the expression level of recombinant ginsenoside-transforming β-glucosidase in GRAS hosts and mass production of the ginsenoside Rh2-Mix

Science.gov (United States)

Siddiqi, Muhammad Zubair; Cui, Chang-Hao; Park, Seul-Ki; Han, Nam Soo; Kim, Sun-Chang

2017-01-01

The ginsenoside Rh2, a pharmaceutically active component of ginseng, is known to have anticancer and antitumor effects. However, white ginseng and red ginseng have extremely low concentrations of Rh2 or Rh2-Mix [20(S)-Rh2, 20(R)-Rh2, Rk2, and Rh3]. To enhance the production of food-grade ginsenoside Rh2, an edible enzymatic bioconversion technique was developed adopting GRAS host strains. A β-glucosidase (BglPm), which has ginsenoside conversion ability, was expressed in three GRAS host strains (Corynebacterium glutamicum, Saccharomyces cerevisiae and Lactococus lactis) by using a different vector system. Enzyme activity in these three GRAS hosts were 75.4%, 11.5%, and 9.3%, respectively, compared to that in the E. coli pGEX 4T-1 expression system. The highly expressed BglPm_C in C. glutamicum can effectively transform the ginsenoside Rg3-Mix [20(S)-Rg3, 20(R)-Rg3, Rk1, Rg5] to Rh2-Mix [20(S)-Rh2, 20(R)-Rh2, Rk2, Rh3] using a scaled-up biotransformation reaction, which was performed in a 10-L jar fermenter at pH 6.5/7.0 and 37°C for 24 h. To our knowledge, this is the first report in which 50 g of PPD-Mix (Rb1, Rb2, Rb3, Rc, and Rd) as a starting substrate was converted to ginsenoside Rg3-Mix by acid heat treatment and then 24.5-g Rh2-Mix was obtained by enzymatic transformation of Rg3-Mix through by BglPm_C. Utilization of this enzymatic method adopting a GRAS host could be usefully exploited in the preparation of ginsenoside Rh2-Mix in cosmetics, functional food, and pharmaceutical industries, thereby replacing the E. coli expression system. PMID:28423055

Identification and characterization of a ginsenoside-transforming β-glucosidase from Pseudonocardia sp. Gsoil 1536 and its application for enhanced production of minor ginsenoside Rg2(S.

Directory of Open Access Journals (Sweden)

Juan Du

Full Text Available The ginsenoside Rg2(S, which is one of the pharmaceutical components of ginseng, is known to have neuroprotective, anti-inflammation, and anti-diabetic effects. However, the usage of ginsenoside Rg2(S is restricted owing to the small amounts found in white and red ginseng. To enhance the production of ginsenoside Rg2(S as a 100 gram unit with high specificity, yield, and purity, an enzymatic bioconversion method was developed to adopt the recombinant glycoside hydrolase (BglPC28, which is a ginsenoside-transforming recombinant β-glucosidase from Pseudonocardia sp. strain Gsoil 1536. The gene, termed bglPC28, encoding β-glucosidase (BglPC28 belonging to the glycoside hydrolase family 3 was cloned. bglPC28 consists of 2,232 bp (743 amino acid residues with a predicted molecular mass of 78,975 Da. This enzyme was overexpressed in Escherichia coli BL21(DE3 using a GST-fused pGEX 4T-1 vector system. The optimum conditions of the recombinant BglPC28 were pH 7.0 and 37 °C. BglPC28 can effectively transform the ginsenoside Re to Rg2(S; the Km values of PNPG and Re were 6.36 ± 1.10 and 1.42 ± 0.13 mM, respectively, and the Vmax values were 40.0 ± 2.55 and 5.62 ± 0.21 µmol min-1 mg-1 of protein, respectively. A scaled-up biotransformation reaction was performed in a 10 L jar fermenter at pH 7.0 and 30°C for 12 hours with a concentration of 20 mg/ml of ginsenoside Re from American ginseng roots. Finally, 113 g of Rg2(S was produced from 150 g of Re with 84.0 ± 1.1% chromatographic purity. These results suggest that this enzymatic method could be usefully exploited in the preparation of ginsenoside Rg2(S in the cosmetics, functional food, and pharmaceutical industries.

The in Vitro Structure-Related Anti-Cancer Activity of Ginsenosides and Their Derivatives

Directory of Open Access Journals (Sweden)

Liang Liu

2011-12-01

Full Text Available Panax ginseng has long been used in Asia as a herbal medicine for the prevention and treatment of various diseases, including cancer. The current study evaluated the cytotoxic potency against a variety of cancer cells by using ginseng ethanol extracts (RSE, protopanaxadiol (PPD-type, protopanaxatriol (PPT-type ginsenosides fractions, and their hydrolysates, which were prepared by stepwise hydrolysis of the sugar moieties of the ginsenosides. The results showed that the cytotoxic potency of the hydrolysates of RSE and total PPD-type or PPT-type ginsenoside fractions was much stronger than the original RSE and ginsenosides; especially the hydrolysate of PPD-type ginsenoside fractions. Subsequently, two derivatives of protopanaxadiol (1, compounds 2 and 3, were synthesized via hydrogenation and dehydration reactions of compound 1. Using those two derivatives and the original ginsenosides, a comparative study on various cancer cell lines was conducted; the results demonstrated that the cytotoxic potency was generally in the descending order of compound 3 > 20(S-dihydroprotopanaxadiol (2 > PPD (1 > 20(S-Rh2 > 20(R-Rh2 ≈ 20(R-Rg3 ≈ 20(S-Rg3. The results clearly indicate the structure-related activities in which the compound with less polar chemical structures possesses higher cytotoxic activity towards cancer cells.

Influence of B-Complex Vitamins on the Pharmacokinetics of Ginsenosides Rg1, Rb1, and Ro After Oral Administration.

Science.gov (United States)

Zheng, Peihe; Chen, Yinbin; Fu, Yangyang; Wang, Hecheng; Wang, Jia; Zheng, Siwen; Xiao, Shengyuan; Wang, Yingping

2017-11-01

After cultivation of ginseng, ginsenosides, which are the major active ingredients of gingeng, were approved for use by the food industry, and began to be used as added functional ingredients to try to improve the quality and price of functional foods. However, the interaction between different types of ginsenosides and nutrients needs further study. We investigated the effect of B-complex vitamins (which are essential nutrients) on the pharmacokinetics of the ginsenosides protopanaxatriol-type saponin Rg 1 , protopanaxadiol-type saponin Rb 1 , and oleanolic acid-type saponin Ro after oral administration. Ginsenosides Rg 1 , Rb 1 , and Ro, with or without B-complex vitamins, respectively, were administered orally to rats to evaluate their pharmacokinetics. The concentration of ginsenosides in plasma was determined by liquid chromatography/tandem mass spectrometry. Pharmacokinetic parameters were fitted using WinNonlin v6.2. After oral coadministration with B-complex vitamins, the area under the concentration-time curve from zero to infinity (AUC 0-∞ ) of ginsenoside Rg 1 was reduced by 70%, that of ginsenoside Rb 1 was reduced by 43%, and that of ginsenoside Ro was reduced by 34%. The AUC 0-∞ of ginsenosides Rg 1 and Rb 1 showed significant differences between different treatments, but the AUC 0-∞ of ginsenoside Ro did not. These results suggest significant ginsenoside-nutrient interactions between ginsenosides Rg 1 , Rb 1 , and B-complex vitamins.

Neuroprotective effects of ginsenoside Rg1-induced neural stem cell transplantation on hypoxic-ischemic encephalopathy

Directory of Open Access Journals (Sweden)

Ying-bo Li

2015-01-01

Full Text Available Ginsenoside Rg1 is the major pharmacologically active component of ginseng, and is reported to have various therapeutic actions. To determine whether it induces the differentiation of neural stem cells, and whether neural stem cell transplantation after induction has therapeutic effects on hypoxic-ischemic encephalopathy, we cultured neural stem cells in 10-80 µM ginsenoside Rg1. Immunohistochemistry revealed that of the concentrations tested, 20 mM ginsenoside Rg1 had the greatest differentiation-inducing effect and was the concentration used for subsequent experiments. Whole-cell patch clamp showed that neural stem cells induced by 20 µM ginsenoside Rg1 were more mature than non-induced cells. We then established neonatal rat models of hypoxic-ischemic encephalopathy using the suture method, and ginsenoside Rg1-induced neural stem cells were transplanted via intracerebroventricular injection. These tests confirmed that neural stem cells induced by ginsenoside had fewer pathological lesions and had a significantly better behavioral capacity than model rats that received saline. Transplanted neural stem cells expressed neuron-specific enolase, and were mainly distributed in the hippocampus and cerebral cortex. The present data suggest that ginsenoside Rg1-induced neural stem cells can promote the partial recovery of complicated brain functions in models of hypoxic-ischemic encephalopathy.

Diclofenac disposition in Indian cow and goat with reference to Gyps vulture population declines

Energy Technology Data Exchange (ETDEWEB)

Taggart, M.A. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); School of Biological Sciences, Department of Plant and Soil Science, University of Aberdeen, AB24 3UU (United Kingdom); Cuthbert, R. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom)]. E-mail: richard.cuthbert@rspb.org.uk; Das, D. [Bombay Natural History Society, Hornbill House, Mumbai, 400023 (India); Sashikumar, C. [Bombay Natural History Society, Hornbill House, Mumbai, 400023 (India); Pain, D.J. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Green, R.E. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Conservation Biology Group, Department of Zoology, University of Cambridge, Downing Street, Cambridge, CB2 3EJ (United Kingdom); Feltrer, Y. [Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Shultz, S. [Royal Society for the Protection of Birds, The Lodge, Sandy, Bedfordshire, SG19 2DL (United Kingdom); Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Cunningham, A.A. [Institute of Zoology, Zoological Society of London, Regent' s Park, London, NW1 4RY (United Kingdom); Meharg, A.A. [School of Biological Sciences, Department of Plant and Soil Science, University of Aberdeen, AB24 3UU (United Kingdom)

2007-05-15

Gyps vultures across India are declining rapidly and the NSAID diclofenac has been shown to be the major cause. Vultures scavenge livestock carcasses that have been treated with diclofenac within the days preceding death. We present data on diclofenac disposition in Indian cow and goat, and field data on the prevalence of diclofenac in carcases in the environment. In the disposition experiment, animals were treated with a single intramuscular injection of diclofenac at 1000 {mu}g kg{sup -1} bw. In cow, diclofenac was detectable in liver, kidney and intestine up to 71 h post-treatment; in plasma, half-life was 12.2 h. In goat, tissue residues were undetectable after 26 h. Prevalence of diclofenac in liver from 36 dead livestock collected in the field was 13.9%. Data suggest that diclofenac residues in Indian cow and goat are short-lived, but diclofenac prevalence in carcasses available to vultures may still be very high. - Residual diclofenac in livestock carcasses in India poses a continuing risk to Gyps vultures.

Diclofenac disposition in Indian cow and goat with reference to Gyps vulture population declines

International Nuclear Information System (INIS)

Taggart, M.A.; Cuthbert, R.; Das, D.; Sashikumar, C.; Pain, D.J.; Green, R.E.; Feltrer, Y.; Shultz, S.; Cunningham, A.A.; Meharg, A.A.

2007-01-01

Gyps vultures across India are declining rapidly and the NSAID diclofenac has been shown to be the major cause. Vultures scavenge livestock carcasses that have been treated with diclofenac within the days preceding death. We present data on diclofenac disposition in Indian cow and goat, and field data on the prevalence of diclofenac in carcases in the environment. In the disposition experiment, animals were treated with a single intramuscular injection of diclofenac at 1000 μg kg -1 bw. In cow, diclofenac was detectable in liver, kidney and intestine up to 71 h post-treatment; in plasma, half-life was 12.2 h. In goat, tissue residues were undetectable after 26 h. Prevalence of diclofenac in liver from 36 dead livestock collected in the field was 13.9%. Data suggest that diclofenac residues in Indian cow and goat are short-lived, but diclofenac prevalence in carcasses available to vultures may still be very high. - Residual diclofenac in livestock carcasses in India poses a continuing risk to Gyps vultures

Endophytic Bacteria Isolated from Panax ginseng Improves Ginsenoside Accumulation in Adventitious Ginseng Root Culture

Directory of Open Access Journals (Sweden)

Xiaolin Song

2017-05-01

Full Text Available Ginsenoside is the most important secondary metabolite of ginseng. Natural sources of wild ginseng have been overexploited. Although root culture could reduce the length of the growth cycle of ginseng, the number of ginsenosides is fewer and their contents are lower in adventitious roots of ginseng than that in ginseng cultivated in the field. In this study, we investigated the effects of endophytic bacterial elicitors on biomass and ginsenoside production in adventitious roots cultures of Panax ginseng. Endophyte LB 5-3 as an elicitor could increase biomass and ginsenoside accumulation in ginseng adventitious root culture. After 6 days elicitation with a 10.0 mL of strain LB 5-3, the content of total ginsenoside was 2.026 mg g−1 which was four times more than that in unchallenged roots. The combination of methyl jasmonate and strain LB 5-3 had a negative effect on ginseng adventitious root growth and ginsenoside production. The genomic DNA of strain LB 5-3 was sequenced, and was found to be most closely related to Bacillus altitudinis (KX230132.1. The challenged ginseng adventitious root extracts exerted inhibitory effect against the HepG2 cells, which IC50 value was 0.94 mg mL−1.

Evaluation of ginsenoside bioconversion of lactic acid bacteria isolated from kimchi

Directory of Open Access Journals (Sweden)

Boyeon Park

2017-10-01

Conclusion: Ginsenoside Rg5 concentration of five LABs have ranged from ∼2.6 μg/mL to 6.5 μg/mL and increased in accordance with the incubation periods. Our results indicate that the enzymatic activity along with acidic condition contribute to the production of minor ginsenoside from lactic acid bacteria.

Protective effect of ginsenoside Re on acute gastric mucosal lesion induced by compound 48/80

Directory of Open Access Journals (Sweden)

Sena Lee

2014-04-01

Full Text Available The protective effect of ginsenoside Re, isolated from ginseng berry, against acute gastric mucosal lesions was examined in rats with a single intraperitoneal injection of compound 48/80 (C48/80. Ginsenoside Re (20 mg/kg or 100 mg/kg was orally administered 0.5 h prior to C48/80 treatment. Ginsenoside Re dose-dependently prevented gastric mucosal lesion development 3 h after C48/80 treatment. Increases in the activities of myeloperoxidase (MPO; an index of neutrophil infiltration and xanthine oxidase (XO and the content of thiobarbituric acid reactive substances (TBARS; an index of lipid peroxidation and decreases in the contents of hexosamine (a marker of gastric mucus and adherent mucus, which occurred in gastric mucosal tissues after C48/80 treatment, were significantly attenuated by ginsenoside Re. The elevation of Bax expression and the decrease in Bcl2 expression after C48/80 treatment were also attenuated by ginsenoside Re. Ginsenoside Re significantly attenuated all these changes 3 h after C48/80 treatment. These results indicate that orally administered ginsenoside Re protects against C48/80-induced acute gastric mucosal lesions in rats, possibly through its stimulatory action on gastric mucus synthesis and secretion, its inhibitory action on neutrophil infiltration, and enhanced lipid peroxidation in the gastric mucosal tissue.

Metabonomics Approach to Assessing the Metabolism Variation and Endoexogenous Metabolic Interaction of Ginsenosides in Cold Stress Rats.

Science.gov (United States)

Zhang, Zhihao; Wang, Xiaoyan; Wang, Jingcheng; Jia, Zhiying; Liu, Yumin; Xie, Xie; Wang, Chongchong; Jia, Wei

2016-06-03

Metabolic profiling technology, a massive information provider, has promoted the understanding of the metabolism of multicomponent medicines and its interactions with endogenous metabolites, which was previously a challenge in clarification. In this study, an untargeted GC/MS-based approach was employed to investigate the urinary metabolite profile in rats with oral administration of ginsenosides and the control group. Significant changes of urinary metabolites contents were observed in the total ginsenosides group, revealing the impact of ginsenosides as indicated by the up- or down-regulation of several pathways involving neurotransmitter-related metabolites, tricarboxylic acid (TCA) cycle, fatty acids β-oxidation, and intestinal microflora metabolites. Meanwhile, a targeted UPLC-QQQ/MS-based metabonomic approach was developed to investigate the changes of urinary ginsenoside metabolites during the process of acute cold stress. Metabolic analysis indicated that upstream ginsenosides (rg1, re, and rf) increased significantly, whereas downstream ginsenosides (ck, ppd, and ppt) decreased correspondingly after cold exposure. Finally, the relationships between ginsenosides and significantly changed metabolites were investigated by correlation analysis.

Comprehensive Profiling and Quantification of Ginsenosides in the Root, Stem, Leaf, and Berry of Panax ginseng by UPLC-QTOF/MS

Directory of Open Access Journals (Sweden)

Jae Won Lee

2017-12-01

Full Text Available The effective production and usage of ginsenosides, given their distinct pharmacological effects, are receiving increasing amounts of attention. As the ginsenosides content differs in different parts of Panax ginseng, we wanted to assess and compare the ginsenosides content in the ginseng roots, leave, stems, and berries. To extract the ginsenosides, 70% (v/v methanol was used. The optimal ultra-performance liquid chromatography-quadrupole time of flight mass spectrometry (UPLC-QTOF/MS method was used to profile various ginsenosides from the different parts of P. ginseng. The datasets were then subjected to multivariate analysis including principal component analysis (PCA and hierarchical clustering analysis (HCA. A UPLC-QTOF/MS method with an in-house library was constructed to profile 58 ginsenosides. With this method, a total of 39 ginsenosides were successfully identified and quantified in the ginseng roots, leave, stem, and berries. PCA and HCA characterized the different ginsenosides compositions from the different parts. The quantitative ginsenoside contents were also characterized from each plant part. The results of this study indicate that the UPLC-QTOF/MS method can be an effective tool to characterize various ginsenosides from the different parts of P. ginseng.

Integrated evaluation of malonyl ginsenosides, amino acids and polysaccharides in fresh and processed ginseng.

Science.gov (United States)

Wan, Jin-Yi; Fan, Yong; Yu, Qing-Tao; Ge, Ya-Zhong; Yan, Chen-Pu; Alolga, Raphael N; Li, Ping; Ma, Zhong-Hua; Qi, Lian-Wen

2015-03-25

Many analytical methods have been developed to characterize ginsenosides in ginseng. Relatively less attention has been paid to the malonyl ginsenosides, amino acids and polysaccharides in various processing ginsengs. In this study, malonyl ginsenosides were characterized by LC-Q-TOF/MS. In positive mode, the most abundant ions at m/z 425.38 were observed corresponding to the protopanoxadiol-type ginsenosides. A rich diagnostic ion at 835.48 was shown representing the malonyl ginsenosides with at least two glucosides. Twelve malonyl ginsenosides were rapidly screened using 835.48-835.49 to restructure ion chromatograms. In negative mode, besides the high deprotonated ion, a neutral loss of 44 Da (CO2) was found. High-energy collision-induced dissociation at 50 V produced the most abundant product ion [M-H-malonyl](-) by a neutral loss of 86 Da. Determination of 17 common amino acids was performed on an automatic amino acid analyzer. Arginine, glutamic acid, and aspartic acid were abundant. The contents of amino acids were 9.1% in fresh ginseng and 3.1% in black ginseng. Phenol-sulfuric acid method was applied to analysis of polysaccharides. The contents of polysaccharides were 29.1% in fresh ginseng and 11.1% in black ginseng. The optimal growth age for the accumulation of constituents was supposed to be 5-6 years. In conclusion, the contents of malonyl ginsenosides, amino acids, and polysaccharides, based on decreasing order, ranked as follows: fresh ginseng>frozen ginseng>white ginseng>stoved ginseng>red ginseng>black ginseng. Processing should be paid more attention for the quality control of ginseng products. Copyright © 2014 Elsevier B.V. All rights reserved.

Ginsenoside Rg1 ameliorates hippocampal long-term potentiation and memory in an Alzheimer's disease model.

Science.gov (United States)

Li, Fengling; Wu, Xiqing; Li, Jing; Niu, Qingliang

2016-06-01

The complex etiopathogenesis of Alzheimer's disease (AD) has limited progression in the identification of effective therapeutic agents. Amyloid precursor protein (APP) and presenilin‑1 (PS1) are always overexpressed in AD, and are considered to be the initiators of the formation of β‑amyloid plaques and the symptoms of AD. In the present study, a transgenic AD model, constructed via the overexpression of APP and PS1, was used to verify the protective effects of ginsenoside Rg1 on memory performance and synaptic plasticity. AD mice (6‑month‑old) were treated via intraperitoneal injection of 0.1‑10 mg/kg ginsenoside Rg1. Long‑term memory, synaptic plasticity, and the levels of AD‑associated and synaptic plasticity‑associated proteins were measured following treatment. Memory was measured using a fear conditioning task and protein expression levels were investigated using western blotting. All the data was analyzed by one-way analysis of variance or t‑test. Following 30 days of consecutive treatment, memory in the AD mouse model was ameliorated in the 10 mg/kg ginsenoside Rg1 treatment group. As demonstrated by biochemical experiments, ginsenoside Rg1 treatment reduced the accumulations of β‑amyloid 1‑42 and phosphorylated (p)‑Tau in the AD model. Additionally, brain-derived neurotrophic factor (BDNF) and p‑TrkB synaptic plasticity‑associated proteins were upregulated following ginsenoside Rg1 application. Correspondingly, long‑term potentiation (LTP) was restored following ginsenoside Rg1 application in the AD mice model. Taken together, ginsenoside Rg1 repaired hippocampal LTP and memory, likely through facilitating the clearance of AD‑associated proteins and through activation of the BDNF‑TrkB pathway. Therefore, ginsenoside Rg1 may be a candidate drug for the treatment of AD.

Production of rare ginsenosides (compound Mc, compound Y and aglycon protopanaxadiol) by β-glucosidase from Dictyoglomus turgidum that hydrolyzes β-linked, but not α-linked, sugars in ginsenosides.

Science.gov (United States)

Lee, Gi-Woong; Kim, Kyoung-Rok; Oh, Deok-Kun

2012-09-01

Optimal hydrolytic activity of β-glucosidase from Dictyoglomus turgidum for the ginsenoside Rd was at pH 5.5 and 80 °C, with a half-life of ~11 h. The enzyme hydrolysed β-linked, but not α-linked, sugar moieties of ginsenosides. It produced the rare ginsenosides, aglycon protopanaxadiol (APPD), compounds Y, and Mc, via three unique transformation pathways: Rb(1) → Rd → F(2) → compound K → APPD, Rb(2) → compound Y, and Rc → compound Mc. The enzyme converted 0.5 mM Rb(2) and 0.5 mM Rc to 0.5 mM compound Y and 0.5 mM compound Mc after 3 h, respectively, with molar conversion yields of 100 %.

Knowledge-based geographic information systems on the Macintosh computer: a component of the GypsES project

Science.gov (United States)

Gregory Elmes; Thomas Millette; Charles B. Yuill

1991-01-01

GypsES, a decision-support and expert system for the management of Gypsy Moth addresses five related research problems in a modular, computer-based project. The modules are hazard rating, monitoring, prediction, treatment decision and treatment implementation. One common component is a geographic information system designed to function intelligently. We refer to this...

Ginsenoside Rg1 enhances lymphatic transport of intrapulmonary silica via VEGF-C/VEGFR-3 signaling in silicotic rats.

Science.gov (United States)

Yu, Jie; Mao, Lijun; Guan, Li; Zhang, Yanlin; Zhao, Jinyuan

2016-03-25

Ginsenoside Rg1, extracted mainly from Panax ginseng, has been shown to exert strong pro-angiogenic activities in vivo. But it is unclear whether ginsenoside Rg1 could promote lung lymphangiogenesis to improve lymphatic transport of intrapulmonary silica in silicotic rats. Here we investigated the effect of ginsenoside Rg1 on lymphatic transport of silica during experimental silicosis, and found that ginsenoside Rg1 treatment significantly raised the silicon content in tracheobronchial lymph nodes and serum to reduce the silicon level in lung interstitium, meanwhile increased pulmonary lymphatic vessel density by enhancing the protein and mRNA expressions of vascular endothelial growth factor-C (VEGF-C) and vascular endothelial growth factor receptor-3 (VEGFR-3). The stimulative effect of ginsenoside Rg1 on lymphatic transport of silica was actively correlated with its pro-lymphangiogenic identity. And VEGFR-3 inhibitor SAR131675 blocked these above effects of ginsenoside Rg1. These findings suggest that ginsenoside Rg1 exhibits good protective effect against lung burden of silica during experimental silicosis through improving lymphatic transport of intrapulmonary silica, which is potentially associated with the activation of VEGF-C/VEGFR-3 signaling pathway. Copyright © 2016 Elsevier Inc. All rights reserved.

A review on the medicinal potentials of ginseng and ginsenosides on cardiovascular diseases

Directory of Open Access Journals (Sweden)

Chang Ho Lee

2014-07-01

Full Text Available Ginseng is widely used for its promising healing and restorative properties as well as for its possible tonic effect in traditional medicine. Nowadays, many studies focus on purified individual ginsenoside, an important constituent in ginseng, and study its specific mechanism of action instead of whole-plant extracts on cardiovascular diseases (CVDs. Of the various ginsenosides, purified ginsenosides such as Rb1, Rg1, Rg3, Rh1, Re, and Rd are the most frequently studied. Although there are many reports on the molecular mechanisms and medical applications of ginsenosides in the treatment of CVDs, many concerns exist in their application. This review discusses current works on the countless pharmacological functions and the potential benefits of ginseng in the area of CVDs. Results: Both in vitro and in vivo results indicate that ginseng has potentially positive effects on heart disease through its various properties including antioxidation, reduced platelet adhesion, vasomotor regulation, improving lipid profiles, and influencing various ion channels. To date, approximately 40 ginsenosides have been identified, and each has a different mechanism of action owing to the differences in chemical structure. This review aims to present comprehensive information on the traditional uses, phytochemistry, and pharmacology of ginseng, especially in the control of hypertension and cardiovascular function. In addition, the review also provides an insight into the opportunities for future research and development on the biological activities of ginseng.

Chronic treatment with ginsenoside Rg1 promotes memory and hippocampal long-term potentiation in middle-aged mice.

Science.gov (United States)

Zhu, G; Wang, Y; Li, J; Wang, J

2015-04-30

Ginseng serves as a potential candidate for the treatment of aging-related memory decline or memory loss. However, the related mechanism is not fully understood. In this study, we applied an intraperitoneal injection of ginsenoside Rg1, an active compound from ginseng in middle-aged mice and detected memory improvement and the underlying mechanisms. Our results showed that a period of 30-day administration of ginsenoside Rg1 enhanced long-term memory in the middle-aged animals. Consistent with the memory improvement, ginsenoside Rg1 administration facilitated weak theta-burst stimulation (TBS)-induced long-term potentiation (LTP) in acute hippocampal slices from middle-aged animals. Ginsenoside Rg1 administration increased the dendritic apical spine numbers and area in the CA1 region. In addition, ginsenoside Rg1 administration up-regulated the expression of hippocampal p-AKT, brain-derived neurotrophic factor (BDNF), proBDNF and glutamate receptor 1 (GluR1), but not p-ERK. Interestingly, the phosphatase and tensin homolog deleted on chromosome ten (PTEN) inhibitor (bpV) mimicked the ginsenoside Rg1 effects, including increasing p-AKT expression, promoting hippocampal basal synaptic transmission, LTP and memory. Taken together, our data suggest that ginsenoside Rg1 treatment improves memory in middle-aged mice possibly through regulating the PI3K/AKT pathway, altering apical spines and facilitating hippocampal LTP. Copyright © 2015 IBRO. Published by Elsevier Ltd. All rights reserved.

Ice XVII as a Novel Material for Hydrogen Storage

Directory of Open Access Journals (Sweden)

Leonardo del Rosso

2017-02-01

Full Text Available Hydrogen storage is one of the most addressed issues in the green-economy field. The latest-discovered form of ice (XVII, obtained by application of an annealing treatment to a H 2 -filled ice sample in the C 0 -phase, could be inserted in the energy-storage context due to its surprising capacity of hydrogen physisorption, when exposed to even modest pressure (few mbars at temperature below 40 K, and desorption, when a thermal treatment is applied. In this work, we investigate quantitatively the adsorption properties of this simple material by means of spectroscopic and volumetric data, deriving its gravimetric and volumetric capacities as a function of the thermodynamic parameters, and calculating the usable capacity in isothermal conditions. The comparison of ice XVII with materials with a similar mechanism of hydrogen adsorption like metal-organic frameworks shows interesting performances of ice XVII in terms of hydrogen content, operating temperature and kinetics of adsorption-desorption. Any application of this material to realistic hydrogen tanks should take into account the thermodynamic limit of metastability of ice XVII, i.e., temperatures below about 130 K.

Ginsenoside Rg3 regulates S-nitrosylation of the NLRP3 inflammasome via suppression of iNOS

Energy Technology Data Exchange (ETDEWEB)

Yoon, Sung-Jin; Park, Jun-Young [Immunotherapy Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon (Korea, Republic of); Department of Functional Genomics, University of Science and Technology, Yuseong-gu, Daejeon (Korea, Republic of); Choi, Song [Immunotherapy Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon (Korea, Republic of); Lee, Jin-Bong; Jung, Haiyoung; Kim, Tae-Don; Yoon, Suk Ran; Choi, Inpyo [Immunotherapy Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon (Korea, Republic of); Department of Functional Genomics, University of Science and Technology, Yuseong-gu, Daejeon (Korea, Republic of); Shim, Sungbo, E-mail: sungbo@ulsan.ac.kr [Department of Biomedical Sciences & Neuromarker Resource Bank (NRB), University of Ulsan College of Medicine, Seoul 138-736 (Korea, Republic of); Park, Young-Jun, E-mail: pyj71@kribb.re.kr [Immunotherapy Research Center, Korea Research Institute of Bioscience and Biotechnology, Yuseong-gu, Daejeon (Korea, Republic of); Department of Functional Genomics, University of Science and Technology, Yuseong-gu, Daejeon (Korea, Republic of)

2015-08-07

Ginsenoside Rg3, a specific biological effector, is well-known as a major bioactive ingredient of Panax ginseng. However, its role in the inflammasome activation process remains unclear. In this report, we demonstrate that ginsenosides 20(R)-Rg3 and 20(S)-Rg3 are capable of suppressing both lethal endotoxic shock and the S-nitrosylation of the NLRP3 inflammasome by inhibiting nitric oxide (NO) production through the regulation of inducible nitric oxide synthase (iNOS) expression. In response to lipopolysaccharide (LPS), the reducing effect of 20(S)-Rg3 and 20(R)-Rg3 on nitric oxide led to an increase in the survival time of mice after lethal endotoxin-induced shock, and excess levels of NO inhibited IL-1β production via the S-nitrosylation of the NLRP3 inflammasome. In addition, ginsenosides 20(R)-Rg3 and 20(S)-Rg3 had suppressive effects on the LPS- or UV-irradiation-induced reactive oxygen species (ROS) levels in macrophage and HaCaT cells and thereby prevented apoptosis of spleen cells in mice. Altogether, these results demonstrate that ginsenoside 20(R)-Rg3 and 20(S)-Rg3, a naturally occurring compound, might act as a dual therapeutic regulator for the treatment of inflammatory and oxidative stress-related diseases. - Highlights: • Ginsenosides Rg3 inhibits NO production through the regulation of iNOS expression. • Ginsenosides Rg3 inhibits the S-nitrosylation of the NLRP3 inflammasome. • Ginsenosides Rg3 suppress on the LPS- or UV-irradiation-induced ROS levels in cells.

A breeding site record of Long-billed Vulture Gyps indicus (Aves: Accipitriformes: Accipitridae from Bejjur Reserve Forest, Telangana, India

Directory of Open Access Journals (Sweden)

Swetha Stotrabhashyam

2015-01-01

Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India.  We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.

Ginsenoside Rg3 induces DNA damage in human osteosarcoma cells and reduces MNNG-induced DNA damage and apoptosis in normal human cells.

Science.gov (United States)

Zhang, Yue-Hui; Li, Hai-Dong; Li, Bo; Jiang, Sheng-Dan; Jiang, Lei-Sheng

2014-02-01

Panax ginseng is a Chinese medicinal herb. Ginsenosides are the main bioactive components of P. ginseng, and ginsenoside Rg3 is the primary ginsenoside. Ginsenosides can potently kill various types of cancer cells. The present study was designed to evaluate the potential genotoxicity of ginsenoside Rg3 in human osteosarcoma cells and the protective effect of ginsenoside Rg3 with respect to N-methyl-N'-nitro-N-nitrosoguanidine (MNNG)-induced DNA damage and apoptosis in a normal human cell line (human fibroblasts). Four human osteosarcoma cell lines (MG-63, OS732, U-2OS and HOS cells) and a normal human cell line (human fibroblasts) were employed to investigate the cytotoxicity of ginsenosides Rg3 by MTT assay. Alkaline comet assay and γH2AX focus staining were used to detect the DNA damage in MG-63 and U-2OS cells. The extent of cell apoptosis was determined by flow cytometry and a DNA ladder assay. Our results demonstrated that the cytotoxicity of ginsenoside Rg3 was dose-dependent in the human osteosarcoma cell lines, and MG-63 and U-2OS cells were the most sensitive to ginsenoside Rg3. As expected, compared to the negative control, ginsenoside Rg3 significantly increased DNA damage in a concentration-dependent manner. In agreement with the comet assay data, the percentage of γH2AX-positive MG-63 and U-2OS cells indicated that ginsenoside Rg3 induced DNA double-strand breaks in a concentration-dependent manner. The results also suggest that ginsenoside Rg3 reduces the extent of MNNG-induced DNA damage and apoptosis in human fibroblasts.

Neuroprotective effects of ginsenoside Rg1 against oxygen–glucose deprivation in cultured hippocampal neurons

Directory of Open Access Journals (Sweden)

Qing He

2014-03-01

Conclusion: Ginsenoside Rg1 has neuroprotective effect on ischemia–reperfusion injury in cultured hippocampal cells mediated by blocking calcium over-influx into neuronal cells and decreasing the nNOS activity after OGD exposure. We infer that ginsenoside Rg1 may serve as a potential therapeutic agent for cerebral ischemia injury.

High altitude and hemoglobin function in the vultures Gyps rueppelli and Aegypius monachus

DEFF Research Database (Denmark)

Weber, Roy E.; Hiebl, Inge; Braunitzer, Gerhard

1988-01-01

Functional characteristics of the stripped composite hemoglobins (Hbs) of lhevultures Gyps rueppellii and Aegypills monachus that can fly at extremely high altitudes, and of component Hbs of G. rueppellii are reported, in relation to influences of pH, temperalure and inositol hexaphosphate. G...... structures of the constituent polypeptide chains to trace molecular adaptations to high-altitude respiration, and to physiological factors (pulmonary hypoxia and hypocapnia, body temperature shifts, and lung and nasal gas and heat exchange) to discern their possible survival value at altitudes of 11300 m....

Comprehensive Characterization for Ginsenosides Biosynthesis in Ginseng Root by Integration Analysis of Chemical and Transcriptome

Directory of Open Access Journals (Sweden)

Jing-Jing Zhang

2017-05-01

Full Text Available Herbgenomics provides a global platform to explore the genetics and biology of herbs on the genome level. Panax ginseng C.A. Meyer is an important medicinal plant with numerous pharmaceutical effects. Previous reports mainly discussed the transcriptome of ginseng at the organ level. However, based on mass spectrometry imaging analyses, the ginsenosides varied among different tissues. In this work, ginseng root was separated into three tissues—periderm, cortex and stele—each for five duplicates. The chemical analysis and transcriptome analysis were conducted simultaneously. Gene-encoding enzymes involved in ginsenosides biosynthesis and modification were studied based on gene and molecule data. Eight widely-used ginsenosides were distributed unevenly in ginseng roots. A total of 182,881 unigenes were assembled with an N50 contig size of 1374 bp. About 21,000 of these unigenes were positively correlated with the content of ginsenosides. Additionally, we identified 192 transcripts encoding enzymes involved in two triterpenoid biosynthesis pathways and 290 transcripts encoding UDP-glycosyltransferases (UGTs. Of these UGTs, 195 UGTs (67.2% were more highly expressed in the periderm, and that seven UGTs and one UGT were specifically expressed in the periderm and stele, respectively. This genetic resource will help to improve the interpretation on complex mechanisms of ginsenosides biosynthesis, accumulation, and transportation.

Enhancement of ginsenoside Rg(1) in Panax ginseng hairy root by overexpressing the α-L-rhamnosidase gene from Bifidobacterium breve.

Science.gov (United States)

Zhang, Ru; Zhang, Bian-Ling; Li, Gu-Cai; Xie, Tao; Hu, Teng; Luo, Zhi-Yong

2015-10-01

To improve the production of ginsenoside Rg1 in Panax ginseng. The α-L-rhamnosidase gene from Bifidobacterium breve (BbRha) was overexpressed into hairy root culture system using Agrobacterium rhizogenes A4. Ginsenoside Rg1 in hairy roots was obtained following transformation via overexpressed gene representing 2.2-fold higher than those of control lines. Several overexpression transgenic hairy root lines were obtained exhibiting markedly increased levels of the corresponding α-L-rhamnosidase enzymatic activity relative to control. Ginsenoside Rg1 levels in the transgenic lines were higher (2.2-fold) than those of control after following 30 days culturing, while ginsenoside Re contents in tested transgenic lines were found to be lower. The transgenic hairy roots harboring α-L-rhamnosidase gene improved the accumulation of ginsenoside Rg1 up to 3.6 mg g(-1) dry weight. BbRha gene selectively enhances the production of ginsenoside Rg1 in P. ginseng hairy roots.

HD-GYP domain proteins regulate biofilm formation and virulence in Pseudomonas aeruginosa

DEFF Research Database (Denmark)

Ryan, Robert P.; Lucey, Jean; O'Donovan, Karen

2009-01-01

residues (YN-GYP). Here we have investigated the role of these proteins in biofilm formation, virulence factor synthesis and virulence of P. aeruginosa. Mutation of PA4108 and PA4781 led to an increase in the level of cyclic-di-GMP in P. aeruginosa, consistent with the predicted activity of the encoded......2572 had a negative influence on swarming that was cryptic and was revealed only after removal of an uncharacterized C-terminal domain. Mutation of PA4108, PA4781 and PA2572 had distinct effects on biofilm formation and architecture of P. aeruginosa. All three proteins contributed to virulence of P...

Ginsenoside Rg1 improves ischemic brain injury by balancing ...

African Journals Online (AJOL)

Tropical Journal of Pharmaceutical Research October 2017; 16 (10): 2469-2475 ... Keywords: Cerebral ischemia, Ginsenoside Rg1, Mitochondrial dysfunction, .... percentage of apoptotic death. .... d), which permit unrestricted use, distribution,.

Ginsenoside Rg1 improves ischemic brain injury by balancing ...

African Journals Online (AJOL)

Ginsenoside Rg1 improves ischemic brain injury by balancing mitochondrial ... and autophagy-related proteins were determined by reat time-polymerase chain ... Treatment with autophagy inhibitors decreased the mitochondrial protective ...

Facile reduction and stabilization of ginsenoside-functionalized gold nanoparticles: optimization, characterization, and in vitro cytotoxicity studies

Science.gov (United States)

Hurh, Joon; Markus, Josua; Kim, Yeon-Ju; Ahn, Sungeun; Castro-Aceituno, Veronica; Mathiyalagan, Ramya; Kim, Yu Jin; Yang, Deok Chun

2017-09-01

Gold nanoparticles (GNPs) are forecasted to provide an attractive platform in biomedicine and catalysis with their potentials of combining a variety of biophysicochemical properties into an integrated nanodevice with great therapeutic and optical functions. There are several reports of crude plant extracts mediating the conversion of metal ions into nanoparticles. However, we aimed to investigate the capability of single bioactive compounds, namely ginsenosides compound K (C-K) and Rh2, to accommodate a synergistic chemical reduction of gold salts by one-pot green chemistry. Ginsenosides C-K and Rh2 are unique triterpenoid saponins present in Panax ginseng Meyer, a perennial plant traditionally used as an oriental medicinal herbal with long history. C-K and Rh2 have demonstrated diverse pharmacological properties such as anticancer, anti-inflammation, anti-aging, and neuroprotective properties. The reduction of gold ions by these ginsenosides led to the production of nontoxic GNPs as tested in mouse macrophage (J774A.1) and human kidney epithelial (HEK-293) in vitro. The kinetics of the bioreduction and the influence of pH were examined by an ultraviolet-visible (UV-Vis) spectrophotometer. GNPs were characterized by field emission transmission electron microscopy (FE-TEM), X-ray diffraction (XRD), dynamic light scattering (DLS), and Fourier transform infrared (FTIR) spectroscopy. Ginsenoside loading efficiency of C-K-GNPs and Rh2-GNPs was determined to be approximately 62.83% and 54.91%, respectively, by thermogravimetric analysis (TGA). These results suggest that one-pot synthesis by ginsenosides C-K and Rh2 may be useful for producing ginsenoside-loaded gold nanocarriers. [Figure not available: see fulltext.

Carbon nanotubes as carriers of Panax ginseng metabolites and enhancers of ginsenosides Rb1 and Rg1 anti-cancer activity

Science.gov (United States)

Lahiani, Mohamed H.; Eassa, Souzan; Parnell, Charlette; Nima, Zeid; Ghosh, Anindya; Biris, Alexandru S.; Khodakovskaya, Mariya V.

2017-01-01

A major benefit to nanomaterial based-medicine is the ability to provide nanosized vehicles for sporadic metabolites. Here, we describe how the conjugation of valuable ginseng secondary metabolites (ginsenoside Rb1 or Rg1) with carbon nanotubes (CNT) can enhance their anti-proliferative and anti-cancer effects. Ginsenoside-CNT conjugate (Rb-CNT or Rg-CNT) permitted the ginsenosides to be used at a low dose, yet achieve a higher incidence of cancer killing. We were able to demonstrate that the ginsenoside-CNT conjugate can decrease cell viability up to 62% in breast cancer cells (MCF-7) and enhance antiproliferation of drug-resistant pancreatic cancer cells (PANC-1) by 61%. The interaction of the ginsenoside-CNT conjugate with breast cancer cells was studied using Raman Spectroscopy mapping. Total transcriptome profiling (Affymetrix platform) of MCF-7 cells treated with the ginsenoside-CNT conjugate shows that a number of cellular, apoptotic and response to stimulus processes were affected. Therefore, our data confirmed the potential use of CNT as a drug delivery system.

A Strategy for Simultaneous Isolation of Less Polar Ginsenosides, Including a Pair of New 20-Methoxyl Isomers, from Flower Buds of Panax ginseng

Directory of Open Access Journals (Sweden)

Sha-Sha Li

2017-03-01

Full Text Available The present study was designed to simultaneously isolate the less polar ginsenosides from the flower buds of Panax ginseng (FBPG. Five ginsenosides, including a pair of new 20-methoxyl isomers, were extracted from FBPG and purified through a five-step integrated strategy, by combining ultrasonic extraction, Diaion Hp-20 macroporous resin column enrichment, solid phase extraction (SPE, reversed-phase high-performance liquid chromatography (RP-HPLC analysis and preparation, and nuclear magnetic resonance (NMR analysis. The quantification of the five ginsenosides was also discussed by a developed method with validations within acceptable limits. Ginsenoside Rg5 showed content of about 1% in FBPG. The results indicated that FBPG might have many different ginsenosides with diverse chemical structures, and the less polar ginsenosides were also important to the quality control and standardization of FBPG.

Molecular sexing of threatened Gyps vultures: an important strategy for conservation breeding and ecological studies

OpenAIRE

Ghorpade, Prabhakar B; Gupta, Praveen K; Prakash, Vibhu; Cuthbert, Richard J; Kulkarni, Mandar; Prakash, Nikita; Das, Asit; Sharma, Anil K; Saini, Mohini

2012-01-01

During the last two decades populations of three resident species of Gyps vulture have declined dramatically and are now threatened with extinction in South Asia. Sex identification of vultures is of key importance for the purpose of conservation breeding as it is desirable to have an equal sex ratio in these monogamous species which are housed together in large colony aviaries. Because vultures are monomorphic, with no differences in external morphology or plumage colour between the sexes, o...

Korean Ginseng Berry Fermented by Mycotoxin Non-producing Aspergillus niger and Aspergillus oryzae: Ginsenoside Analyses and Anti-proliferative Activities.

Science.gov (United States)

Li, Zhipeng; Ahn, Hyung Jin; Kim, Nam Yeon; Lee, Yu Na; Ji, Geun Eog

2016-01-01

To transform ginsenosides, Korean ginseng berry (KGB) was fermented by mycotoxin non-producing Aspergillus niger and Aspergillus oryzae. Changes of ginsenoside profile and anti-proliferative activities were observed. Results showed that A. niger tended to efficiently transform protopanaxadiol (PPD) type ginsenosides such as Rb1, Rb2, Rd to compound K while A. oryzae tended to efficiently transform protopanaxatriol (PPT) type ginsenoside Re to Rh1 via Rg1. Butanol extracts of fermented KGB showed high cytotoxicity on human adenocarcinoma HT-29 cell line and hepatocellular carcinoma HepG2 cell line while that of unfermented KGB showed little. The minimum effective concentration of niger-fermented KGB was less than 2.5 µg/mL while that of oryzae-fermented KGB was about 5 µg/mL. As A. niger is more inclined to transform PPD type ginsenosides, niger-fermented KGB showed stronger anti-proliferative activity than oryzae-fermented KGB.

Neuroprotective effects of ginsenoside Rg1 against oxygen-glucose deprivation in cultured hippocampal neurons.

Science.gov (United States)

He, Qing; Sun, Jianguo; Wang, Qin; Wang, Wei; He, Bin

2014-03-01

Ginsenoside Rg1 (Rg1) is believed to be one of the main active principles in ginseng, a traditional Chinese medicine extensively used to enhance stamina and deal with fatigue as well as physical stress. It has been reported that Rg1 performs multiple biological activities, including neuroprotective activity. In this study, we investigated the efficacy of ginsenoside Rg1 on ischemia-reperfusion injury in cultured hippocampal cells and also probed its possible mechanisms. To establish a model of oxygen-glucose deprivation (OGD) and reperfusion, cultured hippocampal neurons were exposed to OGD for 2.5 hours, followed by a 24-hour reoxygenation. Cultured hippocampal neurons were randomly divided into control group, model group (vehicle), and ginsenoside Rg1 treatment groups (5μM, 20μM, 60μM). At 24 hours post-OGD, the intracellular free calcium concentration was detected using Furo-3/AM-loaded hippocampal neurons deprived of oxygen and glucose. Neuronal nitric oxide synthase (nNOS) activity was measured by chemical colorimetry. Cell apoptosis was evaluated by Hoechst staining, and the neuron viability was determined by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay. Excitotoxic neuronal injury of OGD was demonstrated by the increase of intracellular free calcium concentrations and elevated nNOS activity in the model group compared with the control group. The intracellular free calcium concentrations and the nNOS activity in the groups receiving intermediate and high dose of ginsenoside Rg1 were significantly lower than those of the control group (p cell viability loss (p cell apoptosis induced by OGD. Ginsenoside Rg1 has neuroprotective effect on ischemia-reperfusion injury in cultured hippocampal cells mediated by blocking calcium over-influx into neuronal cells and decreasing the nNOS activity after OGD exposure. We infer that ginsenoside Rg1 may serve as a potential therapeutic agent for cerebral ischemia injury. Copyright © 2014

Effect of B-complex vitamins on the antifatigue activity and bioavailability of ginsenoside Re after oral administration

Directory of Open Access Journals (Sweden)

Yin Bin Chen

2017-04-01

Conclusion: The results suggested that there were pharmacokinetic and pharmacodynamic drug–nutrient interactions between ginsenoside Re and B-complex vitamins. B-complex vitamins can significantly weaken the antifatigue effect and decrease the bioavailability of ginsenoside Re when simultaneously administered orally.

Pharmacogenomics and the Yin/Yang actions of ginseng: anti-tumor, angiomodulating and steroid-like activities of ginsenosides

Directory of Open Access Journals (Sweden)

Yeung Hin

2007-05-01

Full Text Available Abstract In Chinese medicine, ginseng (Panax ginseng C.A. Meyer has long been used as a general tonic or an adaptogen to promote longevity and enhance bodily functions. It has also been claimed to be effective in combating stress, fatigue, oxidants, cancer and diabetes mellitus. Most of the pharmacological actions of ginseng are attributed to one type of its constituents, namely the ginsenosides. In this review, we focus on the recent advances in the study of ginsenosides on angiogenesis which is related to many pathological conditions including tumor progression and cardiovascular dysfunctions. Angiogenesis in the human body is regulated by two sets of counteracting factors, angiogenic stimulators and inhibitors. The 'Yin and Yang' action of ginseng on angiomodulation was paralleled by the experimental data showing angiogenesis was indeed related to the compositional ratio between ginsenosides Rg1 and Rb1. Rg1 was later found to stimulate angiogenesis through augmenting the production of nitric oxide (NO and vascular endothelial growth factor (VEGF. Mechanistic studies revealed that such responses were mediated through the PI3K→Akt pathway. By means of DNA microarray, a group of genes related to cell adhesion, migration and cytoskeleton were found to be up-regulated in endothelial cells. These gene products may interact in a hierarchical cascade pattern to modulate cell architectural dynamics which is concomitant to the observed phenomena in angiogenesis. By contrast, the anti-tumor and anti-angiogenic effects of ginsenosides (e.g. Rg3 and Rh2 have been demonstrated in various models of tumor and endothelial cells, indicating that ginsenosides with opposing activities are present in ginseng. Ginsenosides and Panax ginseng extracts have been shown to exert protective effects on vascular dysfunctions, such as hypertension, atherosclerotic disorders and ischemic injury. Recent work has demonstrates the target molecules of ginsenosides to be a

Pharmacokinetic compatibility of ginsenosides and Schisandra Lignans in Shengmai-san: from the perspective of p-glycoprotein.

Directory of Open Access Journals (Sweden)

Yan Liang

Full Text Available Phytochemical-mediated alterations in P-glycoprotein (P-gp activity may result in herb-drug interactions by altering drug pharmacokinetics. Shengmai-san, a traditional Chinese herbal medicine composed by Panax Ginseng, Ophiopogon Japonicus, and Schisandra Chinensis, is routinely being used for treating various coronary heart diseases. In our previous studies, Schisandra Lignans Extract (SLE was proved as a strong P-gp inhibitor, and herein, the compatibility of Shengmai-san was studied by investigating the influence of SLE on the pharmacokinetics of the ginsenosides from the perspective of P-gp.Pharmacokinetic experiments were firstly performed based on in vitro uptake, efflux and transport experiments in Caco-2, LLC-PK1 wild-type and MDR1-overexpressing L-MDR1 cells. During the whole experiment, digoxin, a classical P-gp substrate, was used as a positive control drug to verify the cells used are the valid models. Meanwhile, the effects of SLE on the pharmacokinetics of ginsenosides were further investigated in rats after single-dose and multi-dose of SLE.The efflux ratios of ginsenoside Rb2, Rc, Rg2, Rg3, Rd and Rb1 were found more than 3.5 in L-MDR1 cells and can be decreased significantly by verapamil (a classical P-gp inhibitor. Contrarily, the efflux ratios of other ginsenosides (Rh1, F1, Re, and Rg1 were lower than 2.0 and not affected by verapamil. Then, the effects of SLE on the uptake and transport of ginsenosides were investigated, and SLE was found can significantly enhance the uptake and inhibit the efflux ratio of ginsenoside Rb2, Rc, Rg2, Rg3, Rd and Rb1 in Caco-2 and L-MDR1 cells. Besides, In vivo experiments showed that single-dose and multi-dose of SLE at 500 mg/kg could increase the area under the plasma concentration time curve of Rb2, Rc and Rd significantly without affecting terminal elimination half-time. In conclusion, SLE could enhance the exposure of ginsenosides Rb2, Rc, Rg2, Rg3, Rd and Rb1 significantly.

Microbial transformation of ginsenosides extracted from Panax ginseng adventitious roots in an airlift bioreactor

OpenAIRE

Xiaolin Song; Hao Wu; Xuanchun Piao; Zhenhao Yin; Chengri Yin

2017-01-01

Background: Ginsenoside is the most important secondary metabolite in ginseng. Natural sources of wild ginseng have been overexploited. Although root culture can reduce the length of the growth cycle of ginseng, the number of species of ginsenosides is reduced and their contents are lower in the adventitious roots of ginseng than in the roots of ginseng cultivated in the field. Results: In this study, 147 strains of β-glucosidase-producing microorganisms were isolated from soil. Of these, ...

Neuroprotective effects of ginsenoside Rg1 against oxygen–glucose deprivation in cultured hippocampal neurons

OpenAIRE

He, Qing; Sun, Jianguo; Wang, Qin; Wang, Wei; He, Bin

2014-01-01

Background: Ginsenoside Rg1 (Rg1) is believed to be one of the main active principles in ginseng, a traditional Chinese medicine extensively used to enhance stamina and deal with fatigue as well as physical stress. It has been reported that Rg1 performs multiple biological activities, including neuroprotective activity. In this study, we investigated the efficacy of ginsenoside Rg1 on ischemia–reperfusion injury in cultured hippocampal cells and also probed its possible mechanisms. Methods...

Temperature diagnostic line ratios of Fe XVII

International Nuclear Information System (INIS)

Raymond, J.C.; Smith, B.W.; Los Alamos National Lab., NM)

1986-01-01

Based on extensive calculations of the excitation rates of Fe XVII, four temperature-sensitive line ratios are investigated, paying special attention to the contribution of resonances to the excitation rates and to the contributions of dielectronic recombination satellites to the observed line intensities. The predictions are compared to FPCS observations of Puppis A and to Solar Maximum Mission (SMM) and SOLEX observations of the sun. Temperature-sensitive line ratios are also computed for emitting gas covering a broad temperature range. It is found that each ratio yields a differently weighted average for the temperature and that this accounts for some apparent discrepancies between the theoretical ratios and solar observations. The effects of this weighting on the Fe XVII temperature diagnostics and on the analogous Fe XXIV/Fe XXV satellite line temperature diagnostics are discussed. 27 references

Ginsenoside Rb1 Reduces Nitric Oxide Production via Inhibition of ...

African Journals Online (AJOL)

Inhibition of Nuclear Factor-κB Activation in Interleukin-1β- ... 20, 40, 80 µM ginsenoside Rb1. NO concentration was assessed by the Griess reaction. ... International Pharmaceutical Abstract, Chemical Abstracts, Embase, Index Copernicus, ...

Mitochondrial DNA analysis of the putative heart of Louis XVII, son of Louis XVI and Marie-Antoinette.

Science.gov (United States)

Jehaes, E; Pfeiffer, H; Toprak, K; Decorte, R; Brinkmann, B; Cassiman, J J

2001-03-01

According to official historiography, the 10-year-old Louis XVII died in the Temple of Paris on June 8, 1795. However, public rumour spread the theory that Louis XVII escaped and that his descendants would be alive today. One such putative 'Louis XVII' was Carl Wilhelm Naundorff, who died in 1845 in Delft (the Netherlands). Comparative mitochondrial DNA (mtDNA) analysis gave evidence that his remains could not be identified as those of Louis XVII. In the present study, mtDNA analysis was performed on the heart of the young boy who died in the prison of Paris in 1795. In order to obtain the strongest evidence possible, two laboratories independently analysed the heart. The results showed that the consensus mtDNA sequence of the heart was identical to that of the maternal relatives of Louis XVII.

XVII sajandi graafika rahvusraamatukogus / Jüri Hain

Index Scriptorium Estoniae

Hain, Jüri, 1941-

2004-01-01

Kuraator J. Hain VI korruse galeriis avatud näitusest "Euroopa XVII sajandi sügavtrükigraafika Eesti Rahvusraamatukogus". Näitusel on esindatud Jacques Callot, Stefano della Bella, Salvator Rosa, Claude Vignon, Valentin Lefebvre, Jacob Matham, Crispijn (van) de Passe jt.

The beneficial effect of ginsenosides extracted by pulsed electric field against hydrogen peroxide-induced oxidative stress in HEK-293 cells

Directory of Open Access Journals (Sweden)

Di Liu

2017-04-01

Conclusion: The present study demonstrated the antioxidative effect of ginsenosides extracted by PEF in vitro. Furthermore, rather than SCSE, PEF may be more useful as an alternative extraction technique for the extraction of ginsenosides with enhanced antioxidant activity.

Inhibitory effect of ginsenoside Rg3 combined with gemcitabine on angiogenesis and growth of lung cancer in mice

International Nuclear Information System (INIS)

Liu, Tai-Guo; Huang, Ying; Cui, Dan-Dan; Huang, Xiao-Bing; Mao, Shu-Hua; Ji, Ling-Ling; Song, Hai-Bo; Yi, Cheng

2009-01-01

Ginsenoside Rg3, a saponin extracted from ginseng, inhibits angiogenesis. The combination of low-dose chemotherapy and anti-angiogenic inhibitors suppresses growth of experimental tumors more effectively than conventional therapy or anti-angiogenic agent alone. The present study was designed to evaluate the efficacy of low-dose gemcitabine combined with ginsenoside Rg3 on angiogenesis and growth of established Lewis lung carcinoma in mice. C57L/6 mice implanted with Lewis lung carcinoma were randomized into the control, ginsenoside Rg3, gemcitabine and combination group. The quality of life and survival of mice were recorded. Tumor volume, inhibitive rate and necrosis rate were estimated. Necrosis of tumor and signals of blood flow as well as dynamic parameters of arterial blood flow in tumors such as peak systolic velocity (PSV) and resistive index (RI) were detected by color Doppler ultrasound. In addition, expression of vascular endothelial cell growth factor (VEGF) and CD31 were observed by immunohistochemstry, and microvessel density (MVD) of the tumor tissues was assessed by CD31 immunohistochemical analysis. Quality of life of mice in the ginsenoside Rg3 and combination group were better than in the control and gemcitabine group. Combined therapy with ginsenoside Rg3 and gemcitabine not only enhanced efficacy on suppression of tumor growth and prolongation of the survival, but also increased necrosis rate of tumor significantly. In addition, the combination treatment could obviously decrease VEGF expression and MVD as well as signals of blood flow and PSV in tumors. Ginsenoside Rg3 combined with gemcitabine may significantly inhibit angiogenesis and growth of lung cancer and improve survival and quality of life of tumor-bearing mice. The combination of chemotherapy and anti-angiogenic drugs may be an innovative and promising therapeutic strategy in the experimental treatment of human lung cancer

[Effect of ginsenoside Rg3 on Pim-3 and Bad proteins in human pancreatic cancer cell line PANC-1].

Science.gov (United States)

Jian, Jie; Hu, Zhi-Fang; Huang, Yuan

2009-05-01

Ginsenoside Rg3 is a traditional Chinese medicine monomer which possesses anticancer effects. This study was to investigate the effects of ginsenoside Rg3 on Pim-3 and phosphorylated Bad (pBad) proteins, pBad (Ser112) and pBad (Ser136) in human pancreatic cancer cell line PANC-1. PANC-1 cells were exposed to 10, 20, 40 and 80 micromol/L ginsenoside Rg3 for 24 h. A short hairpin RNA (shRNA) of Pim-3 was cloned and inserted into a eukaryotic expression vector pSilencer 3.1-H1 Neo to construct pSilencer 3.1-H1 Neo-Pim-3. pSilencer 3.1-H1 Neo-Pim-3 was then transfected into PANC-1 cells. Cell proliferation was measured by MTT assay; cell apoptosis was observed under an invert microscope and measured by flow cytometry with Annexin V/PI staining; protein expressions of Pim-3, Bad, pBad (Ser112) and pBad (Ser136) were measured by Western blot. The inhibitory rates of 10, 20, 40 and 80 micromol/L ginsenoside Rg3 on PANC-1 cells were 20.2%, 33.4%, 52.8% and 65.3%, respectively. Typical morphological changes in apoptosis were induced by ginsenoside Rg3. The apoptotic rate of PANC-1 cells was significantly higher in the ginsenoside Rg3 treatment group (80 micromol/L) than in the control group (12.2% vs. 3.3%, PPANC-1 cells. Compared with the control group, the percentages of early and total apoptotic cells were significantly increased in PANC-1 cells transfected with pim-3-shRNA [(11.5+/-3.7)% vs. (5.8+/-2.2)%,P<0.01;(20.8+/-2.6)% vs.(13.0+/-4.1)%,P<0.05], while the expressions of pim-3 and pBad (Ser112) were both decreased. The anti-tumor effect of ginsenoside Rg3 may be associated with the decrease of Pim-3 and pBad (Ser112).

Cloning and characterization of ginsenoside Ra1-hydrolyzing beta-D-xylosidase from Bifidobacterium breve K-110.

Science.gov (United States)

Hyun, Yang-Jin; Kim, Bomi; Kim, Dong-Hyun

2012-04-01

beta-D-Xylosidase (E.C. 3.2.1.37) from Bifidobacterium breve K-110, which hydrolyzes ginsenoside Ra1 to ginsenoside Rb2, was cloned and expressed in Escherichia coli. The (His6)-tagged recombinant enzyme, designated as XlyBK- 110, was efficiently purified using Ni²⁺-affinity chromatography (109.9-fold, 84% yield). The molecular mass of XylBK- 100 was found to be 55.7 kDa by SDS-PAGE. Its sequence revealed a 1,347 bp open reading frame (ORF) encoding a protein containing 448 amino acids, which showed 82% identity (DNA) to the previously reported glycosyl hydrolase family 30 of Bifidobacterium adolescentis ATCC 15703. The Km and Vmax values toward p-nitrophenyl-beta-D-xylopyranoside (pNPX) were 1.45mM and 10.75 micromol/min/mg, respectively. This enzyme had pH and temperature optima at 6.0 and 45 degrees C, respectively. XylBK-110 acted to the greatest extent on xyloglucosyl kakkalide, followed by pNPX and ginsenoside Ra1, but did not act on p-nitrophenyl-alpha-Larabinofuranoside, p-nitrophenyl-beta-D-glucopyranoside, or p-nitrophenyl-beta-D-fucopyranoside. In conclusion, this is the first report on the cloning and expression of beta-Dxylosidase- hydrolyzing ginsenoside Ra1 and kakkalide from human intestinal microflora.

Whole-Cell Biocatalysis for Producing Ginsenoside Rd from Rb1 Using Lactobacillus rhamnosus GG.

Science.gov (United States)

Ku, Seockmo; You, Hyun Ju; Park, Myeong Soo; Ji, Geun Eog

2016-07-28

Ginsenosides are the major active ingredients in ginseng used for human therapeutic plant medicines. One of the most well-known probiotic bacteria among the various strains on the functional food market is Lactobacillus rhamnosus GG. Biocatalytic methods using probiotic enzymes for producing deglycosylated ginsenosides such as Rd have a growing significance in the functional food industry. The addition of 2% cellobiose (w/v) to glucose-free de Man-Rogosa-Sharpe broths notably induced β-glucosidase production from L. rhamnosus GG. Enzyme production and activity were optimized at a pH, temperature, and cellobiose concentration of 6.0, 40°C, and 2% (w/v), respectively. Under these controlled conditions, β-glucosidase production in L. rhamnosus GG was enhanced by 25-fold. Additionally, whole-cell homogenates showed the highest β-glucosidase activity when compared with disrupted cell suspensions; the cell disruption step significantly decreased the β-glucosidase activity. Based on the optimized enzyme conditions, whole-cell L. rhamnosus GG was successfully used to convert ginsenoside Rb1 into Rd.

Photosynthesis rates, growth, and ginsenoside contents of 2-yr-old Panax ginseng grown at different light transmission rates in a greenhouse.

Science.gov (United States)

Jang, In-Bae; Lee, Dae-Young; Yu, Jin; Park, Hong-Woo; Mo, Hwang-Sung; Park, Kee-Choon; Hyun, Dong-Yun; Lee, Eung-Ho; Kim, Kee-Hong; Oh, Chang-Sik

2015-10-01

Ginseng is a semishade perennial plant cultivated in sloping, sun-shaded areas in Korea. Recently, owing to air-environmental stress and various fungal diseases, greenhouse cultivation has been suggested as an alternative. However, the optimal light transmission rate (LTR) in the greenhouse has not been established. The effect of LTR on photosynthesis rate, growth, and ginsenoside content of ginseng was examined by growing ginseng at the greenhouse under 6%, 9%, 13%, and 17% of LTR. The light-saturated net photosynthesis rate (A sat) and stomatal conductance (g s) of ginseng increased until the LTR reached 17% in the early stage of growth, whereas they dropped sharply owing to excessive leaf chlorosis at 17% LTR during the hottest summer period in August. Overall, 6-17% of LTR had no effect on the aerial part of plant length or diameter, whereas 17% and 13% of LRT induced the largest leaf area and the highest root weight, respectively. The total ginsenoside content of the ginseng leaves increased as the LTR increased, and the overall content of protopanaxatriol line ginsenosides was higher than that of protopanaxadiol line ginsenosides. The ginsenoside content of the ginseng roots also increased as the LTR increased, and the total ginsenoside content of ginseng grown at 17% LTR increased by 49.7% and 68.3% more than the ginseng grown at 6% LTR in August and final harvest, respectively. These results indicate that 13-17% of LTR should be recommended for greenhouse cultivation of ginseng.

Ginsenoside Re Promotes Osteoblast Differentiation in Mouse Osteoblast Precursor MC3T3-E1 Cells and a Zebrafish Model

Directory of Open Access Journals (Sweden)

Hye-Min Kim

2016-12-01

Full Text Available Bone homeostasis is tightly regulated to balance bone formation and bone resorption. Many anabolic drugs are used as bone-targeted therapeutic agents for the promotion of osteoblast-mediated bone formation or inhibition of osteoclast-mediated bone resorption. Previous studies showed that ginsenoside Re has the effect of the suppression of osteoclast differentiation in mouse bone-marrow derived macrophages and zebrafish. Herein, we investigated whether ginsenoside Re affects osteoblast differentiation and mineralization in in vitro and in vivo models. Mouse osteoblast precursor MC3T3-E1 cells were used to investigate cell viability, alkaline phosphatase (ALP activity, and mineralization. In addition, we examined osteoblastic signaling pathways. Ginsenoside Re affected ALP activity without cytotoxicity, and we also observed the stimulation of osteoblast differentiation through the activation of osteoblast markers including runt-related transcription factor 2, type 1 collagen, ALP, and osteocalcin in MC3T3-E1 cells. Moreover, Alizarin red S staining indicated that ginsenoside Re increased osteoblast mineralization in MC3T3-E1 cells and zebrafish scales compared to controls. These results suggest that ginsenoside Re promotes osteoblast differentiation as well as inhibits osteoclast differentiation, and it could be a potential therapeutic agent for bone diseases.

Purification and Characterization of a Ginsenoside Rb1-Hydrolyzing β-Glucosidase from Aspergillus niger KCCM 11239

Directory of Open Access Journals (Sweden)

Kyung Hoon Chang

2012-09-01

Full Text Available Rb1-hydrolyzing β-glucosidase from Aspergillus niger KCCM 11239 was studied to develop a bioconversion process for minor ginsenosides. The specific activity of the purified enzyme was 46.5 times greater than that of the crude enzyme. The molecular weight of the native enzyme was estimated to be approximately 123 kDa. The optimal pH of the purified enzyme was pH 4.0, and the enzyme proved highly stable over a pH range of 5.0–10.0. The optimal temperature was 70 °C, and the enzyme became unstable at temperatures above 60 °C. The enzyme was inhibited by Cu2+, Mg2+, Co2+, and acetic acid (10 mM. In the specificity tests, the enzyme was found to be active against ginsenoside Rb1, but showed very low levels of activity against Rb2, Rc, Rd, Re, and Rg1. The enzyme hydrolyzed the 20-C,β-(1→6-glucoside of ginsenoside Rb1 to generate ginsenoside Rd and Rg3, and hydrolyzed 3-C,β-(1→2-glucoside to generate F2. The properties of the enzyme indicate that it could be a useful tool in biotransformation applications in the ginseng industry, as well as in the development of novel drug compounds.

Collections XVII (The Malone Society)

OpenAIRE

Keenan, Siobhan; Giddens, Eugene

2016-01-01

Collections XVII is the latest volume in the Malone Society's pioneering series of editions of miscellaneous documents relating to English theatre and drama before 1642. It is likely to be of special interest not only to early theatre historians but to those working on Tudor and Stuart court and civic culture, manuscript writing, household drama and early modern women's writing, as it publishes new material in each of these fields. The book includes items such as Revels Office accounts, a pla...

Morphine dependence is attenuated by red ginseng extract and ginsenosides Rh2, Rg3, and compound K

OpenAIRE

Yayeh, Taddesse; Yun, Kyunghwa; Jang, Soyong; Oh, Seikwan

2016-01-01

Background: Red ginseng and ginsenosides have shown plethoric effects against various ailments. However, little is known regarding the effect of red ginseng on morphine-induced dependence and tolerance. We therefore investigated the effect of red ginseng extract (RGE) and biotransformed ginsenosides Rh2, Rg3, and compound K on morphine-induced dependence in mice and rats. Methods: While mice were pretreated with RGE and then morphine was injected intraperitoneally, rats were infused with g...

Effectiveness of Action in India to Reduce Exposure of Gyps Vultures to the Toxic Veterinary Drug Diclofenac

Science.gov (United States)

Cuthbert, Richard; Taggart, Mark A.; Prakash, Vibhu; Saini, Mohini; Swarup, Devendra; Upreti, Suchitra; Mateo, Rafael; Chakraborty, Soumya Sunder; Deori, Parag; Green, Rhys E.

2011-01-01

Contamination of their carrion food supply with the non-steroidal anti-inflammatory drug diclofenac has caused rapid population declines across the Indian subcontinent of three species of Gyps vultures endemic to South Asia. The governments of India, Pakistan and Nepal took action in 2006 to prevent the veterinary use of diclofenac on domesticated livestock, the route by which contamination occurs. We analyse data from three surveys of the prevalence and concentration of diclofenac residues in carcasses of domesticated ungulates in India, carried out before and after the implementation of a ban on veterinary use. There was little change in the prevalence and concentration of diclofenac between a survey before the ban and one conducted soon after its implementation, with the percentage of carcasses containing diclofenac in these surveys estimated at 10.8 and 10.7%, respectively. However, both the prevalence and concentration of diclofenac had fallen markedly 7–31 months after the implementation of the ban, with the true prevalence in this third survey estimated at 6.5%. Modelling of the impact of this reduction in diclofenac on the expected rate of decline of the oriental white-backed vulture (Gyps bengalensis) in India indicates that the decline rate has decreased to 40% of the rate before the ban, but is still likely to be rapid (about 18% year−1). Hence, further efforts to remove diclofenac from vulture food are still needed if the future recovery or successful reintroduction of vultures is to be feasible. PMID:21589920

Pharmacokinetics and efficiency of brain targeting of ginsenosides Rg1 and Rb1 given as Nao-Qing microemulsion.

Science.gov (United States)

Li, Tao; Shu, Ya-Jun; Cheng, Jia-Yin; Liang, Run-Cheng; Dian, Shao-Na; Lv, Xiao-Xun; Yang, Meng-Qi; Huang, Shu-Ling; Chen, Gang; Yang, Fan

2015-02-01

Nao-Qing solution has been shown to be clinically effective in the treatment of acute ischemic stroke (AIS). The purpose of this study was to improve the pharmacokinetics and brain uptake of Nao-Qing, administered as an oil-in-water microemulsion. Sprague-Dawley (SD) rats were given Nao-Qing microemulsion by intranasal or intragastric routes. Samples of blood, brain, heart, liver, lung and kidney were collected at pre-determined time intervals, and the contents of ginsenosides Rg1 and Rb1 (active ingredients of the Nao-Qing microemulsion) were analyzed by high-performance liquid chromatography (HPLC). The results showed that contents of ginsenosides Rg1 and Rb1 in Nao-Qing microemulsion was 8475.13 ± 54.61 μg/ml and 6633.42 ± 527.27 μg/ml, respectively, and that the particle size, pH and viscosity of the microemulsion were 19.9 ± 5.07 nm, 6.1 and 3.056 × 10(-3 )Pas, respectively. Absorption of ginsenoside Rg1 was higher than that of ginsenoside Rb1, which was barely detectable after intragastric administration; furthermore, the concentration of ginsenoside Rg1 in blood and other tissues at each time point was lower for intragastric than for intranasal administration. Compared with intragastric administration, intranasal administration resulted in a shorter tmax (0.08 versus 1 h), a higher Cmax (16.65 versus 11.29 μg/ml), and a higher area under the concentration-time curve (AUC) (592.91 versus 101.70 μgċh/ml) in the brain. The relative rates of uptake (Re) and the ratio of peak concentration (Ce) in the brain were 126.31% and 147.48% for ginsenoside Rg1, respectively. These data illustrate that intranasal administration can promote the absorption of drugs in Nao-Qing microemulsion and achieve fast effect.

Discrepancies between calculated and observed Fe XVII and Ni XIX solar coronal lines

Energy Technology Data Exchange (ETDEWEB)

Loulergue, M [Observatoire de Paris, Section de Meudon, 92 (France); Nussbaumer, H [Eidgenoessische Technische Hochschule, Zurich (Switzerland)

1975-12-01

The 36-levels model atom Fe/sup +16/ of Loulergue and Nussbaumer (1973) is extended to a 51-levels atom including n=4 configuration. The earlier conclusion that relative intensities among the Fe XVII lines are not sufficiently sensitive to variations in electron densities and electron temperature to deduce these parameters from observed intensity ratios still holds. Discrepancies between calculated and observed relative intensities in Fe XVII and Ni XIX are attributed to blends or misidentifications.

Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII

Directory of Open Access Journals (Sweden)

Lizzy Newman

2006-10-01

Full Text Available pA review of Justin Clemens and Russell Grigg (eds., Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII, Duke University Press, 2006. ISBN: 0-8223-3719-3./ppA new book that brings together 16 essays, mostly all commentaries upon Lacan#39;#39;s Seminar XVII, known as #39;The other Side of Psychoanalysis#39;. Topics include the four discourses, the relation between psychoanalysis and contemporary social discourses, the question of social change, the relationship between psychoanalysis and politics, and the structuring function of the Oedipus complex. /p

Transmembrane collagen XVII modulates integrin dependent keratinocyte migration via PI3K/Rac1 signaling.

Directory of Open Access Journals (Sweden)

Stefanie Löffek

Full Text Available The hemidesmosomal transmembrane component collagen XVII (ColXVII plays an important role in the anchorage of the epidermis to the underlying basement membrane. However, this adhesion protein seems to be also involved in the regulation of keratinocyte migration, since its expression in these cells is strongly elevated during reepithelialization of acute wounds and in the invasive front of squamous cell carcinoma, while its absence in ColXVII-deficient keratinocytes leads to altered cell motility. Using a genetic model of murine Col17a1⁻/⁻ keratinocytes we elucidated ColXVII mediated signaling pathways in cell adhesion and migration. Col17a1⁻/⁻ keratinocytes exhibited increased spreading on laminin 332 and accelerated, but less directed cell motility. These effects were accompanied by increased expression of the integrin subunits β4 and β1. The migratory phenotype, as evidenced by formation of multiple unstable lamellipodia, was associated with enhanced phosphoinositide 3-kinase (PI3K activity. Dissection of the signaling pathway uncovered enhanced phosphorylation of the β4 integrin subunit and the focal adhesion kinase (FAK as activators of PI3K. This resulted in elevated Rac1 activity as a downstream consequence. These results provide mechanistic evidence that ColXVII coordinates keratinocyte adhesion and directed motility by interfering integrin dependent PI3K activation and by stabilizing lamellipodia at the leading edge of reepithelializing wounds and in invasive squamous cell carcinoma.

Van Tempeltronk tot katedraal: die kruisweg van Lodewyk XVII

Directory of Open Access Journals (Sweden)

N. Morgan

2007-07-01

Full Text Available From the Temple to the cathedral: the calvary of Louis XVII In 2004, more than 200 years after his death in the Temple prison, the heart of Louis XVII, the successor to France’s last king of the Ancien Régime, Louis XVI, was buried in the royal necropolis of Saint-Denis. Despite numerous publications on the destiny of the Little Prince, the chronology of his short life was not determined by historians and biographers, but by scientists who, in 2000, performed DNA tests on the petrified organ, which was miraculously preserved. Before this date, the biographies of the many pretenders to Louis XVII’s throne (that of Naundorff in particular were better-known than the lifehistory of Marie Antoinette’s youngest son. Since then, various publications have changed this state of affairs, including an historical novel by one of France’s most knowledgeable authors on the monarchy of the 17th and 18th centuries and a biographical novel by a member of the Bourbon family. Antonia Fraser’s (2001 biography on Marie Antoinette and Sofia Coppola’s (2006 film on her life have rekindled interest in the events of the French revolution. The story of Louis XVII, who was used as a pawn by the revolutionaries, is one the most tragic of that period in the country’s history. This article provides an overview of key events gleaned from various sources, translated into Afrikaans for the first time.

XVII Congress of Portuguese Association of Operational Research (APDIO)

CERN Document Server

Miranda, Joao

2015-01-01

The development of Operations Research (OR) requires constant improvements, such as the integration of research results with business applications and innovative educational practice. The full deployment and commercial exploitation of goods and services generally need the construction of strong synergies between educational institutions and businesses. The IO2015 -XVII Congress of APDIO aims at strengthening the knowledge triangle in education, research and innovation, in order to maximize the contribution of OR for sustainable growth, the promoting of a knowledge-based economy, and the smart use of finite resources. The IO2015-XVII Congress of APDIO is a privileged meeting point for the promotion and dissemination of OR and related disciplines, through the exchange of ideas among teachers, researchers, students , and professionals with different background, but all sharing a common desire that is the development of OR.

Ginsenoside Rb1 Attenuates Agonist-Induced Contractile Response via Inhibition of Store-Operated Calcium Entry in Pulmonary Arteries of Normal and Pulmonary Hypertensive Rats

Directory of Open Access Journals (Sweden)

Rui-Xing Wang

2015-03-01

Full Text Available Background: Pulmonary hypertension (PH is characterized by sustained vasoconstriction, enhanced vasoreactivity and vascular remodeling, which leads to right heart failure and death. Despite several treatments are available, many forms of PH are still incurable. Ginsenoside Rb1, a principle active ingredient of Panax ginseng, exhibits multiple pharmacological effects on cardiovascular system, and suppresses monocrotaline (MCT-induced right heart hypertrophy. However, its effect on the pulmonary vascular functions related to PH is unknown. Methods: We examined the vasorelaxing effects of ginsenoside Rb1 on endothelin-1 (ET-1 induced contraction of pulmonary arteries (PAs and store-operated Ca2+ entry (SOCE in pulmonary arterial smooth muscle cells (PASMCs from chronic hypoxia (CH and MCT-induced PH. Results: Ginsenoside Rb1 elicited concentration-dependent relaxation of ET-1-induced PA contraction. The vasorelaxing effect was unaffected by nifedipine, but abolished by the SOCE blocker Gd3+. Ginsenoside Rb1 suppressed cyclopiazonic acid (CPA-induced PA contraction, and CPA-activated cation entry and Ca2+ transient in PASMCs. ET-1 and CPA-induced contraction, and CPA-activated cation entry and Ca2+ transients were enhanced in PA and PASMCs of CH and MCT-treated rats; the enhanced responses were abolished by ginsenoside Rb1. Conclusion: Ginsenoside Rb1 attenuates ET-1-induced contractile response via inhibition of SOCE, and it can effectively antagonize the enhanced pulmonary vasoreactivity in PH.

A PTEN-COL17A1 fusion gene and its novel regulatory role in Collagen XVII expression and GBM malignance.

Science.gov (United States)

Yan, Xiaoyan; Zhang, Chuanbao; Liang, Tingyu; Yang, Fan; Wang, Haoyuan; Wu, Fan; Wang, Wen; Wang, Zheng; Cheng, Wen; Xu, Jiangnan; Jiang, Tao; Chen, Jing; Ding, Yaozhong

2017-10-17

Collagen XVII expression has recently been demonstrated to be correlated with the tumor malignance. While Collagen XVII is known to be widely distributed in neurons of the human brain, its precise role in pathogenesis of glioblastoma multiforme (GBM) is unknown. In this study, we identified and characterized a new PTEN-COL17A1 fusion gene in GMB using transcriptome sequencing. Although fusion gene did not result in measurable fusion protein production, its presence is accompanied with high levels of COL17A1 expression, revealed a novel regulatory mechanism of Collagen XVII expression by PTEN-COL17A1 gene fusion. Knocked down Collagen XVII expression in glioma cell lines resulted in decreased tumor invasiveness, along with significant reduction of MMP9 expression, while increased Collagen XVII expression promotes invasive activities of glioma cells and associated with GBM recurrences. Together, our results uncovered a new PTEN-COL17A1 fusion gene and its novel regulatory role in Collagen XVII expression and GBM malignance, and demonstrated that COL17A1 could serve as a useful prognostic biomarker and therapeutic targets for GBM.

Preparation of Ginsenoside Rg3 and Protection against H2O2-Induced Oxidative Stress in Human Neuroblastoma SK-N-SH Cells

Directory of Open Access Journals (Sweden)

Gang Li

2014-01-01

Full Text Available The aim of this study is to evaluate the protection of ginsenoside Rg3 against oxidative stress in human neuroblastoma SK-N-SH cells. 20(R-ginsenoside Rg3 (20(R-Rg3 and 20(S-ginsenoside Rg3 (20(S-Rg3 were prepared by the method of chemical degradation and column chromatography, and the structure of the two compounds was characterized by 1H-NMR and 13C-NMR spectroscopy. MTT assay and LDH leakage assay were used to determine the cell viability and the oxidative stress cellular model was established by means of H2O2 (600 μM for 4 h. We also investigated the changes of intracellular MDA content, SOD activity, and ROS formation after the treatment of ginsenoside Rg3 for 20 h. The results indicated that both 20 (R-Rg3 and 20 (S-Rg3 had obvious protection against H2O2-induced oxidative stress in SK-N-SH cells. Moreover, 20(R-Rg3 exhibited better antioxidant activity than 20(S-Rg3 in vitro. These findings are expected to provide some implication for further research and application of ginsenoside Rg3 in neuroprotection.

Simultaneous determination of notoginsenoside R₁, ginsenoside Rg₁, ginsenoside Re and 20(S) protopanaxatriol in beagle dog plasma by ultra high performance liquid mass spectrometry after oral administration of a Panax notoginseng saponin preparation.

Science.gov (United States)

Wu, Huichao; Liu, Huimin; Bai, Jie; Lu, Yang; Du, Shouying

2015-01-01

20(S) protopanaxatriol is the main metabolite of notoginsenoside R1, ginsenoside Rg1, ginsenoside Re in Panax notoginseng and has significant activities. A ultra high performance liquid mass spectrometry method has been developed and validated for the simultaneous determination of notoginsenoside R₁ (R1), ginsenoside Rg₁ (Rg₁), ginsenoside Re (Re) and 20(S) protopanaxatriol (PPT) in beagle dog plasma after oral administration of a Panax notoginseng saponin preparation. After the addition of the internal standard (digoxin), plasma samples were subjected to liquid-liquid extraction with acetone and methanol and separated on a 100 × 2.1 mm ACQUITY 1.7 μm C₁₈ column (Waters, USA), with acetonitrile and water as the mobile phase, within a runtime of 7.0 min. The analytes were detected without interference in Selected Reaction Monitoring mode with a change in the electrospray ionization from positive to negative. The detection limits were 0.01 to 0.04 mg/L and the calibration curves of the peak areas for the four ingredients were linear over four orders of magnitude with a correlation coefficient greater than 0.9957. The intra-day and inter-day precision values (relative standard deviation, RSD, %) were within 10.25% and 13.51%, respectively, and the accuracy (relative error, RE, %) was less than 7.81%. The validated method was successfully applied to a comparative pharmacokinetic study of four saponins in beagle dogs after oral administration of a Panax Notoginseng Saponins preparation. The pharmacokinetic parameters were calculated with DAS 3.20. The Tmax and Cmax values indicate a dose-dose relationship between the saponins (R1, Rg1, and Re) and their sapogenin (PPT). Copyright © 2014 Elsevier B.V. All rights reserved.

[Research of anti-aging mechanism of ginsenoside Rg1 on brain].

Science.gov (United States)

Li, Cheng-peng; Zhang, Meng-si; Liu, Jun; Geng, Shan; Li, Jing; Zhu, Jia-hong; Zhang, Yan-yan; Jia, Yan-yan; Wang, Lu; Wang, Shun-he; Wang, Ya-ping

2014-11-01

Neurodegenerative disease is common and frequently occurs in elderly patients. Previous studies have shown that ginsenoside Rg1 was able to inhibit senescent of brain, but the mechanism on the brain during the treatment remains elucidated. To study the mechanism of ginsenoside Rg1 in the process of anti-aging of brain, forty male SD rats were randomly divided into normal group, Rg1 normal group, brain aging model group and Rg1 brain aging model group, each group with 10 rats (brain aging model group: subcutaneous injection of D-galactose (120 mg kg(-1)), qd for 42 consecutive days; Rg1 brain aging model group: while copying the same test as that of brain aging model group, begin intraperitoneal injection of ginsenosides Rg1 (20 mg x kg(-1)) qd for 27 d from 16 d. Rg1 normal group: subcutaneous injection of the same amount of saline; begin intraperitoneal injection of ginsenosides Rg1 (20 mg x kg(-1)) qd for 27 d from 16 d. Normal: injected with an equal volume of saline within the same time. Perform the related experiment on the second day after finishing copying the model or the completion of the first two days of drug injections). Learning and memory abilities were measured by Morris water maze. The number of senescent cells was detected by SA-beta-Gal staining while the level of IL-1 and IL-6 proinflammatory cytokines in hippocampus were detected by ELISA. The activities of SOD, contents of GSH in hippo- campus were quantified by chromatometry. The change of telomerase activities and telomerase length were performed by TRAP-PCR and southern blotting assay, respectively. It is pointed that, in brain aging model group, the spatial learning and memory capacities were weaken, SA-beta-Gal positive granules increased in section of brain tissue, the activity of antioxidant enzyme SOD and the contents of GSH decreased in hippocampus, the level of IL-1 and IL-6 increased in hippocampus, while the length of telomere and the activity of telomerase decreased in hippocampus

Gut microbiota-involved mechanisms in enhancing systemic exposure of ginsenosides by coexisting polysaccharides in ginseng decoction

Science.gov (United States)

Zhou, Shan-Shan; Xu, Jun; Zhu, He; Wu, Jie; Xu, Jin-Di; Yan, Ru; Li, Xiu-Yang; Liu, Huan-Huan; Duan, Su-Min; Wang, Zhuo; Chen, Hu-Biao; Shen, Hong; Li, Song-Lin

2016-03-01

Oral decoctions of traditional Chinese medicines (TCMs) serve for therapeutic and prophylactic management of diseases for centuries. Small molecules and polysaccharides are the dominant chemicals co-occurred in the TCM decoction. Small molecules are well-studied by multidisciplinary elaborations, whereas the role of polysaccharides remains largely elusive. Here we explore a gut microbiota-involved mechanism by which TCM polysaccharides restore the homeostasis of gut microbiota and consequently promote the systemic exposure of concomitant small molecules in the decoction. As a case study, ginseng polysaccharides and ginsenosides in Du-Shen-Tang, the decoction of ginseng, were investigated on an over-fatigue and acute cold stress model. The results indicated that ginseng polysaccharides improved intestinal metabolism and absorption of certain ginsenosides, meanwhile reinstated the perturbed holistic gut microbiota, and particularly enhanced the growth of Lactobacillus spp. and Bacteroides spp., two major metabolic bacteria of ginsenosides. By exploring the synergistic actions of polysaccharides with small molecules, these findings shed new light on scientization and rationalization of the classic TCM decoctions in human health care.

Study on the Correlation between Gene Expression and Enzyme Activity of Seven Key Enzymes and Ginsenoside Content in Ginseng in Over Time in Ji'an, China.

Science.gov (United States)

Yin, Juxin; Zhang, Daihui; Zhuang, Jianjian; Huang, Yi; Mu, Ying; Lv, Shaowu

2017-12-11

Panax ginseng is a traditional medicine. Fresh ginseng is one of the most important industries related to ginseng development, and fresh ginseng of varying ages has different medicinal properties. Previous research has not systematically reported the correlation between changes in key enzyme activity with changes in ginsenoside content in fresh ginseng over time. In this study, for the first time, we use ginseng samples of varying ages in Ji'an and systematically reported the changes in the activity of seven key enzymes (HMGR, FPS, SS, SE, DS, CYP450, and GT). We investigated the content of ginsenoside and gene expression of these key enzymes. Ginsenoside content was measured using HPLC. HPLC, GC-MS, and LC-MS were combined to measure the enzyme activity of the key enzymes. Quantitative PCR was used in the investigation of gene expression. By analyzing the correlation between the enzyme activity and the transcription level of the key enzymes with ginsenoside content, we found that DS and GT enzyme activities are significantly correlated with the ginsenoside content in different ages of ginseng. Our findings might provide a new strategy to discriminate between ginseng of different years. Meanwhile, this research provides important information for the in-depth study of ginsenoside biosynthesis.

Sulfates removal by the GYP-CIX process following lime treatment

International Nuclear Information System (INIS)

Robertson, A.M.; Everett, D.J.; Plessis, N.J. Du

1994-01-01

The treatment of acid mine drainage by limiting results in the discharge of water saturated in gypsum and containing residual metal concentrations. These waters may exceed drinking and irrigation water standards for TDS, sulfates and some metals. The scaling nature of the saturated gypsum solution makes it unsuitable for industrial use and makes further processing difficult and costly. This paper discusses a novel ion exchange process that is suitable to desalinate large volumes of mine and industrial waters with a TDS of up to 6,500 mg/l which is also high in calcium and sulfates, to meet effluent discharge specifications. The GYP-CIX process is a continuous fluidized bed ion-exchange process that effectively removes calcium sulfate from gypsum saturated waters. It uses low cost chemicals such as lime and sulfuric acid for resin regeneration. The only waste product is gypsum and the treated water produced meets standards for reuse or discharge. This process consists of a two stage operation. The first is the removal of cations in a multistage continuous loading train, using cation exchange resin. The second operation is the removal of anions, again in a multistage continuous loading train using anion exchange resin

Synergistic Use of Geniposide and Ginsenoside Rg1 Balance Microglial TNF-α and TGF-β1 following Oxygen-Glucose Deprivation In Vitro: A Genome-Wide Survey

Directory of Open Access Journals (Sweden)

Jun Wang

2015-01-01

Full Text Available Ischemia-activated microglia are like a double-edged sword, characterized by both neurotoxic and neuroprotective effects. The aim of this study was to reveal the synergistic effect of geniposide and ginsenoside Rg1 based on tumor necrosis factor- (TNF- α and transforming growth factor- (TGF- β1 balance of microglia. BV2 microglial cells were divided into 5 groups: control, model (oxygen-glucose deprivation (OGD, geniposide-treated, ginsenoside-Rg1-treated, and combination-treated. A series of assays were used to detect on (i cell viability; (ii NO content; (iii expression (content of TNF-α and TGF-β1; and (iv gene expression profiles. The results showed that integrated use of geniposide and ginsenoside Rg1 significantly inhibited NO level and protected cell viability, improved the content and expression of TGF-β1, and reduced the content and expression of TNF-α. Separated use of geniposide or ginsenoside Rg1 showed different effects at different emphases. Next-generation sequencing showed that Fcγ-receptor-mediated phagocytosis pathway played a key regulatory role in the balance of TNF-α and TGF-β1 when cotreated with geniposide and ginsenoside Rg1. These findings suggest that synergistic drug combination of geniposide and ginsenoside Rg1 in the treatment of stroke is a feasible avenue for the application.

Mengonstruk Masa Depan Nahdlatul Ulama (Studi tentang Rekomendasi Kebijakan Konfercab XVII PCNU Kabupaten Blitar

Directory of Open Access Journals (Sweden)

Arif Muzayin Shofwan

2018-02-01

Full Text Available Nahdlatul Ulama (NU merupakan organisasi keagamaan Islam terbesar di Indonesia yang didirikan oleh ulama pondok pesantren di Surabaya pada tanggal 31 Januari 1926. Ormas ini mulai masuk dan berdiri sebagai cabang di kabupaten Blitar sejak tahun 1352 H/ 1951 M yang pertama kali diketuai oleh Kiai Haji Zahid Syafii. Hingga kini, NU cabang Blitar ini telah melakukan Konfercab ke-XVII. Tulisan kualitiatif dengan pendekatan teori konstruksi sosial ini merupakan studi tentang rekomendasi kebijakan Konfercab XVII NU di kabupaten Blitar untuk masa khidmat 2017-2022. Berdasarkan hal tersebut, tulisan ini menghasilkan bahwa para ulama dan pengurus NU cabang Blitar dalam konfercab XVII NU tersebut telah mengkonstruk beberapa rekomendasi kebijakan yang ditujukan kepada Pemerintah Kabupaten Blitar meliputi lima hal, yaitu bidang pendidikan, ekonomi, sosial, kesehatan, dan partisipasi masyarakat. Selain itu, konfercab ini juga mengkonstruk beberapa kebijakan yang ditujukan kepada pengurus cabang NU kabupaten Blitar terbaru dan warga NU secara keseluruhan dalam rangka membangun sinergi menuju NU ke depan yang lebih mandiri.

Microbial transformation of ginsenosides extracted from Panax ginseng adventitious roots in an airlift bioreactor

Directory of Open Access Journals (Sweden)

Xiaolin Song

2017-03-01

Conclusion: These findings may not only solve the problem of low productivity of metabolite in ginseng root culture but may also result in the development of a new valuable method of manufacturing ginsenoside CK.

Engineering of mesoporous silica nanoparticles for release of ginsenoside CK and Rh2 to enhance their anticancer and anti-inflammatory efficacy: in vitro studies

Science.gov (United States)

Singh, Priyanka; Singh, Hina; Castro-Aceituno, Verónica; Ahn, Sungeun; Kim, Yeon Ju; Farh, Mohamed El-Agamy; Yang, Deok Chun

2017-07-01

The current study highlights the fabrication of drug delivery system by utilizing 200 nm mesoporous silica nanoparticles (MSNPs) with 4-nm pore size, as a carrier system for delivery ginsenoside compound K (CK) and Rh2 to enhance their efficacy. The two pharmacologically imperative ginsenosides, CK and Rh2, were loaded to the MSNPs to prepare MSNPs-CK and MSNPs-Rh2, respectively. A fluorescein isothiocyanate (FITC) fluorescent dye was combined in the MSNPs carrier system, in order to trace the cellular uptake of ginsenoside-loaded nanoparticles for in vitro studies. Following purification, the so-prepared MSNPs-CK-FITC and MSNPs-Rh2-FITC were characterized by several analytical techniques, which includes, high-pressure liquid chromatography (HPLC), 1H NMR, field emission transmission electron microscopy (FE-TEM), Fourier transform infrared spectroscopy (FT-IR), x-ray diffraction (XRD), thermogravimetric analysis (TGA), and dynamic light scattering (DLS). In vitro cytotoxicity assay in HaCaT skin cells, A549 lung cancer cells, HepG2 liver carcinoma cells, and HT-29 colon cancer cell lines were tested for MSNPs-CK-FITC and MSNPs-Rh2-FITC. The results demonstrate the excellent biocompatibility of nanoparticles in normal cell lines (HaCaT skin cells) and anticancer efficacy in all the tested cancer cell lines at 10-μM concentration. Additionally, the in vitro anti-inflammatory behavior of MSNPs-CK-FITC and MSNPs-Rh2-FITC were checked in RAW264.7 (murine macrophage) cell lines. The outcomes showed higher anti-inflammatory efficacy of MSNPs-CK-FITC and MSNPs-Rh2-FITC as compared to standard ginsenosides CK and Rh2 in RAW264.7 cell lines. Thus, with 200 nm MSNPs carrier system for the delivery ginsenosides CK and Rh2, a high amount of loading and increasing in vitro pharmacological efficacies of ginsenosides were realized. This study may provide useful insights for designing and improving the applicability of MSNPs for ginsenoside delivery.

Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII (Book Review

Directory of Open Access Journals (Sweden)

Lizzy Newman

2006-01-01

Full Text Available A review of Justin Clemens and Russell Grigg (eds., Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII, Duke University Press, 2006. ISBN: 0-8223-3719-3.A new book that brings together 16 essays, mostly all commentaries upon Lacan''s Seminar XVII, known as 'The other Side of Psychoanalysis'. Topics include the four discourses, the relation between psychoanalysis and contemporary social discourses, the question of social change, the relationship between psychoanalysis and politics, and the structuring function of the Oedipus complex.

Bioconversion of Ginsenosides in the American Ginseng (西洋參 Xī Yáng Shēn Extraction Residue by Fermentation with Lingzhi (靈芝 Líng Zhī, Ganoderma Lucidum

Directory of Open Access Journals (Sweden)

Bo Yang Hsu

2013-04-01

Full Text Available Ginseng (人参 Rén Shēn has been widely employed in functional foods and traditional medicines in many Asian countries. Owing to the high consumer demand of ginseng products, a large amount of ginseng residue is generated after extraction of ginseng. However, the ginseng residue still contains many bioactive compounds such as ginsenosides. The objective of this research was to convert ginsenosides in American ginseng (西洋參 Xī Yáng Shēn extraction residue (AmR by fermentation with lingzhi (靈芝 Líng Zhī, Ganoderma lucidum and the fermentation products will be used for further hypoglycemic activity research. Thus, this study was primarily focused on the ginsenosides that have been reported to possess hypoglycemic activity. In this study, the changes in seven ginsenoside [Rg1, Re, Rb1, Rc, Rg3(S, compound K (CK, and Rh2(S] in the products as affected by fermentation were investigated. Our results showed that the levels of ginsenosides, namely, Rg1, Rg3(S, and CK increased, while the other ginsenosides (Re, Rb1, and Rc decreased during the fermentation process.

Los vidrios esmaltados catalanes (siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Justina Rodríguez García

2000-01-01

Full Text Available Dentro de la producción vidriera catalana de los siglos xv al xvii, los vidrios esmaltados ocupan el lugar más destacado, por su peculiaridad y calidad artística. Sabemos que Barcelona y Matará fueron los centros más prestigiosos en donde se manufacturó esta calidad de vidrio. No son muy numerosas las piezas conservadas, y aunque el mayor número está concentrado en Barcelona, el resto se encuentra disperso por otras ciudades españolas y extranjeras. Esta serie de objetos nos ha permitido hacer un estudio pormenorizado de la técnica del vidrio esmaltado catalán, siguiendo sus tipologías, y sobre todo, su decoración.Among the Catalonian glass 'production during the xv to xvii centuries, the enamelled glasses are the most significant ones because of tfieir peculiarity and artistic quality. We know that the Barcelona and Mataró were the most prestigious centers where this quality of glass was manifactured. Only a few pieces are preserved and although most of them are concentrated in Barcelona, the rest are dispersed among other spanish and foreign cities.

Development of a standard data base for FBR core nuclear design. 9. Analysis of FCA XVII-1 experiments

International Nuclear Information System (INIS)

Yokoyama, Kenji; Ishikawa, Makoto; Oigawa, Hiroyuki; Iijima, Susumu

1998-10-01

Pnc had developed the adjusted nuclear cross-section library in which the results of the Jupiter experiments were reflected. Using this adjusted library, the distinct improvement of the accuracy in nuclear design of Fbr cores had been achieved. As a recent research, JNC develops a database of other integral data in addition to the JUPITER experiments, aiming at further improvement for accuracy and reliability. In this report, the authors describe the evaluation of the C/E values and the sensitivity analysis for FCA XVII-1 assembly. FCA XVII-1 is a representative mock-up of a MOX fuel sodium cooling FBR core. The criticality, reaction rate ratio, sodium void reactivity worth and 238 U Doppler reactivity worth of FCA XVII-1 were analyzed. The results of C/E values calculated by the standard analytical method for JUPITER experiments are similar to those calculated by the method of JAERI, except for the sodium void reactivity. So, further investigation for sodium void reactivity is necessary. Furthermore, sensitivity analysis shows the characteristics of FCA XVII-1 in comparison with ZPPR-9. (author)

Atomic data and spectral line intensities for Fe XVII

International Nuclear Information System (INIS)

Bhatia, A.K.; Doschek, G.A.

2003-01-01

Electron impact collision strengths and spontaneous radiative decay rates are calculated for Fe XVII. The data pertain to the 73 levels of the configurations, 2s 2 2p 6 , 2s 2 2p 5 3s, 2s 2 2p 5 3p 2s 2 2p 5 3d, 2s2p 6 3s, 2s2p 6 3p, 2s2p 6 3d, 2s 2 2p 5 4s, 2s 2 2p 5 4p, 2s 2 2p 5 4d, 2s2p 6 4s, 2s2p 6 4p, and 2s2p 6 4d. Collision strengths are calculated at 11 incident electron energies: 58.5, 65.0, 70.0, 76.0, 85.0, 127.5, 170.0, 212.5, 255.0, 340.0, and 425.0 Ry. This work is an improvement over our earlier work on Fe XVII in two respects: (1) configurations involving 4s, 4p, and 4d electrons have been added and (2) a broader range of incident electron energies is used in the computation of collision strengths and excitation rate coefficients. Relative spectral line intensities are calculated for astrophysically important transitions. These are obtained by computing the excitation rate coefficients (cm 3 s -1 ), i.e., the collision strengths integrated over a Maxwellian electron distribution, and then solving the equations of detailed balance for the populations of the 73 energy levels, assuming a collisional excitation model and an electron temperature of 4 x 10 6 K. This temperature is typical for Fe XVII when formed in equilibrium by collisional ionization and recombination. Using the excitation rate coefficients and the radiative decay rates, level populations are computed for five electron densities and are given in this paper

Protective effects of geniposide and ginsenoside Rg1 combination treatment on rats following cerebral ischemia are mediated via microglial microRNA‑155‑5p inhibition.

Science.gov (United States)

Wang, Jun; Li, Dan; Hou, Jincai; Lei, Hongtao

2018-02-01

Geniposide, an active component of Gardenia, has been reported to protect against cerebral ischemia in animals. Ginsenoside Rg1, a component of Panax notoginseng, is usually administered in combination with Gardenia for the treatment of acute ischemic stroke; however, there are unknown effects of ginsenoside Rg1 that require further investigation. In the present study, the effects of geniposide and ginsensoide Rg1 combination treatment on focal cerebral ischemic stroke were investigated. For in vivo analysis, male rats were separated into three groups, including the (control), model and geniposide + ginsenoside Rg1 groups (n=8 per group). A middle cerebral artery occlusion model was established as the model group. The treatment group was treated with geniposide (30 mg/kg, tail vein injection) + ginsenoside Rg1 (6 mg/kg, tail vein injection), and the model group received saline instead. Neurobehavioral deficits, infarct volume, brain edema, and the expression of microRNA (miR)‑155‑5p and CD11b by reverse transcription‑quantitative polymerase chain reaction (RT‑qPCR) and immunohistochemistry, were assessed following 24 h of ischemia. For in vitro analysis, BV2 mouse microglial cells were cultured and exposed to geniposide (40 µg/ml) + ginsenoside Rg1 (8 µg/ml) during various durations of oxygen‑glucose deprivation (OGD). The expression levels of miR‑155‑5p, pri‑miR‑155 and pre‑miR‑155 were detected by RT‑qPCR. The results demonstrated that increases in brain infarct volume, edema volume, CD11b‑positive cells and miR‑155‑5p levels were alleviated following geniposide + ginsenoside administration in rats exposed to ischemia. Furthermore, geniposide + ginsenoside Rg1 treatment suppressed the miR‑155‑5p, pri‑miR‑155 and pre‑miR‑155 expression levels in OGD‑injured BV2 microglial cells. The results of the present study demonstrated that tail vein administration of geniposide in combination with ginsenoside Rg1

Detection and quantification of ginsenoside Re in ginseng samples by a chromatographic immunostaining method using monoclonal antibody against ginsenoside Re.

Science.gov (United States)

Morinaga, Osamu; Tanaka, Hiroyuki; Shoyama, Yukihiro

2006-01-02

A chromatographic immunostaining method has been developed for the determination of ginsenoside Re (G-Re) in ginseng samples on a polyethersulphone (PES) membrane. G-Re standard and the extracts of ginseng roots were applied to a PES membrane and developed by methanol-water-acetic acid (45:55:1, by volume). G-Re was clearly detected by an immunostaining method using a monoclonal antibody against G-Re. The coloring spots of G-Re were analyzed quantitatively using NIH Image software indicating at least 0.125 microg of G-Re was detectable. G-Re can be analyzed quantitatively between 0.25 and 4.0 microg.

Ginsenoside Rb1 improves postoperative fatigue syndrome by reducing skeletal muscle oxidative stress through activation of the PI3K/Akt/Nrf2 pathway in aged rats.

Science.gov (United States)

Zhuang, Cheng-Le; Mao, Xiang-Yu; Liu, Shu; Chen, Wei-Zhe; Huang, Dong-Dong; Zhang, Chang-Jing; Chen, Bi-Cheng; Shen, Xian; Yu, Zhen

2014-10-05

Ginsenoside Rb1 is reported to possess anti-fatigue activity, but the mechanisms remain unknown. The aim of this study was to investigate the molecular mechanisms responsible for the anti-fatigue effect of ginsenoside Rb1 on postoperative fatigue syndrome induced by major small intestinal resection (MSIR) in aged rat. Aged rats with MSIR were administrated with ginsenoside Rb1 (15 mg/kg) once a day from 3 days before surgery to the day of sacrifice, or with saline as corresponding controls. Rats without MSIR but going through the same surgery procedure were administrated with saline as blank controls. Anti-fatigue effect was assessed by an open field test; superoxide dismutase, reactive oxygen species and malondialdehyde in skeletal muscle were determined. The mRNA levels of Akt2 and Nrf2 in skeletal muscle were measured by real-time quantitative PCR. The activation of Akt and Nrf2 was examined by western blot and immunohistofluorescence. Our results revealed that ginsenoside Rb1 significantly increased the journey and the rearing frequency, decreased the time of rest in aged rats with MSIR. In addition, ginsenoside Rb1 significantly reduced reactive oxygen species and malondialdehyde release and increased the superoxide dismutase activity of skeletal muscle in aged rats with MSIR. Ginsenoside Rb1 also increased the expression of Akt2 and Nrf2 mRNA, up-regulated Akt phosphorylation and Nrf2 nuclear translocation. These findings indicate that ginsenoside Rb1 has an anti-fatigue effect on postoperative fatigue syndrome in aged rat, and the mechanism possibly involves activation of the PI3K/Akt pathway with subsequent Nrf2 nuclear translocation and induction of antioxidant enzymes. Copyright © 2014 Elsevier B.V. All rights reserved.

Effect of high-dose ginsenoside complex (UG0712 supplementation on physical performance of healthy adults during a 12-week supervised exercise program: A randomized placebo-controlled clinical trial

Directory of Open Access Journals (Sweden)

Eon Sook Lee

2018-04-01

Full Text Available Background: Ginseng has been used as an ergogenic agent, although evidence for its effectiveness is weak. A randomized, double-blind, placebo-controlled clinical trial was conducted to evaluate the effect of a ginsenoside complex (UG0712 on changes in exercise performance. Methods: Sedentary individuals (n=117 were randomly assigned into one of three groups: low-dose ginsenoside supplementation (100 mg/d, n=39, high-dose ginsenoside supplementation (500 mg/d, n=39, or a placebo group (500 mg/d, n=39. All participants underwent a supervised 12-wk aerobic and resistance exercise training course. To assess the effects of supplementation on physical performance, maximal oxygen consumption (VO2max, anaerobic threshold (AT, lactic acid, and muscle strength of the dominant knee were measured at baseline, every visit, and after the training program. Results: Both ginsenoside groups showed significant increases in VO2max and muscular strength during exercise training. There were no definite changes in AT and lactic acid levels over time. After exercise training, there were definite differences in the VO2max (28.64.9 to 33.7±4.9 ml/kg/min in high-dose group vs. 30.4±6.7 to 32.8±6.6 ml/kg/min in placebo, p=0.029 and AT (19.3±4.2 to 20.9±3.5 ml/kg/min in high-dose group vs. 20.0±5.1 to 20.0±4.9 ml/kg/min in placebo, p=0.038 between the high-dose ginsenoside and placebo groups. However, there was no difference in VO2max between the low-dose ginsenoside and placebo groups (p=0.254. There were no differences in muscular strength during exercise training among the three groups. Conclusion: High-dose ginsenoside supplementation (UG0712 augmented the improvement of aerobic capacity by exercise training. Keywords: cardiopulmonary exercise test, ginsenoside, Panax ginseng, randomized controlled trial

Intensity ratio among Ne-like FeXVII n=3-2 transitions

International Nuclear Information System (INIS)

Morita, Shigeru; Oishi, Tetsutarou; Murakami, Izumi; Goto, Motoshi; Huang, Xianli; Zhang, Hongming

2016-01-01

Radial profiles of FeXVII 3s-2p and 3d-2p transitions emitted in wavelength range of 15-17A have been observed in Large Helical Device (LHD). The Chord-integrated radial profiles are converted into radial emissivity profile by means of Abel inversion. The emissivity ratios among FeXVII n=3-2 transitions calculated from the radial emissivity profile are compared with calculation based on a collisional-radiative (CR) model developed for Fe ions. The result reasonably confirms the effect of electron temperature and density on the emissivity ratios. However, the emissivity of 3C (2p"53d "1P_1 → 2p"6) transition is obviously lower than the prediction from the CR model. This discrepancy is consistent with measurements in the solar corona and other laboratory plasmas. (author)

Ginsenoside-Rg{sub 1} induces angiogenesis by the inverse regulation of MET tyrosine kinase receptor expression through miR-23a

Energy Technology Data Exchange (ETDEWEB)

Kwok, Hoi-Hin [Dr. Gilbert Hung Ginseng Laboratory, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Chan, Lai-Sheung [Department of Biology, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Poon, Po-Ying [Dr. Gilbert Hung Ginseng Laboratory, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Yue, Patrick Ying-Kit [Dr. Gilbert Hung Ginseng Laboratory, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Department of Biology, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Wong, Ricky Ngok-Shun, E-mail: rnswong@hkbu.edu.hk [Dr. Gilbert Hung Ginseng Laboratory, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China); Department of Biology, Faculty of Science, Hong Kong Baptist University, Hong Kong SAR (China)

2015-09-15

Therapeutic angiogenesis has been implicated in ischemic diseases and wound healing. Ginsenoside-Rg{sub 1} (Rg{sub 1}), one of the most abundant active components of ginseng, has been demonstrated as an angiogenesis-stimulating compound in different models. There is increasing evidence implicating microRNAs (miRNAs), a group of non-coding RNAs, as important regulators of angiogenesis, but the role of microRNAs in Rg{sub 1}-induced angiogenesis has not been fully explored. In this report, we found that stimulating endothelial cells with Rg{sub 1} could reduce miR-23a expression. In silico experiments predicted hepatocyte growth factor receptor (MET), a well-established mediator of angiogenesis, as the target of miR-23a. Transfection of the miR-23a precursor or inhibitor oligonucleotides validated the inverse relationship of miR-23a and MET expression. Luciferase reporter assays further confirmed the interaction between miR-23a and the MET mRNA 3′-UTR. Intriguingly, ginsenoside-Rg{sub 1} was found to increase MET protein expression in a time-dependent manner. We further demonstrated that ginsenoside-Rg{sub 1}-induced angiogenic activities were indeed mediated through the down-regulation of miR-23a and subsequent up-regulation of MET protein expression, as confirmed by gain- and loss-of-function angiogenic experiments. In summary, our results demonstrated that ginsenoside-Rg{sub 1} could induce angiogenesis by the inverse regulation of MET tyrosine kinase receptor expression through miR-23a. This study has broadened our understanding of the non-genomic effects of ginsenoside-Rg{sub 1,} and provided molecular evidence that warrant further development of natural compound as novel angiogenesis-promoting therapy. - Highlights: • Therapeutic angiogenesis has been implicated in ischemic diseases and wound healing. • Ginsenoside-Rg{sub 1} (Rg{sub 1}) has been demonstrated as an angiogenesis-stimulating compound. • We found that Rg{sub 1} induces angiogenesis by

Ginsenoside F2 reduces hair loss by controlling apoptosis through the sterol regulatory element-binding protein cleavage activating protein and transforming growth factor-β pathways in a dihydrotestosterone-induced mouse model.

Science.gov (United States)

Shin, Heon-Sub; Park, Sang-Yong; Hwang, Eun-Son; Lee, Don-Gil; Mavlonov, Gafurjon Turdalievich; Yi, Tae-Hoo

2014-01-01

This study was conducted to test whether ginsenoside F2 can reduce hair loss by influencing sterol regulatory element-binding protein (SREBP) cleavage-activating protein (SCAP) and the transforming growth factor beta (TGF-β) pathway of apoptosis in dihydrotestosterone (DHT)-treated hair cells and in a DHT-induced hair loss model in mice. Results for ginsenoside F2 were compared with finasteride. DHT inhibits proliferation of hair cells and induces androgenetic alopecia and was shown to activate an apoptosis signal pathway both in vitro and in vivo. The cell-based 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay showed that the proliferation rates of DHT-treated human hair dermal papilla cells (HHDPCs) and HaCaTs increased by 48% in the ginsenoside F2-treated group and by 12% in the finasteride-treated group. Western blot analysis showed that ginsenoside F2 decreased expression of TGF-β2 related factors involved in hair loss. The present study suggested a hair loss related pathway by changing SCAP related apoptosis pathway, which has been known to control cholesterol metabolism. SCAP, sterol regulatory element-binding protein (SREBP) and caspase-12 expression in the ginsenoside F2-treated group were decreased compared to the DHT and finasteride-treated group. C57BL/6 mice were also prepared by injection with DHT and then treated with ginsenoside F2 or finasteride. Hair growth rate, density, thickness measurements and tissue histotological analysis in these groups suggested that ginsenoside F2 suppressed hair cell apoptosis and premature entry to catagen more effectively than finasteride. Our results indicated that ginsenoside F2 decreased the expression of TGF-β2 and SCAP proteins, which have been suggested to be involved in apoptosis and entry into catagen. This study provides evidence those factors in the SCAP pathway could be targets for hair loss prevention drugs.

Photoionization and electron-ion recombination of Fe XVII for high temperature plasmas

International Nuclear Information System (INIS)

Nahar, Sultana N.

2012-01-01

Earlier studies on electron-ion recombination of Fe XVII, e+FeXVIII→FeXVII, concentrated on low temperature region. However, due to its higher abundance, recombination in the high temperature region is of great importance. Total and level-specific recombination cross sections and rates of Fe XVII are presented from the detailed study in the high temperature. The calculations were carried out using the unified method which incorporates both the radiative recombination (RR) and dielectronic recombination (DR) including the interference effects. The method also yields self-consistent set of recombination rates and photoionization cross sections. Unified method is implemented through relativistic Breit-Pauli R-matrix (BPRM) method and close coupling (CC) approximation. For the details of the high energy and high temperature features a CC wave function expansion consisting of 60 levels from n=2 and 3 complexes of the core Fe XVIII was considered. Earlier study included core excitations to n=2 levels only. It is found that the resonances due to core excitations to n=3 levels are much more extensive and stronger than those to n=2 levels and increase the recombination considerably in the high temperature region. While earlier study of 3-level calculations agree very well with the experimentally derived low temperature recombination, the high temperature rate shows a broad peak at about 5×10 6 K, near the maximum abundance of the ion, due to dominance of DR via PEC (photo-excitation-of-core) resonances of n=3 levels. Level-specific recombination rate coefficients, which include both the RR and DR, are presented for 454 levels (n≤10, l≤9, 0 ≤J≤8 with even and odd parities) of Fe XVII. This is the first large-scale BPRM calculations for recombination of a complex atomic system beyond He- and Li-like ions. The results are expected to be accurate with 10-20% uncertainty and provide accurate modelings of ultraviolet to X-ray spectra.

Icon Painters of the Nizhniy Novgorod Volga Region of the XVII Century

Directory of Open Access Journals (Sweden)

Veronicka N. Belyaeva

2012-09-01

Full Text Available The author considers specificity and basic difficulties of biographies of the icon painters of the Nizhniy Novgorod Volga region of the XVII-th century restore. The data on the masters are cites.

A strategy for efficient discovery of new natural compounds by integrating orthogonal column chromatography and liquid chromatography/mass spectrometry analysis: Its application in Panax ginseng, Panax quinquefolium and Panax notoginseng to characterize 437 potential new ginsenosides.

Science.gov (United States)

Yang, Wen-zhi; Ye, Min; Qiao, Xue; Liu, Chun-fang; Miao, Wen-juan; Bo, Tao; Tao, Hai-yan; Guo, De-an

2012-08-20

To discover new natural compounds from herbal medicines tends to be more and more difficult. In this paper, a strategy integrating orthogonal column chromatography and liquid chromatography/mass spectrometry (LC/MS) analysis was proposed, and was applied for rapid discovery of new ginsenosides from Panax ginseng (PG), Panax quinquefolium (PQ), and Panax notoginseng (PN). The ginsenosides extracts were fractionated by MCI gel×silica gel orthogonal column chromatography. The fractions were then separated on a C(18) HPLC column, eluted with a three-component mobile phase (CH(3)CN/CH(3)OH/3mM CH(3)COONH(4)H(2)O), and detected by electrospray ionization tandem mass spectrometry. The structures of unknown ginsenosides were elucidated by analyzing negative and positive ion mass spectra, which provided complementary information on the sapogenins and oligosaccharide chains, respectively. A total of 623 comprising 437 potential new ginsenosides were characterized from the ethanol extracts of PG, PQ and PN. New acylations, diversified saccharide chains and C-17 side chains constituted novelty of the newly identified ginsenosides. An interpretation guideline was proposed for structural characterization of unknown ginsenosides by LC/MS. To confirm reliability of this strategy, two targeted unknown trace ginsenosides were obtained in pure form by LC/MS-guided isolation. Based on extensive NMR spectroscopic analysis and other techniques, they were identified as 3-O-[6-O-(E)-butenoyl-β-D-glucopyranosyl(1,2)-β-D-glucopyranosyl]-20(S)-protopanaxadiol-20-O-β-D-glucopyranosyl(1,6)-β-D-glucopyranoside (named ginsenoside IV) and 3-O-β-D-glucopyranosyl(1,2)-β-D-glucopyranosyl-3β,12β,20(S),24(R)-tetra hydroxy-dammar-25-ene-20-O-β-D-glucopyranosyl(1,6)-β-D-glucopyranoside (ginsenoside V), respectively. The fully established structures were consistent with the MS-oriented structural elucidation. This study expanded our understanding on ginsenosides of Panax species, and the

Protective effect of ginsenoside Rh3 against anticancer drug-induced apoptosis in LLC-PK1 kidney cells

Directory of Open Access Journals (Sweden)

Hye Lim Lee

2017-04-01

Conclusion: These results demonstrate that inhibition of the JNK and ERK mitogen-activated protein kinase signaling cascade plays a critical role in mediating the renoprotective effect of ginsenoside Rh3.

El Buen Pastor y la Monarquía Católica en la segunda mitad del siglo XVII

Directory of Open Access Journals (Sweden)

Iván Sánchez Llanes

2009-01-01

Full Text Available En los siglos XVII y XVIII hay muchas maneras en las que se conceptualiza la relación entre el rey y la comunidad de vasallos, cada una de las cuales muestra algunos aspectos particulares de la teoría y metodología de la praxis del poder político. En este artículo, vamos a explorar la imagen del «Buen pastor» en la monarquía católica en la segunda mitad del siglo XVII y los modos en que apunta una nueva percepción de los deberes y obligaciones que vinculan al rey y su reino.In the XVI and XVII centuries, there are several ways in which the relationship between the king and the community of the vassals is conceptualized, everyone of them showing some particular aspects of the theoretical and methodological praxis of the political power. In this article, we are going to explore the image of the «Good shepherd» in the Catholic monarchy in the second half of the XVII century and the ways in which it points out a new perception of the duties and obligations that links the king and its kingdom.

Complete Genome Sequence of a Genotype XVII Newcastle Disease Virus, Isolated from an Apparently Healthy Domestic Duck in Nigeria

OpenAIRE

Shittu, Ismaila; Sharma, Poonam; Joannis, Tony M.; Volkening, Jeremy D.; Odaibo, Georgina N.; Olaleye, David O.; Williams-Coplin, Dawn; Solomon, Ponman; Abolnik, Celia; Miller, Patti J.; Dimitrov, Kiril M.; Afonso, Claudio L.

2016-01-01

The first complete genome sequence of a strain of Newcastle disease virus (NDV) of genotype XVII is described here. A velogenic strain (duck/Nigeria/903/KUDU-113/1992) was isolated from an apparently healthy free-roaming domestic duck sampled in Kuru, Nigeria, in 1992. Phylogenetic analysis of the fusion protein gene and complete genome classified the isolate as a member of NDV class II, genotype XVII.

Intracellular Trafficking Modulation by Ginsenoside Rg3 Inhibits Brucella abortus Uptake and Intracellular Survival within RAW 264.7 Cells.

Science.gov (United States)

Huy, Tran Xuan Ngoc; Reyes, Alisha Wehdnesday Bernardo; Hop, Huynh Tan; Arayan, Lauren Togonon; Min, WonGi; Lee, Hu Jang; Rhee, Man Hee; Chang, Hong Hee; Kim, Suk

2017-03-28

Ginsenoside Rg3, a saponin extracted from ginseng, has various pharmacological and biological activities; however, its effects against Brucella infection are still unclear. Herein, the inhibitory effects of ginsenoside Rg3 against intracellular parasitic Brucella infection were evaluated through bacterial infection, adherence assays, and LAMP-1 colocalization, as well as immunoblotting and FACS for detecting MAPK signaling proteins and F-actin polymerization, respectively. The internalization, intracellular growth, and adherence of Brucella abortus in Rg3-treated RAW 264.7 cells were significantly decreased compared with the Rg3-untreated control. Furthermore, an apparent reduction of F-actin content and intensity of F-actin fluorescence in Rg3-treated cells was observed compared with B. abortus -infected cells without treatment by flow cytometry analysis and confocal microscopy, respectively. In addition, treating cells with Rg3 decreased the phosphorylation of MAPK signaling proteins such as ERK 1/2 and p38 compared with untreated cells. Moreover, the colocalization of B. abortus -containing phagosomes with LAMP-1 was markedly increased in Rg3-treated cells. These findings suggest that ginsenoside Rg3 inhibits B. abortus infection in mammalian cells and can be used as an alternative approach in the treatment of brucellosis.

Ionic liquid and aqueous two-phase extraction based on salting-out coupled with high-performance liquid chromatography for the determination of seven rare ginsenosides in Xue-Sai-Tong injection.

Science.gov (United States)

Li, Lan-Jie; Jin, Yong-Ri; Wang, Xiao-Zhong; Liu, Ying; Wu, Qian; Shi, Xiao-Lei; Li, Xu-Wen

2015-09-01

A method of ionic liquid salt aqueous two-phase extraction coupled with high-performance liquid chromatography has been developed for the analysis of seven rare ginsenosides including Rg6 , F4 , 20(S)-Rg3 , 20(R)-Rg3 , Rk3 , Rk1 , and Rg5 in Xue-Sai-Tong injection. The injection was mixed with ionic liquid 1-butyl-3-methylimidazolium bromide aqueous solution, and a mixture was obtained. With the addition of sodium dodecyl sulfate and dipotassium phosphate into the mixture, the aqueous two-phase mixture was formed after ultrasonic treatment and centrifuged. Rare ginsenosides were extracted into the upper phase. To obtain a high extraction factors, various influences were considered systematically, such as the volume of ionic liquid, the category and amount of salts, the amount of sodium dodecyl sulfate, the pH value of system, and the time of ultrasonic treatment. Under the optimal condition, rare ginsenosides in Xue-Sai-Tong injection were enriched and detected, the recoveries of seven rare ginsenosides ranged from 90.05 to 112.55%, while relative standard deviations were lower than 2.50%. The developed method was reliable, rapid and sensitive for the determination of seven rare ginsenosides in the injections. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Protective Effect of Ginsenoside Rg1 on Hematopoietic Stem/Progenitor Cells through Attenuating Oxidative Stress and the Wnt/β-Catenin Signaling Pathway in a Mouse Model of d-Galactose-induced Aging.

Science.gov (United States)

Li, Jing; Cai, Dachuan; Yao, Xin; Zhang, Yanyan; Chen, Linbo; Jing, Pengwei; Wang, Lu; Wang, Yaping

2016-06-09

Stem cell senescence is an important and current hypothesis accounting for organismal aging, especially the hematopoietic stem cell (HSC). Ginsenoside Rg1 is the main active pharmaceutical ingredient of ginseng, which is a traditional Chinese medicine. This study explored the protective effect of ginsenoside Rg1 on Sca-1⁺ hematopoietic stem/progenitor cells (HSC/HPCs) in a mouse model of d-galactose-induced aging. The mimetic aging mouse model was induced by continuous injection of d-gal for 42 days, and the C57BL/6 mice were respectively treated with ginsenoside Rg1, Vitamin E or normal saline after 7 days of d-gal injection. Compared with those in the d-gal administration alone group, ginsenoside Rg1 protected Sca-1⁺ HSC/HPCs by decreasing SA-β-Gal and enhancing the colony forming unit-mixture (CFU-Mix), and adjusting oxidative stress indices like reactive oxygen species (ROS), total anti-oxidant (T-AOC), superoxide dismutase (SOD), glutathione peroxidase (GSH-px) and malondialdehyde (MDA). In addition, ginsenoside Rg1 decreased β-catenin and c-Myc mRNA expression and enhanced the phosphorylation of GSK-3β. Moreover, ginsenoside Rg1 down-regulated advanced glycation end products (AGEs), 4-hydroxynonenal (4-HNE), phospho-histone H2A.X (r-H2A.X), 8-OHdG, p16(Ink4a), Rb, p21(Cip1/Waf1) and p53 in senescent Sca-1⁺ HSC/HPCs. Our findings indicated that ginsenoside Rg1 can improve the resistance of Sca-1⁺ HSC/HPCs in a mouse model of d-galactose-induced aging through the suppression of oxidative stress and excessive activation of the Wnt/β-catenin signaling pathway, and reduction of DNA damage response, p16(Ink4a)-Rb and p53-p21(Cip1/Waf1) signaling.

Complete Genome Sequence of a Genotype XVII Newcastle Disease Virus, Isolated from an Apparently Healthy Domestic Duck in Nigeria

Science.gov (United States)

Shittu, Ismaila; Sharma, Poonam; Joannis, Tony M.; Volkening, Jeremy D.; Odaibo, Georgina N.; Olaleye, David O.; Williams-Coplin, Dawn; Solomon, Ponman; Abolnik, Celia; Miller, Patti J.; Dimitrov, Kiril M.

2016-01-01

The first complete genome sequence of a strain of Newcastle disease virus (NDV) of genotype XVII is described here. A velogenic strain (duck/Nigeria/903/KUDU-113/1992) was isolated from an apparently healthy free-roaming domestic duck sampled in Kuru, Nigeria, in 1992. Phylogenetic analysis of the fusion protein gene and complete genome classified the isolate as a member of NDV class II, genotype XVII. PMID:26847901

Animal study of rh-endostatin combined with ginsenoside Rg3 on inhibiting growth of breast cancer xenografts

Directory of Open Access Journals (Sweden)

Chuan-Ming Tong

2016-03-01

Full Text Available Objective: To study the inhibiting effect of rh-endostatin combined with ginsenoside Rg3 on growth of breast cancer xenografts. Methods: C57BL/6 nude mice were selected as research subjects, animal models with breast cancer xenografts were established through subcutaneous injection of breast cancer cells in the neck and randomly divided into A-D groups, and normal saline, rh-endostatin, ginsenoside Rg3 and rh-endostatin combined with ginsenoside Rg3 were injected respectively. Tumor growth, serum angiogenesis factor contents, percentages of cell cycles and expression levels of cell cycle-related molecules in tumor tissue of four groups were compared. Results: 7 d, 14 d and 21 d after treatment, tumor volume as well as serum VEGF and bFGF contents of B group, C group and D group were significantly lower than those of A group, and tumor volume as well as serum VEGF and bFGF contents of D group were significantly lower than those of B group and C group; 21 d after treatment, tumor weight, percentages of S phase and G2/M phase as well as mRNA contents and protein contents of cyclin E and CDC25A in tumor tissue of B group, C group and D group were lower than those of A group, and G0/G1 phase percentages were higher than that of A group; tumor weight, percentages of S phase and G2/M phase as well as mRNA contents and protein contents of cyclin E and CDC25A in tumor tissue of D group were significantly lower than those of B group and C group, and G0/G1 phase percentage was lower than those of B group and C group. Conclusion: rh-endostatin combined with ginsenoside Rg3 can more effectively inhibit growth of breast cancer xenografts, make cell cycle arrest and down-regulate expression of cell cyclerelated molecules.

Korean red ginseng and its primary ginsenosides inhibit ethanol-induced oxidative injury by suppression of the MAPK pathway in TIB-73 cells.

Science.gov (United States)

Park, Hye-Min; Kim, Shang-Jin; Mun, A-Reum; Go, Hyeon-Kyu; Kim, Gi-Beum; Kim, Sung-Zoo; Jang, Seon-Il; Lee, Sei-Jin; Kim, Jin-Shang; Kang, Hyung-Sub

2012-06-14

Panax ginseng (P. ginseng) is one of the most widely used medicinal plants due to its wide spectrum of medicinal effects. Among the currently available Panax ginseng products, Korea red ginseng (KRG) has been shown to exhibit a variety of antioxidative and hepatoprotective action. Our aim was to investigate the effects of KRG and its primary ginsenosides (Rg3 and Rh2) on EtOH-induced injury to mouse hepatocytes (TIB-73). We investigated the effects of KRG and its primary ginsenoside on EtOH-induced injury to TIB-73 cells and evaluated MAPKs signals as a possible mechanism of action. Hepatocytic injury was evaluated by biochemical assays as cell viability, lactate dehydrogenase (LDH), aspartate aminotransferase (AST), ROS and mitochondria membrane potential (MMP) level in TIB-73 cells. The levels of MAPK activation were analyzed by Western blots. The results showed that exposure of EtOH to TIB-73 cells led to cell death and membrane damage, accompanied by a decrease in cell viability, MMP, and Mg(2+) concentrations, but an increase in LDH, AST, ROS and MAPK activation. KRG and its primary ginsenosides reduced EtOH-induced generation of ROS and the activation of ERK and JNK, and increased Mg(2+) concentrations. These results suggest that KRG and its primary ginsenosides inhibit EtOH-induced oxidative injury by suppression of the MAPK pathway in TIB-73 cells. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Caspase-Mediated Anti-Apoptotic Effect of Ginsenoside Rg5, a Main Rare Ginsenoside, on Acetaminophen-Induced Hepatotoxicity in Mice.

Science.gov (United States)

Wang, Zi; Hu, Jun-Nan; Yan, Meng-Han; Xing, Jing-Jing; Liu, Wen-Cong; Li, Wei

2017-10-25

Frequent overdose of acetaminophen (APAP) is one of the most common and important incentives of acute hepatotoxicity. Prior to this work, our research group confirmed that black ginseng (Panax ginseng, BG) showed powerful protective effects on APAP-induced ALI. However, it is not clear which kind of individual ginsenoside from BG plays such a liver protection effect. The objective of the current investigation was to evaluate whether ginsenoside Rg5 (G-Rg5) protected against APAP-induced hepatotoxicity and the involved action mechanisms. Mice were administrated with G-Rg5 at two dosages of 10 or 20 mg/kg for 7 consecutive days. After the last treatment, all of the animals that received a single intraperitoneal injection of APAP (250 mg/kg) showed severe liver toxicity after 24 h, and the liver protection effects of G-Rg5 were examined. The results clearly indicated that pretreatment with G-Rg5 remarkably inhibited the production of serum tumor necrosis factor (TNF-α) and interleukin-1β (IL-1β) compared with the APAP group. Meanwhile, G-Rg5 decreased the hepatic malondialdehyde (MDA) content, the protein expression levels of 4-hydroxynonenal (4-HNE) and cytochrome P450 2E1 (CYP2E1) in the liver tissues. G-Rg5 decreased APAP caused the hepatic overexpression of cyclooxygenase-2 (COX-2) and inducible nitric oxide synthase (iNOS). Furthermore, analysis of immunohistochemistry and Western blotting also indicated that G-Rg5 pretreatment inhibited activation of apoptotic pathways mainly via increasing the expression of Bcl-2 protein, decreasing the expression of Bax protein, proliferating cell nuclear antigen (PCNA), cytochrome c, caspase-3, caspase-8, and caspase-9. Liver histopathological observation provided further evidence that pretreatment with G-Rg5 could significantly inhibit hepatocyte necrosis, inflammatory cell infiltration, and apoptosis caused by APAP. In conclusion, the present study clearly demonstrates that G-Rg5 exerts a liver protection effect against

Optimization of dynamic-microwave assisted enzymatic hydrolysis extraction of total ginsenosides from stems and leaves of panax ginseng by response surface methodology.

Science.gov (United States)

Wang, Xiao-Yan; Ren, Hui

2018-03-21

Ginseng stems and leaves (GSAL) are abundant in ginsenosides compounds. For efficient utilization of GSAL and the enhancement of total ginsenosides (TG) compound yields in GSAL, TG from GSAL were extracted, using dynamic-microwave assisted extraction coupled with enzymatic hydrolysis (DMAE-EH) method. The extraction process has been simulated and its main influencing factors such as ethanol concentration, microwave temperature, microwave time and pump flow rate have been optimized by response surface methodology coupled with a Box-Behnken design(BBD). The experimental results indicated that optimal extraction conditions of TG from GSAL were as follows: ethanol concentration of 75%, microwave temperature of 60°C, microwave time of 20 min and pump flow rate of 38 r/min. After experimental verification, the experimental yields of TG was 60.62 ± 0.85 mg g -1 , which were well agreement with the predicted by the model. In general, the present results demonstrated that DMAE-EH method was successfully used to extract total ginsenosides in GSAL.

The ginsenoside PPD exerts anti-endometriosis effects by suppressing estrogen receptor-mediated inhibition of endometrial stromal cell autophagy and NK cell cytotoxicity.

Science.gov (United States)

Zhang, Bing; Zhou, Wen-Jie; Gu, Chun-Jie; Wu, Ke; Yang, Hui-Li; Mei, Jie; Yu, Jia-Jun; Hou, Xiao-Fan; Sun, Jian-Song; Xu, Feng-Yuan; Li, Da-Jin; Jin, Li-Ping; Li, Ming-Qing

2018-05-14

Endometriosis (EMS) is an estrogen-dependent gynecological disease with a low autophagy level of ectopic endometrial stromal cells (eESCs). Impaired NK cell cytotoxic activity is involved in the clearance obstruction of the ectopic endometrial tissue in the abdominopelvic cavity. Protopanaxadiol (PPD) and protopanaxatriol (PPT) are two metabolites of ginsenosides, which have profound biological functions, such as anti-cancer activities. However, the role and mechanism of ginsenosides and metabolites in endometriosis are completely unknown. Here, we found that the compounds PPD, PPT, ginsenoside-Rg3 (G-Rg3), ginsenoside-Rh2 (G-Rh2), and esculentoside A (EsA) led to significant decreases in the viability of eESCs, particularly PPD (IC50 = 30.64 µM). In vitro and in vivo experiments showed that PPD promoted the expression of progesterone receptor (PR) and downregulated the expression of estrogen receptor α (ERα) in eESCs. Treatment with PPD obviously induced the autophagy of eESCs and reversed the inhibitory effect of estrogen on eESC autophagy. In addition, eESCs pretreated with PPD enhanced the cytotoxic activity of NK cells in response to eESCs. PPD decreased the numbers and suppressed the growth of ectopic lesions in a mouse EMS model. These results suggest that PPD plays a role in anti-EMS activation, possibly by restricting estrogen-mediated autophagy regulation and enhancing the cytotoxicity of NK cells. This result provides a scientific basis for potential therapeutic strategies to treat EMS by PPD or further structural modification.

Characterization of Chondrogenic Gene Expression and Cartilage Phenotype Differentiation in Human Breast Adipose-Derived Stem Cells Promoted by Ginsenoside Rg1 In Vitro

Directory of Open Access Journals (Sweden)

Fang-Tian Xu

2015-11-01

Full Text Available Background/Aims: Investigating and understanding chondrogenic gene expression during the differentiation of human breast adipose-derived stem cells (HBASCs into chondrogenic cells is a prerequisite for the application of this approach for cartilage repair and regeneration. In this study, we aim to characterize HBASCs and to examine chondrogenic gene expression in chondrogenic inductive culture medium containing ginsenoside Rg1. Methods: Human breast adipose-derived stem cells at passage 3 were evaluated based on specific cell markers and their multilineage differentiation capacity. Cultured HBASCs were treated either with basic chondrogenic inductive conditioned medium alone (group A, control or with basic chondrogenic inductive medium plus 10 µg/ml (group B, 50 µg/ml (group C, or 100µg/ml ginsenoside Rg1 (group D. Cell proliferation was assessed using the CCK-8 assay for a period of 9 days. Two weeks after induction, the expression of chondrogenic genes (collagen type II, collagen type XI, ACP, COMP and ELASTIN was determined using real-time PCR in all groups. Results: The different concentrations of ginsenoside Rg1 that were added to the basic chondrogenic inductive culture medium promoted the proliferation of HBASCs at earlier stages (groups B, C, and D but resulted in chondrogenic phenotype differentiation and higher mRNA expression of collagen type II (CO-II, collagen type XI (CO-XI, acid phosphatase (ACP, cartilage oligomeric matrix protein (COMP and ELASTIN compared with the control (group A at later stages. The results reveal an obvious positive dose-effect relationship between ginsenoside Rg1 and the proliferation and chondrogenic phenotype differentiation of HBASCs in vitro. Conclusions: Human breast adipose-derived stem cells retain stem cell characteristics after expansion in culture through passage 3 and serve as a feasible source of cells for cartilage regeneration in vitro. Chondrogenesis in HBASCs was found to be prominent

A Distinctive Pattern of Beauveria bassiana-biotransformed Ginsenoside Products Triggers Mitochondria/FasL-mediated Apoptosis in Colon Cancer Cells.

Science.gov (United States)

Gum, Sang Il; Rahman, Md Khalilur; Won, Jong Soon; Cho, Min Kyung

2016-01-01

Ginseng is one of the most commonly used adaptogens. Transformation into the minor ginsenosides produces compounds with more effective action. Beauveria bassiana, a teleomorph of Cordyceps bassiana, is a highly efficient producer of mammalian steroids and produces large amounts of sugar-utilizing enzymes. However, the fermentation of steroid glycosides in ginseng with B. bassiana has never been studied. Thus, we evaluated the bioconversion of the major ginsenosides in white ginseng by B. bassiana. Interestingly, B. bassiana increased the total amount of protopanaxadiols and hydrolyzed Rb1 into minor ginsenosides, exhibiting high levels of Rd and Rg3, as well as moderate levels of Rb2 and Rc analyzed by high-performance liquid chromatography coupled with evaporative light-scattering detection. The β-glucosidase activity was highly increased, which led to the selective elimination of sugar moiety at the 20-C position of Rb1 to Rd, followed by Rg3. Rb2 and Rc accumulated because of the minimal activities of α-L-arabinopyranosidase and α-L-arabinofuranosidase, respectively. The fermentation product exerted dose-dependent cytotoxicity in HCT-15 cells, which are resistant to ginseng. The product, but not white ginseng, exhibited apoptotic effects via the Fas ligand and caspase 8/9. This study demonstrates for the first time that the B. bassiana-fermented metabolites have potent apoptotic activity in colon cancer cells, linking to a therapeutic use. Copyright © 2015 John Wiley & Sons, Ltd.

XVII International Botanical Congress. 100 years after the II IBC in Vienna 1905. Abstracts

International Nuclear Information System (INIS)

Popp, M.; Hesse, M.; Stuessy, T.; Greimler, J.; Bohar-Nodenkampf, H.

2005-01-01

Full text: The program of XVII IBC 2005 includes all aspects of basic and applied botanical research. Progress in the different sub-disciplines is revealed through plenary talks, general lectures, symposia, and poster sessions. This conference emphasizes the newest developments in the botanical sciences worldwide. (botek)

Grupos de poder, familia e Iglesia en Gran Canaria en el Siglo XVII: el clero femenino

OpenAIRE

Alemán Ruiz, Esteban

1996-01-01

[ES] Estudio del clero regular femenino en la isla de Gran Canaria en el siglo XVII, desde la perspectiva de las estrategias familiares y de los grupos de poder de la sociedad isleña en aquella centuria.

Simultaneous quantitation of polygalaxanthone III and four ginsenosides by ultra-fast liquid chromatography with tandem mass spectrometry in rat and beagle dog plasma after oral administration of Kai-Xin-San: application to a comparative pharmacokinetic study.

Science.gov (United States)

Lv, Chunxiao; Li, Qing; Zhang, Xiaowen; He, Bosai; Xu, Huarong; Yin, Yidi; Liu, Ran; Liu, Jingjing; Chen, Xiaohui; Bi, Kaishun

2014-05-01

A fast, selective, and quantitative ultra-fast liquid chromatography with tandem mass spectrometry method has been developed and validated for the simultaneous quantitation of polygalaxanthone III, ginsenoside Rb1, ginsenoside Rd, ginsenoside Re, and ginsenoside Rg1 in the plasma of rat and beagle dog after oral administration of Kai-Xin-San. After addition of the internal standard, salidroside, the plasma samples were extracted by liquid-liquid extraction and separated on a Venusil MP C18 column with methanol/0.01% acetic acid water as mobile phase. The tandem mass spectrometric detection was performed in the multiple reaction monitoring with turbo ion spray source in a switching ionization mode. The method was examined, and found to be precise and accurate with the linearity range of the compounds. The intra- and interday precision and accuracy of the analytes were well within acceptance criteria (±15%). The mean extraction recoveries of analytes and internal standard were all >75.0%. The validated method has been successfully applied to comparing pharmacokinetic profiles of analytes in rat and beagle dog plasma. The results indicated that no significant differences were observed in pharmacokinetic parameters of ginsenoside Rg1, while the others had significant differences, which may due to the different mechanisms of absorption and metabolism. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Chondroprotective Effects of Ginsenoside Rg1 in  Human Osteoarthritis Chondrocytes and a Rat Model  of Anterior Cruciate Ligament Transection

Directory of Open Access Journals (Sweden)

Wendan Cheng

2017-03-01

Full Text Available This study aimed to assess whether Ginsenoside Rg1 (Rg1 inhibits inflammatory responses in human chondrocytes and reduces articular cartilage damage in a rat model of osteoarthritis (OA. Gene expression and protein levels of type II collagen, aggrecan, matrix metalloproteinase (MMP‐13 and cyclooxygenase‐2 (COX‐2 were determined in vitro by quantitative real‐time‐polymerase chain reaction and Western blotting. Prostaglandin E2 (PGE2 amounts in the culture medium were determined by enzyme‐linked immunosorbent assay (ELISA. For in vivo assessment, a rat model of OA was generated by anterior cruciate ligament transection (ACLT. Four weeks after ACLT, Rg1 (30 or 60 mg/kg or saline was administered by gavage once a day for eight consecutive weeks. Joint damage was analyzed by histology and immunohistochemistry. Ginsenoside Rg1 inhibited Interleukin (IL‐1β‐induced chondrocyte gene and protein expressions of MMP‐13, COX‐2 and PGE2, and prevented type II collagen and aggrecan degradation, in a dose‐dependent manner. Administration of Ginsenoside Rg1 to OA rats attenuated cartilage degeneration, and reduced type II collagen loss and MMP‐13 levels. These findings demonstrated that Ginsenoside Rg1 can inhibit inflammatory responses in human chondrocytes in vitro and reduce articular cartilage damage in vivo, confirming the potential therapeutic value of Ginsenoside Rg1 in OA.

Pious works as a Path to Salvation: the Bishopric of Albarracín (XVII century

Directory of Open Access Journals (Sweden)

José Manuel LATORRE CIRIA

2015-12-01

Full Text Available  This article intends to show the role that various pious works play as instruments of salvation and as an expression of certain forms of religiousness that had deep social repercussions. We highlight the case of the bishopric of Albarracín during the XVII century. The study is mainly concerned with the information furnished by pastoral visits, the book of chaplaincy institutions and two reports on the bishopric written toward the start and the end of the XVII century respectively. The founding of chaplaincies and benefices was effected as an answer to the search for spiritual graces; however these institutions which were offered to the faithful by the Church as paths to salvation provided clear social advantages. Through these institutions the future of a family member could be secured. The memory and name of the founder perpetuated and the vanity of the linages was satisfied. Pious works were instruments of salvation, but also of solidarity, and family support.

Optimization of lipase-catalyzed synthesis of ginsenoside Rb1 esters using response surface methodology.

Science.gov (United States)

Hu, Jiang-Ning; Lee, Jeung-Hee; Zhu, Xue-Mei; Shin, Jung-Ah; Adhikari, Prakash; Kim, Jae-Kyung; Lee, Ki-Teak

2008-11-26

In the lipase (Novozyme 435)-catalyzed synthesis of ginsenoside Rb1 esters, different acyl donors were found to affect not only the degree of conversion but also the regioselectivity. The reaction of acyl donors with short carbon chain was more effective, showing higher conversion than those with long carbon chain. Among the three solvent systems, the reaction in tert-amyl alcohol showed the highest conversion rate, while the reaction in the mixed solvent of t-BuOH and pyridine (1:1) had the lowest conversion rate. To allow the increase of GRb1 lipophilicity, we decided to further study the optimal condition of synthesis of GRb1 with vinyl decanoate with 10 carbon chain fatty acids in tert-amyl alcohol. Response surface methodology (RSM) was employed to optimize the synthesis condition. From the ridge analysis with maximum responses, the maximum GRb1 conversion was predicted to be 61.51% in a combination of factors (40.2 h, 52.95 degrees C, substrate mole ratio 275.57, and enzyme amount 39.81 mg/mL). Further, the adequacy of the predicted model was examined by additional independent experiments at the predicted maximum synthesis conditions. Results showed that the RSM was effective to optimize a combination of factors for lipase-catalyzed synthesis of ginsenoside Rb1 with vinyl decanoate.

Rare ginsenoside Ia synthesized from F1 by cloning and overexpression of the UDP-glycosyltransferase gene from Bacillus subtilis: synthesis, characterization, and in vitro melanogenesis inhibition activity in BL6B16 cells.

Science.gov (United States)

Wang, Dan-Dan; Jin, Yan; Wang, Chao; Kim, Yeon-Ju; Perez, Zuly Elizabeth Jimenez; Baek, Nam In; Mathiyalagan, Ramya; Markus, Josua; Yang, Deok-Chun

2018-01-01

Ginsenoside F1 has been described to possess skin-whitening effects on humans. We aimed to synthesize a new ginsenoside derivative from F1 and investigate its cytotoxicity and melanogenesis inhibitory activity in B16BL6 cells using recombinant glycosyltransferase enzyme. Glycosylation has the advantage of synthesizing rare chemical compounds from common compounds with great ease. UDP-glycosyltransferase (BSGT1) gene from Bacillus subtilis was selected for cloning. The recombinant glycosyltransferase enzyme was purified, characterized, and utilized to enzymatically transform F1 into its derivative. The new product was characterized by NMR techniques and evaluated by MTT, melanin count, and tyrosinase inhibition assay. The new derivative was identified as (20 S )-3 β ,6 α ,12 β ,20-tetrahydroxydammar-24-ene-20- O - β -D-glucopyranosyl-3- O - β -D-glucopyranoside (ginsenoside Ia), which possesses an additional glucose linked into the C-3 position of substrate F1. Ia had been previously reported; however, no in vitro biological activity was further examined. This study focused on the mass production of arduous ginsenoside Ia from accessible F1 and its inhibitory effect of melanogenesis in B16BL6 cells. Ia showed greater inhibition of melanin and tyrosinase at 100 μmol/L than F1 and arbutin. These results suggested that Ia decreased cellular melanin synthesis in B16BL6 cells through downregulation of tyrosinase activity. To our knowledge, this is the first study to report on the mass production of rare ginsenoside Ia from F1 using recombinant UDP-glycosyltransferase isolated from B. subtillis and its superior melanogenesis inhibitory activity in B16BL6 cells as compared to its precursor. In brief, ginsenoside Ia can be applied for further study in cosmetics.

PRODUCEREA ŞI COMERCIALIZAREA BĂUTURILOR ALCOOLICE ÎN ORAŞELE DIN RZECZPOSPOLITA ŞI ŢARA MOLDOVEI (SEC.XVI-XVII

Directory of Open Access Journals (Sweden)

Nicolae DUDNICENCO

2016-12-01

Full Text Available Articolul vizează producerea, comercializarea şi consumul băuturilor alcoolice în oraşele din Rzeczpospolita (a berii, a votcii, a miedului şi din Ţara Moldovei (a vinului, a rachiului, a berii, a brăgii în sec. XVI-XVII. Se investighează mo­dul de producere, comercializare, precum şi taxele care se percepeau pentru băuturile alcoolice în oraşele din teri­toriul dat. Producerea băuturilor alcoolice aducea venituri mari economiei oraşelor din spaţiul indicat supra.PRODUCTION AND COMMERCIALISATION OF ALCOHOLIC DRINKS IN RZECZPOSPOLITA AND MOLDOVA PRINCIPALITY CITIES (XVI-XVII C.The article targeting the production, marketing and consumption of alcoholic drinks in the cities from Rzeczpospolita (beer, vodka, mead and from Moldova (wine, spirits, beer, braga in the XVI-XVII c. It have been investigated the mode of production, sell and taxes at which were subjected the alcoholic drinks in the cities on that territory. Production of alcoholic drinks brought substantial revenues to the economy of the cities from the indicated area.

Total ginsenosides synergize with ulinastatin against septic acute lung injury and acute respir atory distress syndrome

Science.gov (United States)

Sun, Rongju; Li, Yana; Chen, Wei; Zhang, Fei; Li, Tanshi

2015-01-01

Total ginsenosides synergize with ulinastatin (UTI) against septic acute lung injury (ALI) and acute respiratory distress syndrome (ARDS). We randomly divided 80 cases of severe sepsis-induced ALI and ARDS into a UTI group and a ginsenosides (GS)+UTI group. Continuous electrocardiac monitoring of pulse, respiratory rate, blood pressure, and heart rate; invasive hemodynamic monitoring; ventilator-assisted breathing and circulation support; and anti-infection as well as UTI treatment were given in the UTI group with GS treatment added for 7 consecutive days in the GS+UTI group. The indicators of pulmonary vascular permeability, pulmonary circulation, blood gases, and hemodynamics as well as APACHE II and ALI scores were detected on days 1, 3, and 7. The ALI score in the GS+UTI group was significantly decreased (P UTI group, and the indicators of pulmonary capillary permeability such as pulmonary vascular permeability index, extravascular lung water index, and oxygenation index, in the GS+UTI group improved significantly more than that of the UTI group. The indicators of hemodynamics and pulmonary circulation such as cardiac index, intrathoracic blood volume index, and central venous pressure improved significantly (P UTI group was lower than that of the UTI group. GS can effectively collaborate with UTI against ALI and/or ARDS. PMID:26261640

La literatura espiritual en la España del siglo XVII

OpenAIRE

Suboh Jarabo, Yasmina

2015-01-01

Artículo basado en la investigación de mi tesis doctoral, Inquisición, censura y literatura espiritual en la España Moderna, en el que demuestro que la literatura espiritual en el siglo XVII no se encontraba en decadencia, debido a las medidas impuestas por la Inquisición y la Contrarreforma, como muchos investigadores han señalado, sino que perduró sin perder importancia y seguidores durante este siglo, continuando la labor de los autores espirituales del siglo XVI, defendiendo una espiritua...

The Octyl Ester of Ginsenoside Rh2 Induces Lysosomal Membrane Permeabilization via Bax Translocation

Directory of Open Access Journals (Sweden)

Fang Chen

2016-04-01

Full Text Available Ginsenoside Rh2 is a potential pharmacologically active metabolite of ginseng. Previously, we have reported that an octyl ester derivative of ginsenoside Rh2 (Rh2-O, has been confirmed to possess higher bioavailability and anticancer effect than Rh2 in vitro. In order to better assess the possibility that Rh2-O could be used as an anticancer compound, the underlying mechanism was investigated in this study. The present results revealed that lysosomal destabilization was involved in the early stage of cell apoptosis in HepG2 cells induced by Rh2-O. Rh2-O could induce an early lysosomal membrane permeabilization with the release of lysosomal protease cathepsins to the cytosol in HepG2 cells. The Cat B inhibitor (leu and Cat D inhibitor (pepA inhibited Rh2-O-induced HepG2 apoptosis as well as tBid production and Δφm depolarization, indicating that lysosomal permeabilization occurred upstream of mitochondrial dysfunction. In addition, Rh2-O induced a significant increase in the protein levels of DRAM1 and Bax (p < 0.05 in lysosomes of HepG2 cells. Knockdown of Bax partially inhibited Rh2-O-induced Cat D release from lysosomes. Thus it was concluded that Rh2-O induced apoptosis of HepG2 cells through activation of the lysosomal-mitochondrial apoptotic pathway involving the translocation of Bax to the lysosome.

Cloning and characterization of three squalene epoxidase genes in panax vietnamensis var. fuscidicus, a rare medical plant with high content of ocotillot-type ginsenosides

International Nuclear Information System (INIS)

Ma, C.H.; Jiang, N.H.; Chen, J.W.; Zhang, G.H.

2016-01-01

Panax vietnamensis var. fuscidiscus, is a new variety of Panax. vietnamensis, which was first found in Jinping County, the southern part of Yunnan Province, China. It is also one of the most prized medicinal plants used in traditional ethnic minority medicine systems. This species contains higher content of ocotillol-type saponin, especially majonoside R2, which make this plant particularly suitable for identification of the SE genes responsible for the biosynthesis of ginsenosides. Three cDNAs encoding SE were cloned from P. vietnamensis var. fuscidiscus, and their molecular characterizations were investigated. The tissue-specific expression patterns of the three SE genes were analyzed by RT-qPCR. The transcription levels of these genes in Methyl jasmonate (MeJA)-treated leaves of P. vietnamensis var. fuscidiscus were also estimated by RT-qPCR. PvfSE, PvfSE2 and PvfSE3 differed in predicted membrane-spanning helices. Phylogenetic analysis grouped these SE into three different clades. The three PvfSE isoforms were all most highly expressed in leaves. Moreover, they exhibited different response patterns under MeJA induction. The three PvfSE isoforms may play different roles in sterol or ginsenoside biosynthesis in this herb This report is the first attempt to clone and expression analysis of SE from P. vietnamensis var. fuscidiscus and provides a new foundation for further understanding the role of SE in the biosynthesis of ginsenosides. (author)

Production of Ginsenoside F2 by Using Lactococcus lactis with Enhanced Expression of β-Glucosidase Gene from Paenibacillus mucilaginosus.

Science.gov (United States)

Li, Ling; Shin, So-Yeon; Lee, Soo Jin; Moon, Jin Seok; Im, Wan Taek; Han, Nam Soo

2016-03-30

This study aimed to produce a pharmacologically active minor ginsenoside F2 from the major ginsenosides Rb1 and Rd by using a recombinant Lactococcus lactis strain expressing a heterologous β-glucosidase gene. The nucleotide sequence of the gene (BglPm) was derived from Paenibacillus mucilaginosus and synthesized after codon optimization, and the two genes (unoptimized and optimized) were expressed in L. lactis NZ9000. Codon optimization resulted in reduction of unfavorable codons by 50% and a considerable increase in the expression levels (total activities) of β-glucosidases (0.002 unit/mL, unoptimized; 0.022 unit/mL, optimized). The molecular weight of the enzyme was 52 kDa, and the purified forms of the enzymes could successfully convert Rb1 and Rd into F2. The permeabilized L. lactis expressing BglPm resulted in a high conversion yield (74%) of F2 from the ginseng extract. Utilization of this microbial cell to produce F2 may provide an alternative method to increase the health benefits of Panax ginseng.

XVII 'Jacques-Louis Lions' Spanish-French School

CERN Document Server

Alonso, Pedro

2017-01-01

The first part of this volume gathers the lecture notes of the courses of the “XVII Escuela Hispano-Francesa”, held in Gijón, Spain, in June 2016. Each chapter is devoted to an advanced topic and presents state-of-the-art research in a didactic and self-contained way. Young researchers will find a complete guide to beginning advanced work in fields such as High Performance Computing, Numerical Linear Algebra, Optimal Control of Partial Differential Equations and Quantum Mechanics Simulation, while experts in these areas will find a comprehensive reference guide, including some previously unpublished results, and teachers may find these chapters useful as textbooks in graduate courses. The second part features the extended abstracts of selected research work presented by the students during the School. It highlights new results and applications in Computational Algebra, Fluid Mechanics, Chemical Kinetics and Biomedicine, among others, offering interested researchers a convenient reference guide to these l...

La diffusione delle opere antilatine di Nilo Cabasilas in manoscritti russi nel XVII secolo

Directory of Open Access Journals (Sweden)

Marco Scarpa

2017-10-01

Full Text Available The Spread of Neilos Kabasilas’s Anti-Latin Treaties in Russian Manuscripts in the 17th Century  In the 17th century, Neilos Kabasilas’s anti-Latin works, along with Gregory Palamas’s Contro Becco, were considerably widespread in Russia. The first copy was made for Arseniĭ Sukhanov in the 1630s, another copy – supplemented with several polemical texts – was then prepared for the Patriarchal Library. Four manuscripts are associated with the activity of the monks Simon Azar’in, Efrem Kvašnin and Sergij Šelonin, who were in Moscow in the 1640s, and are perhaps related to the question of the religious confession of Prince Valdemar, who was designated to marry the Tsar’s daughter. In mid-seventeenth century another manuscript appeared in Ukraine, marked at that time by the controversies which followed the Union of Brest. In the 1660s, two copies were made in the Solovetskiĭ Monastery. At the end of the century, Archbishop Atanasiĭ Kholmogorskij, involved in the controversy over Christ’s presence in the Eucharist, made further three copies of these works. Four manuscripts from the first half of the eighteenth century testify in their turn to the interest of particular individuals in this collection of texts on the Procession of the Holy Spirit.   Rozpowszechnienie antyłacińskich traktatów Nila Kabazylasa w rękopisach ruskich w XVII wieku  W XVII wieku antyłacińskie traktaty Nila Kabazylasa, obok Contro Becco Grzegorza Palamasa, były dość dobrze rozpowszechnione na Rusi. Pierwszy odpis został przygotowany przez Arsenija Suchanowa w latach trzydziestych XVII wieku. Drugi wzbogacony o kilka tekstów polemicznych powstał dla biblioteki patriarchalnej. Cztery kolejne rękopisy wiążą się z działalnością przebywających w latach czterdziestych w Moskwie mnichów Simona Azarina, Efrema Kwasznina i Sergija Szelonina i odsyłają prawdopodobnie do sprawy wyznania księcia Waldemara, kandydata na męża dla carskiej c

Effects of Ginsenoside Rb1 on Skin Changes

Directory of Open Access Journals (Sweden)

Yoshiyuki Kimura

2012-01-01

Full Text Available Ginseng roots (Panax ginseng CA Meyer have been used traditionally for the treatment, especially prevention, of various diseases in China, Korea, and Japan. Both experimental and clinical studies suggest ginseng roots to have pharmacological effects in patients with life-style-related diseases such as non-insulin-dependent diabetic mellitus, atherosclerosis, hyperlipidemia, and hypertension. The topical use of ginseng roots to treat skin complaints including atopic suppurative dermatitis, wounds, and inflammation is also described in ancient Chinese texts; however, there have been relatively few studies in this area. In the present paper, we describe introduce the biological and pharmacological effects of ginsenoside Rb1 isolated from Red ginseng roots on skin damage caused by burn-wounds using male Balb/c mice (in vivo and by ultraviolet B irradiation using male C57BL/6J and albino hairless (HR-1 mice (in vivo. Furthermore, to clarify the mechanisms behind these pharmacological actions, human primary keratinocytes and the human keratinocyte cell line HaCaT were used in experiments in vitro.

El derecho de las pesquerías de guipuzcoanos y vizcaínos en Islandia, Groenlandia y Svalbard en el siglo xvii.

OpenAIRE

Serna Vallejo, Margarita

2014-01-01

La caza de la ballena en el entorno de Islandia y Groenlandia por los navegantes de Guipúzcoa y Vizcaya debió ser fruto del azar con anterioridad al siglo xvii. Pero la situación cambió tras el descubrimiento del archipiélago ártico de Svalbard en 1596 por Barents. En los siglos xvi y xvii, las instituciones de la Provincia de Guipúzcoa, del Señorío de Vizcaya y de la propia Monarquía Hispánica sólo se preocuparon de las pesquerías a partir de los requerimientos que les formularon los partici...

Bioconversion Using Lactic Acid Bacteria: Ginsenosides, GABA, and Phenolic Compounds.

Science.gov (United States)

Lee, Na-Kyoung; Paik, Hyun-Dong

2017-05-28

Lactic acid bacteria (LAB) are used as fermentation starters in vegetable and dairy products and influence the pH and flavors of foods. For many centuries, LAB have been used to manufacture fermented foods; therefore, they are generally regarded as safe. LAB produce various substances, such as lactic acid, β-glucosidase, and β-galactosidase, making them useful as fermentation starters. Existing functional substances have been assessed as fermentation substrates for better component bioavailability or other functions. Representative materials that were bioconverted using LAB have been reported and include minor ginsenosides, γ-aminobutyric acid, equol, aglycones, bioactive isoflavones, genistein, and daidzein, among others. Fermentation mainly involves polyphenol and polysaccharide substrates and is conducted using bacterial strains such as Streptococcus thermophilus, Lactobacillus plantarum, and Bifidobacterium sp. In this review, we summarize recent studies of bioconversion using LAB and discuss future directions for this field.

Heterologous production of a ginsenoside saponin (compound K) and its precursors in transgenic tobacco impairs the vegetative and reproductive growth.

Science.gov (United States)

Gwak, Yu Shin; Han, Jung Yeon; Adhikari, Prakash Babu; Ahn, Chang Ho; Choi, Yong Eui

2017-06-01

Production of compound K (a ginsenoside saponin) and its precursors in transgenic tobacco resulted in stunted growth and seed set failure, which may be caused by strong autotoxicity of heterologously produced phytochemicals against the tobacco itself. Panax ginseng roots contain various saponins (ginsenosides), which are major bioactive compounds. A monoglucosylated saponin, compound K (20-O-(β-D-glucopyranosyl)-20(S)-protopanaxadiol), has high medicinal and cosmetic values but is present in undetectable amounts in naturally grown ginseng roots. The production of compound K (CK) requires complicated deglycosylation of ginsenosides using physicochemical and/or enzymatic degradation. In this work, we report the production of CK in transgenic tobacco by co-overexpressing three genes (PgDDS, CYP716A47 and UGT71A28) isolated from P. ginseng. Introduction and expression of the transgenes in tobacco lines were confirmed by genomic PCR and RT-PCR. All the lines of transgenic tobacco produced CK including its precursors, protopanaxadiol and dammarenediol-II (DD). The concentrations of CK in the leaves ranged from 1.55 to 2.64 µg/g dry weight, depending on the transgenic line. Interestingly, production of CK in tobacco brought stunted plant growth and gave rise to seed set failure. This seed set failure was caused by both long-styled flowers and abnormal pollen development in transgenic tobacco. Both CK and DD treatments highly suppressed in vitro germination and tube growth in wild-type pollens. Based on these results, metabolic engineering for CK production in transgenic tobacco was successfully achieved, but the production of CK and its precursors in tobacco severely affects vegetative and reproductive growth due to the cytotoxicity of phytochemicals that are heterologously produced in transgenic tobacco.

Simultaneous analysis of nucleobases, nucleosides and ginsenosides in ginseng extracts using supercritical fluid chromatography coupled with single quadrupole mass spectrometry.

Science.gov (United States)

Huang, Yang; Zhang, Tingting; Zhao, Yumei; Zhou, Haibo; Tang, Guangyun; Fillet, Marianne; Crommen, Jacques; Jiang, Zhengjin

2017-09-10

Nucleobases, nucleosides and ginsenosides, which have a significant impact on the physiological activity of organisms, are reported to be the active components of ginseng, while they are less present in ginseng extracts. Few analytical methods have been developed so far to simultaneously analyze these three classes of compounds with different polarities present in ginseng extracts. In the present study, a simple and efficient analytical method was successfully developed for the simultaneous separation of 17 nucleobases, nucleosides and ginsenosides in ginseng extracts using supercritical fluid chromatography coupled with single quadrupole mass spectrometry (SFC-MS). The effect of various experimental factors on the separation performance, such as the column type, temperature and backpressure, the type of modifier and additive, and the concentration of make-up solvent were systematically investigated. Under the selected conditions, the developed method was successfully applied to the quality evaluation of 14 batches of ginseng extracts from different origins. The results obtained for the different batches indicate that this method could be employed for the quality assessment of ginseng extracts. Copyright © 2017 Elsevier B.V. All rights reserved.

Laboratory measurements of the x-ray line emission from neon-like Fe XVII

International Nuclear Information System (INIS)

Brown, G V; Beiersdorfer, P; Chen, H; Scofield, J; Boyce, K R; Kelley, R L; Kilbourne, C A; Porter, F S; Gu, M F; Kahn, S M; Szymkowiak, A E

2006-01-01

The authors have conducted a systematic study of the dominant x-ray line emission from Fe XVII. These studies include relative line intensities in the optically thin limit, intensities in the presence of radiation from satellite lines from lower charge states of iron, and the absolute excitation cross sections of some of the strongest lines. These measurements were conducted at the Lawrence Livermore National Laboratory electron beam ion trap facility using crystal spectrometers and a NASA-Goddard Space Flight Center microcalorimeter array

La crisis del siglo XVII. Religión, Reforma y cambio social. [Reseña

OpenAIRE

Lama, E. (Enrique) de la

2010-01-01

Reseña de: Hugh Trevor-Roper, La crisis del siglo XVII. Religión, Reforma y cambio social, primera edición en castellano: Liberty-Fund/Katz, Argentina/España 2009, 488 pp. Traducida por Lilia Mosconi de la obra original de H.R. Trevor-Roper, The crisis of the seventeenth Century. Religion, the Reformation and social change & other essays, London/Melbourne-Toronto 1967, 487 pp.

Ginsenosides Rb1 and Rg1 Stimulate Melanogenesis in Human Epidermal Melanocytes via PKA/CREB/MITF Signaling

Directory of Open Access Journals (Sweden)

Mao Lin

2014-01-01

Full Text Available Reduced or defective melanin skin pigmentation may cause many hypopigmentation disorders and increase the risk of damage to the skin triggered by UV irradiation. Ginsenosides Rb1 and Rg1 have many molecular targets including the cAMP-response element-binding protein (CREB, which is involved in melanogenesis. This study aimed to investigate the effects of ginsenosides Rb1 and Rg1 on melanogenesis in human melanocytes and their related mechanisms. The effects of Rb1 and Rg1 on cell viability, tyrosinase activity, cellular melanin content and protein levels of tyrosinase, microphthalmia-associated transcription factor (MITF, and activation of CREB in melanocytes were assessed. Results showed that Rb1 or Rg1 significantly increased cellular melanin content and tyrosinase activity in a dose-dependent manner. By contrast, the cell viability of melanocytes remained unchanged. After exposure to Rb1 or Rg1, the protein levels of tyrosinase, MITF, and phosphorylated CREB were significantly increased. Furthermore, pretreatment with the selective PKA inhibitor H-89 significantly blocked the Rb1- or Rg1-induced increase of melanin content. These findings indicated that Rb1 and Rg1 increased melanogenesis and tyrosinase activity in human melanocytes, which was associated with activation of PKA/CREB/MITF signaling. The effects and mechanisms of Rb1 or Rg1 on skin pigmentation deserve further study.

Preparation and evaluation of self-microemulsions for improved bioavailability of ginsenoside-Rh1 and Rh2.

Science.gov (United States)

Yang, Feifei; Zhou, Jing; Hu, Xiao; Yu, Stephanie Kyoungchun; Liu, Chunyu; Pan, Ruile; Chang, Qi; Liu, Xinmin; Liao, Yonghong

2017-10-01

Due to intestinal cytochrome P450 (CYP450)-mediated metabolism and P-glycoprotein (P-gp) efflux, poor oral bioavailability hinders ginsenoside-Rh1 (Rh1) and ginsenoside-Rh2 (Rh2) from clinical application. In this study, Rh1 and Rh2 were incorporated into two self-microemulsions (SME-1 and SME-2) to improve oral bioavailability. SME-1 contained both CYP450 and P-gp inhibitory excipients while SME-2 only consisted of P-gp inhibitory excipients. Results for release, cellular uptake, transport, and lymph node distribution demonstrated no significant difference between either self-microemulsions in vivo, but were elevated significantly in comparison to the free drug. The pharmaceutical profiles in vivo showed that the bioavailability of Rh1 in SME-1 (33.25%) was significantly higher than that in either SME-2 (21.28%) or free drug (12.92%). There was no significant difference in bioavailability for Rh2 between SME-1 (48.69%) or SME-2 (41.73%), although they both had remarkable increase in comparison to free drug (15.02%). We confirmed that SME containing CYP450 and P-gp inhibitory excipient could distinctively improve the oral availabilities of Rh1 compared to free drug or SME containing P-gp inhibitory excipient. No notable increase was observed between either SME for Rh2, suggesting that Rh2 undergoes P-gp-mediated efflux, but may not undergo distinct CYP450-mediated metabolism.

Roles of survival and dispersal in reintroduction success of Griffon vulture (Gyps fulvus).

Science.gov (United States)

Le Gouar, Pascaline; Robert, Alexandre; Choisy, Jean-Pierre; Henriquet, Sylvain; Lecuyer, Philippe; Tessier, Christian; Sarrazin, François

2008-06-01

The success of reintroduction programs greatly depends on the amount of mortality and dispersal of the released individuals. Although local environmental pressures are likely to play an important role in these processes, they have rarely been investigated because of the lack of spatial replicates of reintroduction. In the present study, we analyzed a 25-year data set encompassing 272 individuals released in five reintroduction programs of Griffon Vultures (Gyps fulvus) in France to examine the respective roles of survival and dispersal in program successes and failures. We use recent developments in multi-strata capture-recapture models to take into account tag loss in survival estimates and to consider and estimate dispersal among release areas. We also examined the effects of sex, age, time, area, and release status on survival, and we tested whether dispersal patterns among release areas were consistent with habitat selection theories. Results indicated that the survival of released adults was reduced during the first year after release, with no difference between sexes. Taking into account local observations only, we found that early survival rates varied across sites. However when we distinguished dispersal from mortality, early survival rates became equal across release sites. It thus appears that among reintroduction programs difference in failure and success was due to differential dispersal among release sites. We revealed asymmetrical patterns of dispersal due to conspecific attraction: dispersers selected the closest and the largest population. We showed that mortality can be homogeneous from one program to another while, on the contrary, dispersal is highly dependent on the matrix of established populations. Dispersal behavior is thus of major interest for metapopulation restoration and should be taken into account in planning reintroduction designs.

Diclofenac toxicity in Gyps vulture is associated with decreased uric acid excretion and not renal portal vasoconstriction.

Science.gov (United States)

Naidoo, V; Swan, G E

2009-04-01

Diclofenac (DF), a non-steroidal anti-inflammatory drug (NSAID), is largely regarded as one of the most devastating environmental toxicant in recent times, after accidental exposure via their food-chain lead to massive mortalities in three vulture species on the Asian subcontinent. Although the use of diclofenac was recently banned on the Indian subcontinent, following the favourable safety profile of meloxicam, its mechanism of toxicity remains unknown. In an attempt to establish this mechanism, we test three hypotheses using models established from either the domestic chicken (Gallus domesticus) or the African White-backed vulture (Gyps africanus). We demonstrate that both DF and meloxicam are toxic to renal tubular epithelial (RTE) cells following 12 h of exposure, due to an increase in production of reactive oxygen species (ROS), which could be temporarily ameliorated by pre-incubation with uric acid (UA). When cultures were incubated with either drug for only 2 h, meloxicam showed no toxicity in contrast to diclofenac. In both cases no increase in ROS production was evident. In addition, diclofenac decreased the transport of uric acid, by interfering with the p-amino-hippuric acid (PAH) channel. We conclude that vulture susceptibility to diclofenac results from a combination of an increased ROS, interference with UA transport and the duration of exposure.

Espaços livres em praças inglesas do século XVII: o caso de Convent Garden

Directory of Open Access Journals (Sweden)

Maria Fernanda Derntl

2006-12-01

Full Text Available Covent Garden é considerada uma experiência modelar entre as primeiras transformações no espaço urbano ainda de aparência medieval de Londres no século XVII. A partir da iconografia da época e das indicações da bibliografia pertinente, procura-se apresentar uma análise abrangente da configuração formal dessa praça. Destaca-se a existência de diferentes tipos de espaços livres contribuindo para determinar seu desenho: além do espaço central, também fizeram parte da praça o pátio da igreja de St. Paul, a oeste e os jardins da mansão Bedford, ao sul. Conclui-se que o desenho apresentado por Covent Garden não era completamente regular ou simétrico e teria sido bem diferente das squares londrinas dos séculos XVII e XVIII.

Highly Selective Bioconversion of Ginsenoside Rb1 to Compound K by the Mycelium of Cordyceps sinensis under Optimized Conditions

Directory of Open Access Journals (Sweden)

Wei-Nan Wang

2015-10-01

Full Text Available Compound K (CK, a highly active and bioavailable derivative obtained from protopanaxadiol ginsenosides, displays a wide variety of pharmacological properties, especially antitumor activity. However, the inadequacy of natural sources limits its application in the pharmaceutical industry. In this study, we firstly discovered that Cordyceps sinensis was a potent biocatalyst for the biotransformation of ginsenoside Rb1 into CK. After a series of investigations on the biotransformation parameters, an optimal composition of the biotransformation culture was found to be lactose, soybean powder and MgSO4 without controlling the pH. Also, an optimum temperature of 30 °C for the biotransformation process was suggested in a range of 25 °C–50 °C. Then, a biotransformation pathway of Rb1 → Rd → F2 → CK was established using high performance liquid chromatography/quadrupole time-of-flight mass spectrometry (HPLC-Q-TOF-MS. Our results demonstrated that the molar bioconversion rate of Rb1 to CK was more than 82% and the purity of CK produced by C. sinensis under the optimized conditions was more than 91%. In conclusion, the combination of C. sinensis and the optimized conditions is applicable for the industrial preparation of CK for medicinal purposes.

Ginsenoside Rk1 bioactivity: a systematic review

Directory of Open Access Journals (Sweden)

Abdelrahman Elshafay

2017-11-01

Full Text Available Ginsenoside Rk1 (G-Rk1 is a unique component created by processing the ginseng plant (mainly Sung Ginseng (SG at high temperatures. The aim of our study was to systematically review the pharmacological effects of G-Rk1. We utilized and manually searched eight databases to select in vivo and in vitro original studies that provided information about biological, pharmaceutical effects of G-Rk1 and were published up to July 2017 with no restriction on language or study design. Out of the 156 papers identified, we retrieved 28 eligible papers in the first skimming phase of research. Several articles largely described the G-Rk1 anti-cancer activity investigating “cell viability”, “cell proliferation inhibition”, “apoptotic activity”, and “effects of G-Rk1 on G1 phase and autophagy in tumor cells” either alone or in combination with G-Rg5. Others proved that it has antiplatelet aggregation activities, anti-inflammatory effects, anti-insulin resistance, nephroprotective effect, antimicrobial effect, cognitive function enhancement, lipid accumulation reduction and prevents osteoporosis. In conclusion, G-Rk1 has a significant anti-tumor effect on liver cancer, melanoma, lung cancer, cervical cancer, colon cancer, pancreatic cancer, gastric cancer, and breast adenocarcinoma against in vitro cell lines. In vivo experiments are further warranted to confirm these effects.

Municipio y mercado en el Aragón Moderno : el abasto de pescado en Zaragoza (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

2004-01-01

Full Text Available Estudio relativo a la política desarrollada por el Concejo de Zaragoza sobre el comercio de pescado durante los siglos XVI y XVII. La prosperidad económica de la ciudad y del municipio permitieron crear durante el siglo xvi condiciones favorables para asegurar a los habitantes de Zaragoza un suministro suficiente a un precio asequible. Sin embargo, el declive económico y el creciente endeudamiento municipal forzarán durante el siglo xvii a aumentar los impuestos sobre las transacciones y reducir la protección al consumidor.This paper studies municipal politics carried out by the Zaragoza city council concerning the first trade during the sixteenth and seventeenth centuries. Economic prosperity in the city and council allowed to create during the sixteenth century favourable conditions in order to get a sufficient supply and a reasonable price for the population. However, economic decline and raising municipal indebtedness during the seventeenth century led to an increase of market taxation and a reduction of consumers' protection.

Measurement of the Radiative Decay of the Longest-Lived Level in the Fe XVII Spectrum

Science.gov (United States)

Brown, Gregory V.; Beiersdorfer, Peter; Träbert, Elmar

2014-08-01

The Fe XVII emission spectrum comprises several very prominent X-ray lines that play an important role in the study of many astrophysical objects. Among the Fe XVII X-ray lines, those emanating from a 3s level, i.e., lines 3F, 3G, and M2, invariably appear too strong compared to the lines emanating from a 3d level, i.e., lines 3C and 3D, when compared to theory. Two of the four 3s levels are metastable, which means they have a rather long radiative decay time compared to collisional processes. The decay rate of the 2p^53s J=2 level has recently been measured at the Livermore EBIT facility [J. R. Crespo López-Urrutia and P. Beiersdorfer, ApJ 721, 576 (2010)], and the scatter of predictions by a factor of 1.7 has been reduced to a measurement uncertainty of merely a few percent. Even longer-lived is the J=0 level of the same 2p^53s configuration. Theory predicts an exclusive magnetic dipole decay to the lowest J=1 level of the same 2p^53s configuration, i.e. to the upper level of line 3G. There appear to be fewer predictions for this rate than for the rates associated with the other Fe XVII levels. Various calculations yield a decay rate near 16 000 s-1 for this level (or a level lifetime near 63 µs). If this value is correct, electron-impact collisions affect line ratios tied to this level at densities between about 10^10 cm-3 and 10^13 cm-3, that is, exactly at many coronal densities of present interest. We have used the Livermore EBIT facility to measure the M1 decay rate of the 2p^53s J=0 level. We find a value commensurate with the value predicted by the Flexible Atomic Code.Work performed under auspices of U.S. D.o.E. by DE-AC52-07NA27344 and supported by NASA's APRA progam under Interagency Agreement NNG13WF991.

Cultura escrita, oralidade e gênero em conventos portugueses (séculos XVII e XVIII

Directory of Open Access Journals (Sweden)

Lígia Bellini

2010-12-01

Full Text Available O artigo aborda formatos e usos da escrita em mosteiros femininos e masculinos, no Portugal dos séculos XVII e XVIII, buscando explorar significados particulares do domínio de técnicas escriturais. Neste sentido, procura adaptar, à especificidade do contexto analisado, sugestões metodológicas dos estudos sobre as implicações do letramento e seus vínculos com a esfera da oralidade, noutros universos histórico-sociais.

Community Organization of Siberian Coachmen in Late XVI – XVII Centuries

Directory of Open Access Journals (Sweden)

Oleg V. Semenov

2014-06-01

Full Text Available The article, basing on the wide range of archival data, mostly introduced into scientific use for the first time, studies communal (secular and church organization of Siberian coachmen in late XVI – XVII centuries. The paper touches upon the issue, concerning the time of its establishment, thoroughly characterizes the structure, functions and officials. The features of interrelation between coachmen ‘world’ and state and other corporate communities of the region are showed. The conclusion that, despite the dependence on the authorities, the processes of bureaucratization and the growth of the villeinage trends, common for the country, coachmen played significant role in the social life of Siberia is made. They intensively protected their interests and forced the government to consider them.

Eminencias del arte, primor de la arquitectura. Las dedicaciones de los templos catedralicios novohispanos en el siglo XVII

Directory of Open Access Journals (Sweden)

Luis Javier Cuesta Hernández

2012-01-01

Full Text Available Este artículo se dedica a estudiar la imagen literaria de la arquitectura en la Nueva España en el siglo XVII desde una posible extrapolación del tópico ut pictura poesis a la arquitectura. Toma como ejemplos para ello las dedicaciones catedralicias de las catedrales de México y Puebla en esa centuria.

Llamados a servir: los hospitalarios de San Juan de Dios en Zacatecas, México en el siglo XVII

Directory of Open Access Journals (Sweden)

González Fasani, Ana Mónica

2007-12-01

Full Text Available Consolidated the Order of San Juan of God in Spain, their religious soon were required to pass to American lands. With the purpose of lifting hospitals they arrived to beginnings of the XVII century and they were organized in three counties: one that would embrace the viceroyalty of New Spain and of overseas, the other one the viceroyalty of the Peru and a third, the denominated Mainland. To four years of having installed in Mexico, they were requested in the populous and rich mining city call Our Mrs. of the Zacatecas.Consolidada la Orden de San Juan de Dios en España, sus religiosos pronto fueron requeridos para pasar a tierras americanas. Con el fin de levantar hospitales llegaron a inicios del siglo XVII y se organizaron en tres provincias: una que abarcaría el virreinato de Nueva España y de ultramar, la otra el virreinato del Perú y una tercera, la denominada Tierra Firme. A cuatro años de instalados en México, fueron solicitados en la populosa y rica ciudad minera llamada Nuestra Señora de los Zacatecas.

A PRESENÇA INDÍGENA NAS CAPELAS DA CAPITANIA DE SÃO VICENTE (SÉCULO XVII

Directory of Open Access Journals (Sweden)

Glória Kok

2011-10-01

Full Text Available Este artigo tem o objetivo de examinar as múltiplas ações indígenas no âmbito das capelas da Capitania de São Vicente, durante o século XVII. Nesse contexto, as capelas, administradas por ordens religiosas e por particulares, concentraram centenas de índios trazidos do sertão e, não raro, preservaram práticas, saberes, identidades e tradições culturais indígenas.

Neuroprotective effects of ginsenoside Rb1 on high glucose-induced neurotoxicity in primary cultured rat hippocampal neurons.

Science.gov (United States)

Liu, Di; Zhang, Hong; Gu, Wenjuan; Liu, Yuqin; Zhang, Mengren

2013-01-01

Ginsenoside Rb1 is one of the main active principles in traditional herb ginseng and has been reported to have a wide variety of neuroprotective effects. Endoplasmic reticulum (ER) stress has been implicated in neurodegenerative diseases, so the present study aimed to observe the effects of ginsenoside Rb1 on ER stress signaling pathways in high glucose-treated hippocampal neurons. The results from MTT, TUNEL labeling and Annexin V-FITC/PI/Hoechst assays showed that incubating neurons with 50 mM high glucose for 72 h decreased cell viability and increased the number of apoptotic cells whereas treating neurons with 1 μM Rb1 for 72 h protected the neurons against high glucose-induced cell damage. Further molecular mechanism study demonstrated that Rb1 suppressed the activation of ER stress-associated proteins including protein kinase RNA (PKR)-like ER kinase (PERK) and C/EBP homology protein (CHOP) and downregulation of Bcl-2 induced by high glucose. Moreover, Rb1 inhibited both the elevation of intracellular reactive oxygen species (ROS) and the disruption of mitochondrial membrane potential induced by high glucose. In addition, the high glucose-induced cell apoptosis, activation of ER stress, ROS accumulation and mitochondrial dysfunction can also be attenuated by the inhibitor of ER stress 4-phenylbutyric acid (4-PBA) and anti-oxidant N-acetylcysteine(NAC). In conclusion, these results suggest that Rb1 may protect neurons against high glucose-induced cell injury through inhibiting CHOP signaling pathway as well as oxidative stress and mitochondrial dysfunction.

Pathology and proposed pathophysiology of diclofenac poisoning in free-living and experimentally exposed oriental white-backed vultures (Gyps bengalensis)

Science.gov (United States)

Meteyer, C.U.; Rideout, B.A.; Gilbert, M.; Shivaprasad, H.L.; Oaks, J.L.

2005-01-01

Oriental white-backed vultures (Gyps bengalensis; OWBVs) died of renal failure when they ingested diclofenac, a nonsteroidal anti-inflammatory drug (NSAID), in tissues of domestic livestock. Acute necrosis of proximal convoluted tubules in these vultures was severe. Glomeruli, distal convoluted tubules, and collecting tubules were relatively spared in the vultures that had early lesions. In most vultures, however, lesions became extensive with large urate aggregates obscuring renal architecture. Inflammation was minimal. Extensive urate precipitation on the surface and within organ parenchyma (visceral gout) was consistently found in vultures with renal failure. Very little is known about the physiologic effect of NSAIDs in birds. Research in mammals has shown that diclofenac inhibits formation of prostaglandins. We propose that the mechanism by which diclofenac induces renal failure in the OWBV is through the inhibition of the modulating effect of prostaglandin on angiotensin II-mediated adrenergic stimulation. Renal portal valves open in response to adrenergic stimulation, redirecting portal blood to the caudal vena cava and bypassing the kidney. If diclofenac removes a modulating effect of prostaglandins on the renal portal valves, indiscriminant activation of these valves would redirect the primary nutrient blood supply away from the renal cortex. Resulting ischemic necrosis of the cortical proximal convoluted tubules would be consistent with our histologic findings in these OWBVs.

Grammatical norm problem in diachronies (on the material of the manuscript of the XVII century “Jesus Christ passions”

Directory of Open Access Journals (Sweden)

Serebryakova Elina Valerievna

2015-09-01

Full Text Available The article describes the results of the study in terms of the implementation of the grammatical rules of the text of the apocryphal writings of «Jesus Christ Passion», forming the bulk of convolutes of the XVII century, which is stored in the Mordovian regional museum and has not been introduced in the scientific sphere. It is given the definition of the grammatical norm, summarized the point of view of well-known scientists who study the evolution of the norms of book-Slavic language at different stages of its development and in the establishment and description of the main characteristics of the «strict» and reduced norm of the Church Slavonic language. It is use/disuse of a complicated system of past tenses of verbs, the dual number, principles in the use of participle forms, formation of imperative, causal, conditional and temporary relations and other features. An analysis of the graphic-orthographic and grammatical features of the manuscript concluded that the language of the monument is in the center of the Church Slavonic language of the reduced standard of the XVII century with the appearance of dialectal features inherent to the southern Russian dialects.

Una mentalidad demoníaca del siglo XVII.

Directory of Open Access Journals (Sweden)

Mario Elkin Ramírez.

1998-06-01

Full Text Available En el presente artículo el autor hace un ejercicio de reconstrucción histórica de algunos de los elementos que constituyen la mentalidad Europea en el siglo XVI y XVII, en lo que concierne la demonología, la creencia en el padre y las luchas religiosas ; para contextualizar el escrito de Freud sobre “una neurosis demoniaca del siglo XVII”. Muestra que el pintor Haizmann disponía en la utilería de su época, de las concepciones del demonio, de la virgen y de los santos que anudados a su complejo paterno personal, explican su neurosis, pero permiten además la hipótesis de que el resquebrajamiento de la figura del padre, a partir del politeísmo cristiano, y la pérdida de la hegemonía religiosa de la Iglesia católica sobrevenida por la reforma, el creciente escepticismo, -que no del ateísmo- colocan a la época entera en un instante de transición de mentalidad de un mundo cerrado de dioses y demonios a un universo positivo, científico y angustiante, por la muerte del Dios-padre protector.

THE IMPACTS OF THE INTERNATIONAL SPORTS ORGANIZATIONS: A STUDY ON 2013 M ERSIN XVII. MEDITERRANEAN GAMES

Directory of Open Access Journals (Sweden)

Evren GÜÇER

2014-07-01

Full Text Available The main objective of the study is to determine the economic impacts of XVII. Mediterranean Games‟ which hosted in Mersin in 2013. Local residents in Mersin are surveyed to determine the economic impacts of the Games. In the summer of 2013 a total of 32 branches in the Mediterranean Games in Mersin, Mega Event Impact Scale whi ch developed Jie and Yan (2010 is used to collect data. In study, with local residents‟ in Mersin perceptions of economic aspects (Economic Benefits and Economic Costs of XVII. Mediterranean Games between their individual characteristics status of differ ences are studied. Inside the identified universe as the local residents in Mersin selected with the simple random sampling method are surveyed (44,9 % of 203 women (55,1 % and 249 men total of 452 residents. The t test and one - way analysis of variance ( ANOVA is used to determine local residents‟ between individual characteristics with perceptions of mega event impact scale‟s economic benefits and economic costs aspects. According to the analysis results, there are not any statistically significant diffe rences with perceptions of aspects of organizations‟ economic benefits between local residents‟ gender and age status, occupation (F=5.352; p0.05. As a result, officers and students in Mersin think more positive than other professional groups about organization; the people who have between 2001 - 3000 TL income level detects more positive organizations‟ economic benefits aspect than the people who have between 1001 - 2000 TL income level and local residents‟ economic benefits aspect detects more positive when decreases years of accommodation in Mersin.

PREFACE: XVII International Scientific Conference ''RESHETNEV READINGS''

Science.gov (United States)

2015-01-01

The International Scientific Conference ''RESHETNEV READINGS'' is dedicated to the memory of Mikhail Reshetnev, an outstanding scientist, chief-constructor of space-rocket systems and communication satellites. The current volume represents selected proceedings of the main conference materials which were published by XVII International Scientific Conference ''RESHETNEV READINGS'' held on November 12 - 14, 2013. Plenary sessions, round tables and forums will be attended by famous scientists, developers and designers representing the space technology sector, as well as professionals and experts in the IT industry. A number of outstanding academic figures expressed their interest in an event of such a level including Jaures Alferov, Vice-president of the Russian Academy of Sciences (RAS), Academician of RAS, Nobel laureate, Dirk Bochar, General Secretary of the European Federation of National Engineering Associates (FEANI), Prof. Yuri Gulyaev, Academician of RAS, Member of the Presidium of RAS, President of the International Union of Scientific and Engineering Associations, Director of the Institute of Radio Engineering and Electronics of RAS, as well as rectors of the largest universities in Russia, chief executives of well-known research enterprises and representatives of big businesses. We would like to thank our main sponsors such as JSC ''Reshetnev Information Satellite Systems'', JSC ''Krasnoyarsk Engineering Plant'', Central Design Bureau ''Geophysics'', Krasnoyarsk Region Authorities. These enterprises and companies are leading ones in the aerospace branch. It is a great pleasure to cooperate and train specialists for them.

Ginsenoside Rb1 Protects Rat Neural Progenitor Cells against Oxidative Injury

Directory of Open Access Journals (Sweden)

Na Ni

2014-03-01

Full Text Available Ginseng, the root of Panax ginseng C.A. Meyer, has been used as a tonic to enhance bodily functions against various ailments for hundreds of years in Far Eastern countries without apparent adverse effects. Ginsenoside Rb1, one of the most active ingredients of ginseng, has been shown to possess various pharmacological activities. Here we report that Rb1 exhibits potent neuroprotective effects against oxidative injury induced by tert-butylhydroperoxide (t-BHP. Lactate dehydrogenase (LDH assay demonstrated that incubation with 300 µm t-BHP for 2.5 h led to a significant cell loss of cultured rat embryonic cortex-derived neural progenitor cells (NPCs and the cell viability was pronouncedly increased by 24 h pretreatment of 10 µm Rb1. TUNEL staining further confirmed that pretreatment of Rb1 significantly reduced the cell apoptosis in t-BHP-induced oxidative injury. Real time PCR revealed that pretreatment with Rb1 activated Nrf2 pathway in cultured NPCs and led to an elevated expression of HO-1. The results of the present study demonstrate that Rb1 shows a potent anti-oxidative effect on cultured NPCs by activating Nrf2 pathway.

Ginsenoside Rg1 nanoparticle penetrating the blood–brain barrier to improve the cerebral function of diabetic rats complicated with cerebral infarction

Directory of Open Access Journals (Sweden)

Shen J

2017-09-01

Full Text Available Junyi Shen, Zhiming Zhao, Wei Shang, Chunli Liu, Beibei Zhang, Lingjie Zhao, Hui Cai Department of Integrated Traditional and Western Medicine, Jinling Hospital, School of Medicine, Nanjing University, Nanjing, China Abstract: Diabetic cerebral infarction is with poorer prognosis and high rates of mortality. Ginsenoside Rg1 (Rg1 has a wide variety of therapeutic values for central nervous system (CNS diseases for the neuron protective effects. However, the blood–brain barrier (BBB restricts Rg1 in reaching the CNS. In this study, we investigated the therapeutic effects of Rg1 nanoparticle (PHRO, fabricated with γ-PGA, L-PAE (H, Rg1, and OX26 antibody, targeting transferrin receptor, on the diabetes rats complicated with diabetic cerebral infarction in vitro and in vivo. Dynamic light scattering analysis shows the average particle size of PHRO was 79±18 nm and the polydispersity index =0.18. The transmission electron microscope images showed that all NPs were spherical in shape with diameters of 89±23 nm. PHRO released Rg1 with sustained release manner and could promote the migration of cerebrovascular endothelial cells and tube formation and even penetrated the BBB in vitro. PHRO could penetrate the BBB with high concentration in brain tissue to reduce the cerebral infarction volume and promote neuronal recovery in vivo. PHRO was promising to be a clinical treatment of diabetes mellitus with cerebral infarction. Keywords: poly-γ-glutamic acid, ginsenoside Rg1, OX26, blood–brain barrier

Hibridación, interacción social y adaptación cultural en la Costa de Mosquitos, siglos XVII y XVIII

Directory of Open Access Journals (Sweden)

García, Claudia

2002-12-01

Full Text Available From their emergence as a socially differentiated group at the end of the 17th Century, the Miskitu Indians transformed their culture through processes which were profoundly influenced by their interaction with Others, by their ideas and their customs. And, whilst assimilating into the group individuals of different ethnic origins, they also incorporated material objects which would subsequently become new cultural requirements. The aim of this project is to relate the social behaviour of the Miskitu during the 17th and 18th Centuries to their interest in obtaining non-traditional products.

A partir de su emergencia como grupo socialmente diferenciado a fines del siglo XVII los indios miskitu transformaron su cultura por medio de procesos profundamente influenciados por la interacción con el Otro, por sus ideas y por sus prácticas. Y el grupo, al tiempo que asimilaba a individuos de diferente procedencia étnica, incorporaba objetos materiales que se convirtirían en necesidades culturales nuevas. La intención de este trabajo es relacionar la conducta social de los miskitu durante los siglos XVII y XVIII con su interés por obtener productos no tradicionales.

Las Competencias Legales del Racional en la Organización Administrativa y Contable del Municipio de Valencia (Comienzos del Siglo XVII

Directory of Open Access Journals (Sweden)

Francisco Mayordomo García-Chicote

2005-06-01

Full Text Available La organización administrativa y contable de los mayores municipios españoles, a comienzos del XVII, es un tema que apenas ha sido abordado por los investigadores de la historia de la Contabilidad y del Derecho. En este trabajo se estudian los textos legales (Capitols del Quitament y Ordenanzas de la Taula de Canvis que regulaban aquellas cuestiones en relación con la ciudad de Valencia, y sobre todo se hace un detenido análisis del cargo municipal (el Racional que se responsabilizaba de la contabilidad y el control interno de la Hacienda local. Palabras clave: contabilidad pública, historia de la contabilidad, Valencia, siglo XVII.A serious lack of research con be observed on the administrative and accounting organisation of the main Spanish cities around the beginning of the 17th century. This paper analyses the legal texts (Capitols del Quitament and Ordenanzas de la Taula de Canvis relative to the matter in the city of Valencia. Furthermore, this study is aimed to highlight the characteristics of the Racional who was responsible for the accounting, and internal control of the local finance.

Ginsenoside compound K promotes β-amyloid peptide clearance in primary astrocytes via autophagy enhancement.

Science.gov (United States)

Guo, Jinhui; Chang, Li; Zhang, Xin; Pei, Sujuan; Yu, Meishuang; Gao, Jianlian

2014-10-01

The aim of the present study was to investigate the effect of ginsenoside compound K on β-amyloid (Aβ) peptide clearance in primary astrocytes. Aβ degradation in primary astrocytes was determined using an intracellular Aβ clearance assay. Aggregated LC3 in astrocyte cells, which is a marker for the level of autophagy, was detected using laser scanning confocal microscope. The effect of compound K on the mammalian target of rapamycin (mTOR)/autophagy pathway was determined using western blot analysis, and an enzyme-linked immunosorbent assay was used for Aβ detection. The results demonstrated that compound K promoted the clearance of Aβ and enhanced autophagy in primary astrocytes. In addition, it was found that phosphorylation of mTOR was inhibited by compound K, which may have contributed to the enhanced autophagy. In conclusion, compound K promotes Aβ clearance by enhancing autophagy via the mTOR signaling pathway in primary astrocytes.

Militares en el Mundo Urbano Fronterizo Castellano (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

Susana TRUCHUElO GARCÍA

2012-12-01

Full Text Available En este artículo se estudian diversos espacios urbanos fronterizos y costeros que albergaban presidios reales en Castilla en los siglos XVI y XVII. Se valoran las prácticas de gobierno que relacionaron, por una parte, a los vecinos, sujetos a la jurisdicción de los alcaldes y el corregidor, y, por otra, a los soldados, beneficiados por el fuero militar. Muchas de las discordias estuvieron causadas por las competencias de jurisdicción entre los distintos poderes, por el aumento de atribuciones de los militares en los contextos bélicos, por el control ejercido por los militares en las milicias concejiles y por la participación de los soldados en las instituciones de gobierno de la ciudad. Este estudio nos permite comprender el proceso de definición de una identidad particular en las ciudades fronterizas, sustentada en la exclusión de la comunidad de todo elemento que intentara segregarse del marco de acción de las autoridades urbanas y de la jurisdicción ordinaria.

Montes y bosques de Orihuela en los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

José Ojeda Nieto

2007-01-01

Full Text Available Los montes y los bosques de la época Moderna son poco conocidos. Escasean los documentos, y cuando los hay se fijan en las talas y abusos cometidos por los vecinos o en las preocupaciones -normativas concejiles- de buena utilización de la leña y la madera. La Orihuela foral, siglos XVI y XVII, gozaba de una amplia extensión de terrenos comunales donde el pastoreo convivía con el aprovechamiento silvícola. El presente estudio marca los límites del monte, concretamente del arbolado, al tiempo que cuantifica, como propuesta, los distintos espacios que configuraban el paisaje del Bajo Segura: huerta, boalares, redondas y realengo. Normas y leyes que reglamentaban cortes y talas, así como los malos usos del bosque -carboneo e incendios-, son también analizados para entender el proceso de deforestación y su control a lo largo de las citadas centurias.

Polémicas en torno a los catequistas andinos en el virreinato peruano (siglos XVI-XVII)

OpenAIRE

Charles, John

2012-01-01

El presente artículo examina el papel de los catequistas indígenas en la evangelización andina, dándole énfasis a la influencia de las políticas del Tercer Concilio Limense (1582-1583) en favor del quechua y los testimonios de oficiales eclesiásticos sobre el estatus del quechua como lengua de enseñanza doctrinal hacia principios del siglo XVII. El trabajo analiza, además, los problemas que el bilingüismo indígena planteó para el proyecto colonial de unificación cultural y religiosa, así como...

Consideraciones sobre el comercio de libros en Lima a principios del siglo XVII

Directory of Open Access Journals (Sweden)

González Sánchez, Carlos Alberto

1997-12-01

Full Text Available Not available.

El estudio de la circulación libraria en la América colonial continúa siendo un tema poco explotado, contrastando con el auge de las investigaciones sobre bibliotecas particulares o de instituciones de enseñanza. Las razones, muy diversas, vienen determinadas por la escasez de fuentes, entre las que destacan los inventarios de mercaderes libreros, cuya información es indispensable para el conocimiento de las inquietudes lectoras y, en definitiva, de los esquemas mentales de la sociedad de la Edad Moderna. En esta ocasión, dos interesantes inventarios de mercancía libraria, negociada en Lima a principios del siglo XVII, nos ofrecerán algunos indicios de una faceta crucial de la vida humana: libros y lecturas.

Effect of enzyme on extraction of ginsenoside Rb1 and Rg3 from Panax notoginseng roots

Science.gov (United States)

Phuong, Nguyen Tran Xuan; Thy, Lu Thi Mong; Khang, Nguyen Luu Vinh; My, Huynh Thi Kieu; Tam, Nguyen Le Phuong; Hieu, Nguyen Huu

2018-04-01

Panax notoginseng is distributed throughout the north and northwest of Vietnam, especially Ha Giang, Lao Cai, and Cao Bang provinces. The root of this plant contains ginsenosides (Rb1, Rb2, Rd, Rg3), flavonoids, polyacetylene, polysaccharides, amino acids, fatty acids, and peptides. In this study, the ratios of enzyme (Viscozyme, Termamyl, Cellulase), solvent of components, and time extraction were investigated. The results showed that the highest contents of Rb1 and Rg3 were achieved in the sample extracted with the ratio of enzymes V:C:T = 1:0:0, ethanol:water (60:40, v/v) as extracting solvent in 45 minutes. Then, conditions of high performance liquid chromatography with diode array detector method to determine the content of ginsenosides Rb1 and Rg3 in the roots of Panax notoginseng were studied, including wavelength, mobile phase, and flow rate. The separation was subjected on a reversed-phase C18 column using acetonitrile (A) and water (B) as mobile phase. The gradient elution was set as follow: 0-10 min, 15-25% A; 10-20 min, 25-30% A; 20-40 min, 30-60% A; 40-60 min, 60-80% A; and 60-65 min back to 15% A before the next injection, at a flow rate of 0.5 mL/min, and the wavelength was set at 202 nm. The linear range was from 298.59 to 696.72 µg/mL for Rb1 and from 8.19 to 19.10 µg/L for Rg3. The limits of detection for Rb1 and Rg3 obtained were 0.31 µg/mL and 0.33 µg/mL, respectively. The limits of quantification were 0.95 µg/mL and 1.01 µg/mL for Rb1 and Rg3, respectively. Consequently, the high performance liquid chromatography demonstrated the highly sensitive and accurate method for determination of Rb1 and Rg3 in Panax notoginseng.

Anti-inflammatory function of ginsenoside Rg1 on alcoholic hepatitis through glucocorticoid receptor related nuclear factor-kappa B pathway.

Science.gov (United States)

Gao, Yan; Chu, Shifeng; Li, Jingwei; Li, Jianping; Zhang, Zhao; Xia, Congyuan; Heng, Yang; Zhang, Meijin; Hu, Jinfeng; Wei, Guining; Li, Yueting; Chen, Naihong

2015-09-15

Ginseng is the dried root of Panax ginseng C.A. Mayer. Since ancient times, ginseng has been used as one kind of treatment drug or tonic in China and even other eastern countries like Korea and Japan. Pharmacological active chemical ingredients and its extract of ginseng are a mixture of triterpenoid saponins, collectively called ginsenosides. Among them, ginsenoside Rg1 is the most pharmacological active one. Based on prior experimental results and the understanding of alcoholic hepatitis, the major aim of this study is to investigate whether Rg1 is beneficial in a rodent model mimic alcoholic hepatic injury associated with binge drinking and explore the underlying possible mechanisms. C57BL/6 mice were given oral consumption of 6g/kg alcohol 1h after treated with Rg1 (10, 20 and 40mg/kg) or dexamethasone (1mg/kg) for 9 consecutive days. Biochemical analyses were performed and liver fragments were processed for microscopy, immunohistochemistry and western blot analysis. According to our data, Rg1 treatment significantly reversed the high mortality rate induced by alcohol consumption and also alleviated liver impairment as evidenced by the decrease of serum parameters. Meanwhile, histological and ultrastructural analysis of alcoholic groups showed hepatocellular impairment but restored in Rg1-treated groups. Overproductive inflammatory cytokines were also suppressed by Rg1 in alcohol-intoxicated mouse livers. In addition, changes of GR related NF-κB pathway, including phospho-IκB-α, were also modulated to normal levels. This study demonstrates that Rg1 might promote GR mediating the repression of NF-κB and inhibit the inflammatory reactions in alcoholic hepatitis. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Do power lines and protected areas present a catch-22 situation for Cape vultures (Gyps coprotheres)?

Science.gov (United States)

Phipps, W Louis; Wolter, Kerri; Michael, Michael D; MacTavish, Lynne M; Yarnell, Richard W

2013-01-01

Cape vulture Gyps coprotheres populations have declined across their range due to multiple anthropogenic threats. Their susceptibility to fatal collisions with the expanding power line network and the prevalence of carcasses contaminated with illegal poisons and other threats outside protected areas are thought to be the primary drivers of declines in southern Africa. We used GPS-GSM units to track the movements and delineate the home ranges of five adult (mean ±SD minimum convex polygon area = 121,655±90,845 km(2)) and four immature (mean ±SD minimum convex polygon area = 492,300±259,427 km(2)) Cape vultures to investigate the influence of power lines and their use of protected areas. The vultures travelled more than 1,000 km from the capture site and collectively entered five different countries in southern Africa. Their movement patterns and core foraging ranges were closely associated with the spatial distribution of transmission power lines and we present evidence that the construction of power lines has allowed the species to extend its range to areas previously devoid of suitable perches. The distribution of locations of known Cape vulture mortalities caused by interactions with power lines corresponded to the core ranges of the tracked vultures. Although some of the vultures regularly roosted at breeding colonies located inside protected areas the majority of foraging activity took place on unprotected farmland. Their ability to travel vast distances very quickly and the high proportion of time they spend in the vicinity of power lines and outside protected areas make Cape vultures especially vulnerable to negative interactions with the expanding power line network and the full range of threats across the region. Co-ordinated cross-border conservation strategies beyond the protected area network will therefore be necessary to ensure the future survival of threatened vultures in Africa.

Antonio Roalas. Un pintor del primer tercio del siglo XVII en Madrid

Directory of Open Access Journals (Sweden)

Rodríguez Rebollo, Ángel

2004-03-01

Full Text Available El conocimiento que actualmente se tiene sobre los pintores del barroco madrileño ha avanzado mucho desde que Ángulo y Pérez Sánchez publicaran los dos volúmenes dedicados al primer y segundo tercio del siglo XVII. Posteriormente han ido viendo la luz estudios más pormenorizados, a veces en forma de exposiciones, que han clarificado aún más la importancia de los artistas que trabajaron en torno a la Corte de los llamados «los Austrias menores»; sin embargo, existen aún hoy un buen número de pintores sólo conocidos a través de contratos o inventarios de la época. La absoluta desinformación que tenemos de ellos, acrecentada por la inexistencia de obras firmadas, no permite a los historiadores dedicarles al menos un estudio parcial de su arte…

El funcionamiento del tributo en Nueva Granada a finales del siglo XVII: Guatavita en 1690

Directory of Open Access Journals (Sweden)

Heraclio Bonilla

2007-11-01

Full Text Available Este ensayo examina los mecanismos de articulación política que se crearon entre el corregidor y los pueblos de indios que integraron el partido de Guatavita. Analiza la naturaleza y el monto del tributo que pagaron los indios y el manejo que el corregidor hizo de estos recursos. Estudia las cargas fiscales que se impusieron sobre la encomienda y los vínculos políticos que se desarrollaron entre encomenderos, corregidores y Estado colonial. La evidencia histórica que sirve de sustento a este trabajo proviene de la contabilidad que presentó el corregidor de Guatavita ante las autoridades coloniales a finales del siglo XVII.

La cocina de los venenos. Aspectos de la criminalidad en el Nuevo Reino de Granada, siglos XVII-XVIII

OpenAIRE

Ariza Martínez, Juan Sebastián

2013-01-01

Durante los siglos XVII y XVIII se presentaron varias querellas ante el Tribunal de Justicia Criminal del Nuevo Reino de Granada, en las que se denunciaba que había personas que ejercían los oficios médicos sin tener títulos que los acreditaran como facultativos en las artes curativas. Por ese entonces, se creía que quienes utilizaban yerbas y conjuros como métodos terapéuticos, por lo general mujeres, debían ser juzgadas como yerbateras-envenenadoras, porque no pretendían curar sino matar a ...

Religião e política: o pensamento antimaquiavelista espanhol dos séculos XVI E XVII

Directory of Open Access Journals (Sweden)

Jaime Estevão dos Reis

2013-09-01

Full Text Available Este artigo tem como objetivo discutir a relação entre religião e política no pensamento antimaquiavelista espanhol de fins do século XVI e primeira metade do século XVII. Frente à razão de Estado defendida por Nicolau Maquiavel, que qualificam como errônea e falsa, os escritores políticos espanhóis propõem o que chamam de verdadeira razão de Estado, baseada em princípios cristãos.

Maestros, oficiales y aprendices: La incipiente organización artesanal en la Cartago del siglo XVII.

Directory of Open Access Journals (Sweden)

Elizet Payne Iglesias

2000-01-01

preindustriales, y en nuestro caso de las sociedades coloniales. A la llegada de los europeos a las Indias se produjo el trasplante de ciertas instituciones de carácter hispánico. Este nuevo espacio creó las condiciones que le dieron rasgos propios a las sociedades coloniales como fue el caso de las organizaciones gremiales y en su defecto, de las actividades artesanales que manifestaron cierta tradición gremial. En estos términos hemos de analizar aquí la organización artesanal de Cartago en el Siglo XVII, como resultado de su propia especificidad, así como el rumbo de las actividades artesanales.

Development of the nowcasting system for the XVII Asiad at Korea Meteorological Administration

Science.gov (United States)

Park, Kyungjeen; Kim, Juwon; Jang, Taekyu; Hwang, Seung On; Park, Yunho; Kim, Yoonjae; Park, Seonjoo; Joo, Sangwon; Noh, Hae Mi

2014-05-01

The XVII Asiad, known as the 2014 Asian game, is the largest sporting event in Asia. It will be held in Incheon, South Korea from September 19 to October 4, with 437 events in 36 sports. To support this game, Korea Meteorological Administration developed Incheon Data Assimilation and Prediction System (IDAPS) for nowcasting and very short range forecasts. The domain is centered at Incheon city and covers the central region of the Korean peninsula and adjacent seas. It repeats analysis and forecast processes with 1 hour cycling interval. IDAPS has approximately 1 km horizontal resolution with 324 x 360 grids and 70 vertical layers. Three dimensional variational data assimilation is applied to assimilate AWS, windprofiler, buoy, sonde, aircraft, scatwinds, rain rate, and radar products. The details of IDAPS and the experiment results will be given during the conference.

Of decentralization of public power Ukrainian land that belonged to Lithuanian (XIII – the early XVII century

Directory of Open Access Journals (Sweden)

C. V. Manuilova

2016-06-01

Full Text Available A comprehensive crisis in Ukraine and continued military confrontation in the Donbass demonstrated the urgent need to establish effective governance, which would imply decentralization of public power. Note that in implementing the decentralization of power in Ukraine insists the International Monetary Fund; United Nations Development Program; the transfer of authority to the field and decentralization of power in Ukraine is one of the points of the Minsk agreements and obligations of Ukraine to the EU. The article deals with the Ukrainian lands topical issue features the decentralization of public power in the XIII - the beginning of XVII century. The importance of the topic due to the need to study the historical experience of the implementation of decentralization. It was, emphasized that the success of the reforms depends largely because of the historical experience and features of the decentralization of public power in the past. Characterized by the development of local government in the Ukrainian lands was part of the Lithuanian state. The purpose of the article is to clarify the characteristics of decentralization of public authority on Ukrainian lands were part of the Lithuanian state during the XVII century XIII. To address this goal, outline decentralization of public power in the state; analyze, competence of local government in the Ukrainian lands that belonged to the Lith uanian State; determine how close to the power of the people. The level of decentralization of public power in the Grand Duchy of Lithuania in the XIII - the beginning of XVII century was high. It was, found that Lithuania had not established a centralized state. It is, noted that the Board of the nobility limited the princely power. The effect of delegated deputies from different parts of the Lithuanian statehood solutions nobility Council.Clarified the facts that confirm the existence of decentralization of public power in Lithuania: the functioning of local

[Effects of Total Ginsenosides and Volatile Oil of Acorus tatarinowii Co-Administration on Ability of Learning and Memory and Apoptosis in Alzheimer's Disease Mice Model Induced By D-Galactose and Aluminium Chloride].

Science.gov (United States)

Deng, Min-zhen; Huang, Li-ping; Fang, Yong-qi

2015-05-01

To observe the effects of the co-administration of total ginsenosides and volatile oil of Acorus tatarinowii on the ability of learning and memory and apoptosis in Alzheimer's disease (AD) mice model induced by D-galactose and aluminium chloride. 50 Kunming (KM) mice were randomly divided into normal group, model group, Aricept group (1 mg/kg), Ding Zhi Wan group (10 g/kg) and co-administration of total ginsenosides and volatile oil of Acorus tatarinowii group (co-administered group, the doses of volatile oil of Acorus tatarinowii and total ginsenosides were 30 mg/kg and 150 mg/kg, respectively). In addition to normal group, mice in other groups were given D-galactose 150 mg/ (kg x d), ip, and aluminium chloride 5 mg/kg, ig, once daily for 40 days. At the same time, mice in the treated groups were administrated with the corresponding drug from the 20th day after the modeling, once daily for 40 days. Water maze and avoiding darkness experiments were used to test learning and memory abilities; Aβ1-42 and BCL-2 content in cortex and hippocampus were detected by ELISA; the vitalities of acetyl cholinesterase ( AChE) and acetylcholine transferase (ChAT) were detected by ultraviolet spectrophotometry. Superoxide dismutase (SOD) vitalities were detected by a water-soluble tetrazolium salt (WST-1) method; the content of malondialdehyde ( MDA) in cortex and hippocampus were detected by the thiobarbituric acid (TBA) method; senile plaque on Aβ1-42 precipitation were observed by immunohistochemistry; brain tissues were observed by hematoxylin-eosin staining (HE). As compared with model group, in the co-administered group, the time of AD mice swimming, the numbers of blind area and electric shock reduced significantly (P < 0.05), and the latent period was prolonged (P < 0.05); AChE activity and levels of Aβ1-42 and MDA in cortex and hippocampus were decreased significantly (P < 0.05 or P < 0.01); ChAT and SOD activities as well as BCL-2 content were increased significantly

El cultivo del trigo en Nueva Galicia durante el siglo XVII

Directory of Open Access Journals (Sweden)

René de León Meza

2016-01-01

Full Text Available Este artículo estudia los factores que determinaron el desarrollo y consolidación del cultivo del trigo en varias comarcas del reino de Nueva Galicia durante el siglo xvii tomando como referencia la última fundación de Guadalajara. Destaca lo vital que fue para esta industria la mano de obra indígena a través del sistema de repartimiento forzado y la vigencia de este hasta el siglo xviii en contraste con Nueva España donde fue suprimido desde 1633. La hipótesis aquí planteada es que la escasez de trigo y harina que constantemente sufrieron los habitantes de la ciudad de Guadalajara se debió a la confabulación de las autoridades del Cabildo con los comerciantes y productores para acapararlos, esconderlos y luego venderlos a precios elevados. La política que los regidores implementaron de no instalar una alhóndiga que concentrara y regulara la venta de esos productos confirma el anterior aserto.

Non-equilibrium Modeling of the Fe XVII 3C/3D Line Ratio in an Intense X-Ray Free-Electron Laser Excited Plasma

Science.gov (United States)

Loch, S. D.; Ballance, C. P.; Li, Y.; Fogle, M.; Fontes, C. J.

2015-03-01

Recent measurements using an X-ray Free Electron Laser (XFEL) and an Electron Beam Ion Trap at the Linac Coherent Light Source facility highlighted large discrepancies between the observed and theoretical values for the Fe xvii 3C/3D line intensity ratio. This result raised the question of whether the theoretical oscillator strengths may be significantly in error, due to insufficiencies in the atomic structure calculations. We present time-dependent spectral modeling of this experiment and show that non-equilibrium effects can dramatically reduce the predicted 3C/3D line intensity ratio, compared with that obtained by simply taking the ratio of oscillator strengths. Once these non-equilibrium effects are accounted for, the measured line intensity ratio can be used to determine a revised value for the 3C/3D oscillator strength ratio, giving a range from 3.0 to 3.5. We also provide a framework to narrow this range further, if more precise information about the pulse parameters can be determined. We discuss the implications of the new results for the use of Fe xvii spectral features as astrophysical diagnostics and investigate the importance of time-dependent effects in interpreting XFEL-excited plasmas.

Evaluation of a new eastern blotting technique for the analysis of ginsenoside Re in American ginseng berry pulp extracts.

Science.gov (United States)

Morinaga, Osamu; Uto, Takuhiro; Yuan, Chun-Su; Tanaka, Hiroyuki; Shoyama, Yukihiro

2010-06-01

A new eastern blotting technique has been established for ginsenoside Re (G-Re) contained in American ginseng berry pulp extracts. G-Re in American ginseng berry pulp was extracted using 100% methanol, 100% ethanol, 50% aqueous methanol, and 50% aqueous ethanol. The combined crude extracts were applied onto a polyethersulfone membrane and developed using the methanol-water-acetic acid solvent system (45:55:1 v/v). Separated components were immunostained using anti-G-Re monoclonal antibody. G-Re was first specifically detected and then quantitatively analyzed using NIH Imaging software. We also confirmed that the most suitable solvent was 50% aqueous methanol for extracting G-Re from American ginseng berry pulp. (c) 2009 Elsevier B.V. All rights reserved.

Archeographical and historical artifact of the Jesuits of Saint Jan collegium in Jaroslav in the late XVII century in the fonds of the Manuscript Institute of VNLU

Directory of Open Access Journals (Sweden)

Bulatova S.

2014-01-01

Full Text Available The publication treats a manuscript inventory of the late XVII century, unknown for historians, which contains the descriptions of landed estates of the Jesuit collegium of Saint Jan in Jaroslav. The paper covers the archeographical aspect of research of the manuscript artifact of Subcarpathian land, which is currently deposited in the fonds of the Manuscript Institute of V. Vernadsky National Library of Ukraine. The author-originator of the manuscript states explicit historical-archival data on Jesuit and szlachta landed estates in Subcarpathian region in XVI-XVII centuries, in particular the possessions of Jaroslav landed holdings. In the publication we consider the historical information on the original sources of various antiquariums and archives of Rich Pospolyta, primarily the archive of the Jesuit collegium in Jaroslav, which are stated in the manuscript inventory. The archeographical analysis of the manuscript, performed in the article, contributes to the historical reconstruction of the Jesuit collegium of Saint Jan in Jaroslav.

Talis mater, talis filia: las malas madres en los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Amaia Nausia Pimoulier

2013-12-01

Full Text Available Este artículo presenta un tipo de violencia familiar protagonizado por madres e hijas navarras de los siglos XVI y XVII. Las acu-saciones por lenocinio o alcahuetería contra las madres que emplearon a sus propias hijas en sus tratos de mediadoras sirven para ilustrar una forma de violencia que supone, entre otras cosas, una ruptura del amor materno. La preca-ria situación de la madre y las dificultades tras el fallecimiento del esposo —la gran parte de los casos están protagonizados por madres viu-das— fue el contexto general en el que se desarrollaron los malos tratos. La historia de estas mujeres representa un mal ejercicio de la autoridad materna y una forma de violencia hacia las hijas; una violencia no siempre física, pero sí emocional y psicológica.

Observed magnetic dipole transitions in the ground terms of Ti XIV, Ti XV, and Ti XVII

International Nuclear Information System (INIS)

Suckewer, S.; Fonck, R.; Hinnov, E.

1979-09-01

Four observed spectrum lines in titanium-containing tokamak discharges have been identified as follows: TiXIV 2s 2 2p 5 2 P/sub 1/2/ → 2 P/sub 3/2/ at 2115.3 A, TiXV 2s 2 2p 4 3P 1 → 3 P 2 at 2544.8 A, TiXVII 2s 2 2p 2 3 P 2 → 3 P 1 at 3834.4 A and 3 P 1 → 3 P 0 at 3371.5 A. The identifications are based on observed time behavior and correlation with intensities of resonance lines of other titanium ions, and on general agreement with predicted wavelengths and intensities

Teoría de la honestidad un proyecto pedagógico francés. La cultura de la conversación y el jansenismo en la Francia del siglo XVII

Directory of Open Access Journals (Sweden)

Constanza Botero Betancur

2015-08-01

Full Text Available La teoría de la honestidad en la Francia siglo XVII se convirtió en una práctica cultural, donde las mujeres tuvieron el rol principal, en función de la formación de los hombres. Así la cultura de la conversación se conformó como una herramienta mundana de culturización. Sin embargo, al tomar fuerza la doctrina religiosa jansenista entre estas damas, la gracia mundana perdió peso frente a la gracia divina. Honesty theory in France in XVII century became a cultural praxis in which women played the main role in function of men’s education. Conversation culture became a mundane tool of education. However, when the Jansenist religious doctrine became powerful among these ladies, mundane grace lost importance before divine grace.

Interaction of the ginsenosides with κ-casein and their effects on amyloid fibril formation by the protein: Multi-spectroscopic approaches.

Science.gov (United States)

Chen, Fanbo; Wang, Yunhua; Yang, Miao; Yin, Jianyuan; Meng, Qin; Bu, Fengquan; Sun, Dandan; Liu, Jihua

2016-07-01

The interaction of the ginsenosides (GS) including ginsenoside Rg1, Rb1 and Re with κ-casein and the effects of GS inhibiting amyloid fibril formation by κ-casein have been investigated in vitro by fluorescence and ultraviolet spectra. Results showed that Rg1 and Rb1 had dose-dependent inhibitory effects on reduced and carboxymethylated κ-casein (RCMκ-CN) fibril formation, while Re resulted in an increase in the rate of fibril formation. The enhancement in RLS intensity was attributed to the formation of new complex between GS and RCMκ-CN, and the corresponding thermodynamic parameters (ΔH, ΔS and ΔG) were assayed. The steady-state ultraviolet-visible absorption spectra had also been tested to observe if the ground-state complex formed, and it showed the same result as RLS spectra. The binding constants and the number of binding sites between GS and RCMκ-CN at different temperatures had been evaluated from relevant fluorescence data. According to the Förster non-radiation energy transfer theory, the binding distance between RCMκ-CN and GS was calculated. The fluorescence lifetime of RCMκ-CN was longer in the presence of GS than in absence of GS, which was evident that the hydrophobic interaction plays a major role in the binding of GS to RCMκ-CN. From the results of synchronous fluorescence, it could be deduced that the polarity around RCMκ-CN Trp97 residue decreased and the hydrophobicity increased after addition of Rg1 or Rb1. Based on all the above results, it is explained that Rg1 and Rb1 inhibited amyloid fibril formation by κ-casein because the molecular spatial conformation and physical property of κ-casein changed causing by the complex formation between GS and κ-casein. Copyright © 2016 Elsevier B.V. All rights reserved.

Simultaneous determination of 2 aconitum alkaloids and 12 ginsenosides in Shenfu injection by ultraperformance liquid chromatography coupled with a photodiode array detector with few markers to determine multicomponents

Directory of Open Access Journals (Sweden)

Ai-Hua Ge

2015-06-01

Full Text Available A method with few markers to determine multicomponents was established and validated to evaluate the quality of Shenfu injection by ultraperformance liquid chromatography coupled with a photodiode array detector. The separations were performed on an ACQUITY UPLC BEH C18 (2.1 × 50 mm2, 1.7 μm column. Methanol and 0.1% formic acid aqueous solution were used as the mobile phase. The flow rate was 0.3 mL/min. 2 aconitum alkaloids and 12 ginsenosides could be perfectly separated within 15 minutes. Ginsenoside Rg1 and benzoylmesaconine, the easily available active components, were employed as the maker components to calculate the relative correction factors of other components in Shenfu injection, Panax ginseng and Aconitum carmichaeli. The external standard method was also established to validate the feasibility of the method with few markers to determine multicomponents. Parameter p and the principal component analysis method were employed to investigate the disparities among batches for the effective quality control of Shenfu injection. The results demonstrated that the ultraperformance liquid chromatography coupled with a photodiode array detector method with few markers to determine multicomponents could be used as a powerful tool for the quality evaluation of traditional Chinese medicines and their preparations.

El argumento de la notoria desigualdad en la relación de pareja (Lima y Quito, siglos xvii y xviii)

OpenAIRE

Lavallé, Bernard

2015-01-01

Quien haya trabajado sobre los problemas de la familia y las relaciones de pareja durante la época colonial debe haberse topado con la cuestión de la notoria desigualdad. A partir de situaciones de varios tipos encontradas a lo largo de los siglos xvii y xviii en dos centros urbanos del virreinato peruano, esto es Lima y Quito, quisiéramos analizar en qué contextos surgía este problema, qué significado(s) podía tener según se tratara de los afectados, los denunciantes o el entorno social. En ...

Azulejos portugueses dos séculos XVII e XVIII em Pernambuco: patologias e caracterização tecnológica

OpenAIRE

FREITAS, Yuri Menezes

2015-01-01

Em Pernambuco, azulejos portugueses dos séculos XVII e XVIII estão presentes em vinte edificações religiosas. Neste período, em Portugal, houve modificações na organização produtiva dos azulejos, objetivando adaptar-se às demandas de épocas distintas. Esta pesquisa busca compreender se tais modificações promoveram variações na caracterização tecnológica destes azulejos históricos. Foi realizado o levantamento de danos dos azulejos deste período, constatando-se uma baixa qualida...

The Safety and Pharmacokinetics of Carprofen, Flunixin and Phenylbutazone in the Cape Vulture (Gyps coprotheres following Oral Exposure.

Directory of Open Access Journals (Sweden)

Tamsyn Fourie

Full Text Available The following study evaluates the overt toxic potential of carprofen (CRP, flunixin (FXN and phenylbutazone (PBZ in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg, FXN (1 mg/kg,PBZ (1.7 mg/kg or water was evaluated by means of a four-way parallel study (n = 2, as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.

The Safety and Pharmacokinetics of Carprofen, Flunixin and Phenylbutazone in the Cape Vulture (Gyps coprotheres) following Oral Exposure.

Science.gov (United States)

Fourie, Tamsyn; Cromarty, Duncan; Duncan, Neil; Wolter, Kerri; Naidoo, Vinny

2015-01-01

The following study evaluates the overt toxic potential of carprofen (CRP), flunixin (FXN) and phenylbutazone (PBZ) in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres) being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg), FXN (1 mg/kg),PBZ (1.7 mg/kg) or water was evaluated by means of a four-way parallel study (n = 2), as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax) of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax) respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.

Los orígenes y desarrollo de la pesca española en Terranova y Groenlandia (siglos XVI-XVII)

OpenAIRE

Pérez-de-Rubín-y-Feigl, J. (Juan)

2007-01-01

Se describen los altibajos en las pesquerías de Terranova y las incursiones en aguas de Groenlandia-Noruega y Brasil (1625), en un cambiante y conflictivo escenario internacional. La lucha por el dominio del mar llevó a períodos de violentas agresiones en los caladeros del Atlántico Norte, influyendo en el libre acceso de los pescadores españoles durante los siglos XVI y XVII. En las costas españolas, tanto en las de la metrópoli como en las ultramarinas, se sucedieron largos períodos de esca...

Foraging range and habitat use by Cape Vulture Gyps coprotheres from the Msikaba colony, Eastern Cape province, South Africa

Directory of Open Access Journals (Sweden)

Morgan B. Pfeiffer

2015-05-01

Full Text Available Despite the extent of subsistence farmland in Africa, little is known about endangered species that persist within them. The Cape Vulture (Gyps coprotheres is regionally endangered in southern Africa and at least 20% of the population breeds in the subsistence farmland area previously known as the Transkei in the Eastern Cape province of South Africa. To understand their movement ecology, adult Cape Vultures (n = 9 were captured and fitted with global positioning system/global system for mobile transmitters. Minimum convex polygons (MCPs,and 99% and 50% kernel density estimates (KDEs were calculated for the breeding and non breeding seasons of the Cape Vulture. Land use maps were constructed for each 99% KDE and vulture locations were overlaid. During the non-breeding season, ranges were slightly larger(mean [± SE] MCP = 16 887 km2 ± 366 km2 than the breeding season (MCP = 14 707 km2 ± 2155 km2. Breeding and non-breeding season MCPs overlapped by a total of 92%. Kernel density estimates showed seasonal variability. During the breeding season, Cape Vultures used subsistence farmland, natural woodland and protected areas more than expected. In the non-breeding season, vultures used natural woodland and subsistence farmland more than expected, and protected areas less than expected. In both seasons, human-altered landscapes were used less, except for subsistence farmland. Conservation implications: These results highlight the importance of subsistence farm land to the survival of the Cape Vulture. Efforts should be made to minimise potential threats to vultures in the core areas outlined, through outreach programmes and mitigation measures.The conservation buffer of 40 km around Cape Vulture breeding colonies should be increased to 50 km.

Large Enhancement in High-Energy Photoionization of Fe XVII and Missing Continuum Plasma Opacity

Science.gov (United States)

Nahar, Sultana N.; Pradhan, Anil K.

2016-06-01

Aimed at solving the outstanding problem of solar opacity, and radiation transport plasma models in general, we report substantial photoabsorption in the high-energy regime due to atomic core photoexcitations not heretofore considered. In extensive R -matrix calculations of unprecedented complexity for an important iron ion Fe xvii (Fe16 + ), with a wave function expansion of 99 Fe xviii (Fe17 + ) LS core states from n ≤4 complexes (equivalent to 218 fine structure levels), we find (i) up to orders of magnitude enhancement in background photoionization cross sections, in addition to strongly peaked photo-excitation-of-core resonances not considered in current opacity models, and ii) demonstrate convergence with respect to successive core excitations. The resulting increase in the monochromatic continuum, and 35% in the Rosseland mean opacity, are compared with the "higher-than-predicted" iron opacity measured at the Sandia Z -pinch fusion device at solar interior conditions.

Las Competencias Legales del Racional en la Organización Administrativa y Contable del Municipio de Valencia (Comienzos del Siglo XVII)

OpenAIRE

Francisco Mayordomo García-Chicote

2005-01-01

La organización administrativa y contable de los mayores municipios españoles, a comienzos del XVII, es un tema que apenas ha sido abordado por los investigadores de la historia de la Contabilidad y del Derecho. En este trabajo se estudian los textos legales (Capitols del Quitament y Ordenanzas de la Taula de Canvis) que regulaban aquellas cuestiones en relación con la ciudad de Valencia, y sobre todo se hace un detenido análisis del cargo municipal (el Racional) que se responsabilizaba de la...

Municipio y mercado en el Aragón moderno : el abasto de carne en Zaragoza (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

2003-01-01

Full Text Available Estudio relativo a la política desarrollada por el Concejo de Zaragoza sobre el mercado de carne durante los siglos XVI y XVII. La prosperidad económica del reino de Aragón, la ciudad y municipio de Zaragoza durante el siglo XVI permitieron aumentar el control público sobre las transacciones de carne para asegurar a la población un suministro suficiente, así como sustentar la demanda local. Sin embargo, el declive económico del reino de Aragón y el creciente endeudamiento municipal durante el siglo XVII obligaron a reducir la presencia pública en el mercado y la defensa de la demanda local en el mercado de carne. El reajuste de la política municipal promovió la paulatina integración del mercado aragonés, proceso que continuó en el siglo XVIII para afianzarse durante la crisis final del Antiguo Régimen.This paper studies municipal politics carried out by the Zaragoza city council concerning the meat market during the sixteenth and seventeenth centuries. Economic prosperity in the kingdom of Aragón, Zaragoza city and council during the sixteenth century allowed to increase public control of meat transactions in order to supply efficiently the population, as well as to support local demand. However, economic decline of the kingdom and raising municipal indebtedness during the seventeenth century led to reduce public intervention and support of local demand on the meat market. Readjustment of municipal politics gradually promoted the integration of the market in Aragón. This process continued during the eighteenth century and became firmly established during the final crisis of the "Ancien Régime".

Especulaciones lingüísticas sobre el hebreo en la España del siglo XVI y principios del XVII

OpenAIRE

Perea Siller, Francisco Javier

2003-01-01

Las especulaciones en torno a la lengua hebrea durante el siglo XVI y principios del XVII en España arrojan luz sobre algunos temas principales de la reflexión lingüística de la época: el origen del lenguaje y la identidad de la lengua primitiva, el carácter motivado o arbitrario de las lenguas, el parentesco entre las lenguas primitivas y actuales, y el problema de la lengua más antigua de España. Se han tratado estos temas, dividiendo la tesis en dos partes: la primera analiza las discusion...

El estilo "rasgueado" de la guitarra barroca y su influencia en la guitarra flamenca: fuentes escritas y musicales (siglo XVII)

OpenAIRE

Torres Cortés, Norberto

2012-01-01

En trabajos anteriores2 hemos podido ilustrar, utilizando fuentes musicológicas, iconográficas y escritas, cómo ha se ha producido el tránsito de la guitarra popular rasgueada a la guitarra flamenca en España, y particularmente en Andalucía, entre los siglos XVI al XIX. Uno de los periodos más interesantes que nutrirá los futuros toques y bailes flamencos lo tendremos en el siglo XVII y la práctica en toda Europa de la guitarra barroca “rasgueada” o “guitarra española”...

[The constribution of Justyne Siegemundin, the midwife of the Brandenburg court, to the development of the obstetrics at XVII century].

Science.gov (United States)

Kraśnianin, Elzbieta; Semczuk, Andrzej

2006-12-01

From the beginning of the world assisting during childbirth was and is the women's domain. On the evolution this profession composed of many famous midwifes. Into this group unquestionably we can count Justine Siegemundin (1636-1705), midwife-self-taught person. Her activity contributed to rise the obstetrics knowledge in XVII century. Justine Siegemundin, the midwife of the Brandenburg court, published in 1690 a book describing a surgical trick still bears her name today. It is called the "double hold"--"Gedoppelter Handgriff", or "Siegemundin-Handgriff". This book counts as on the most important milestones of obstetrics history.

Ginsenoside Rb1 for Myocardial Ischemia/Reperfusion Injury: Preclinical Evidence and Possible Mechanisms

Directory of Open Access Journals (Sweden)

Qun Zheng

2017-01-01

Full Text Available Ginseng is an important herbal drug that has been used worldwide for many years. Ginsenoside Rb1 (G-Rb1, the major pharmacological extract from ginseng, possesses a variety of biological activities in the cardiovascular systems. Here, we conducted a preclinical systematic review to investigate the efficacy of G-Rb1 for animal models of myocardial ischemia/reperfusion injury and its possible mechanisms. Ten studies involving 211 animals were identified by searching 6 databases from inception to May 2017. The methodological quality was assessed by using the CAMARADES 10-item checklist. All the data were analyzed using RevMan 5.3 software. As a result, the score of study quality ranged from 3 to 7 points. Meta-analyses showed that G-Rb1 can significantly decrease the myocardial infarct size and cardiac enzymes (including lactate dehydrogenase, creatine kinase, and creatine kinase-MB when compared with control group (P<0.01. Significant decrease in cardiac troponin T and improvement in the degree of ST-segment depression were reported in one study (P<0.05. Additionally, the possible mechanisms of G-Rb1 for myocardial infarction are antioxidant, anti-inflammatory, antiapoptosis, promoting angiogenesis and improving the circulation. Thus, G-Rb1 is a potential cardioprotective candidate for further clinical trials of myocardial infarction.

O mundo americano na produção escrita inglesa: séculos XVI, XVII e XVIII

Directory of Open Access Journals (Sweden)

Lílian Martins de Lima

2012-06-01

Full Text Available A apreciação do Novo Mundo por letrados ingleses, irlandeses e escoceses pode ser pontuada a partir da segunda metade do século XVI. A compreensão acerca dessa temática é um dos eixos deste artigo, que pretende avaliar as nuances da produção escrita em língua inglesa entre os séculos XVI, XVII e XVIII, com destaque para a formulação de histórias filosóficas da América. Buscamos, em linhas gerais, avaliar de que forma o cenário americano foi descrito por autores que, em diferentes momentos, se indagaram sobre o lugar da América na historiografia inglesa.

La lucha por el mantenimiento de un huerto de simples en la universidad de Valencia durante el siglo XVII

Directory of Open Access Journals (Sweden)

Felipo, Amparo

2005-12-01

Full Text Available This article deepens on the efforts made during the 17th century by Medicine professors and students, Pharmacist Associations as well as surgeons and magistrates from Valencia directed toward the creation and mantenaince of a garden destinated to the growing of medicinal plants from worldwide.

Este artículo profundiza en los esfuerzos realizados durante el siglo XVII por catedráticos y estudiantes de Medicina, colegios de boticarios y cirujanos y magistrados municipales de Valencia orientados a la creación y mantenimiento de un huerto destinado al cultivo de plantas medicinales procedentes de diferentes partes del mundo.

20(S-ginsenoside Rg3 promotes senescence and apoptosis in gallbladder cancer cells via the p53 pathway

Directory of Open Access Journals (Sweden)

Zhang F

2015-08-01

Full Text Available Fei Zhang,* Maolan Li,* Xiangsong Wu,* Yunping Hu, Yang Cao, Xu’an Wang, Shanshan Xiang, Huaifeng Li, Lin Jiang, Zhujun Tan, Wei Lu, Hao Weng, Yijun Shu, Wei Gong, Xuefeng Wang, Yong Zhang, Weibin Shi, Ping Dong,# Jun Gu,# Yingbin Liu#Department of General Surgery and Laboratory of General Surgery, Xinhua Hospital Affiliated to Shanghai Jiao Tong University, School of Medicine, Institute of Biliary Tract Disease, Shanghai Jiao Tong University School of Medicine, Shanghai, People’s Republic of China *These authors contributed equally to this work #These authors jointly directed this work Abstract: Gallbladder cancer (GBC, the most frequent malignancy of the biliary tract, is associated with high mortality and extremely poor prognosis. 20(S-ginsenoside Rg3 (20(S-Rg3 is a steroidal saponin with high pharmacological activity. However, the anticancer effect of 20(S-Rg3 in human GBC has not yet been determined. In this study, we primarily found that 20(S-Rg3 exposure suppressed the survival of both NOZ and GBC-SD cell lines in a concentration-dependent manner. Moreover, induction of cellular senescence and G0/G1 arrest by 20(S-Rg3 were accompanied by a large accumulation of p53 and p21 as a result of murine double minute 2 (MDM2 inhibition. 20(S-Rg3 also caused a remarkable increase in apoptosis via the activation of the mitochondrial-mediated intrinsic caspase pathway. Furthermore, intraperitoneal injection of 20(S-Rg3 (20 or 40 mg/kg for 3 weeks markedly inhibited the growth of xenografts in nude mice. Our results demonstrated that 20(S-Rg3 potently inhibited growth and survival of GBC cells both in vitro and in vivo. 20(S-Rg3 attenuated GBC growth probably via activation of the p53 pathway, and subsequent induction of cellular senescence and mitochondrial-dependent apoptosis. Therefore, 20(S-Rg3 may be a potential chemotherapeutic agent for GBC therapy.Keywords: gallbladder cancer, 20(S-ginsenoside Rg3, senescence, apoptosis, p53 pathway

HOW LOCALS REGARD SPORT EVENTS IN TERMS OF TOURISM DEVELOPMENT? A RESEARCH ON XVII MEDITERRANEAN GAMES IN MERSIN WITH IN THE FRAME OF ALTRUISTIC SURPLUS PHENOMENON

Directory of Open Access Journals (Sweden)

Ozan GULER

2016-07-01

Full Text Available The aim of this study is to (1 investigate locals’ perceptions of the positive and negative impacts of the XVII Mediterranean Games; (2 identify which perceptions of these impacts would predict locals’ intention to support future sporting events and (3 discussing locals’ support intentions towards future sporting events within the context of altruistic surplus phenomenon. The data was obtained through stratified sampling by gathering one on one questionnaire from 422 participants, which were then analyzed by exploratory factor analysis, confirmatory factor analysis and multiple regression analysis. The results show that while locals mostly benefit from the XVII Mediterranean Games in the areas of “tourism infrastructure development” and ‘image enhancement-consolidation’, they are complaining about uncovered economic expectations. As a result of regression analysis “tourism resource development and urban revitalization” and “image enhancement and consolidation” variables have significantly predicted the locals’ support intentions for the future sporting events. It is understood that the locals’ positive perceptions far outweighed the effects of negative perceptions in terms of intentions to support hosting future sport events. When it comes to local’s positive outlooks, effects of negative perceptions on support intention become insignificant which could be explained by the altruistic surplus phenomenon.

A preliminary assessment of the potential risks from electrical ...

African Journals Online (AJOL)

... Grey-crowned Crane Balearica regulorum, Lesser Flamingo Phoeniconaias minor, White-backed Vulture Gyps africanus, Rüppell's Vulture Gyps rueppellii, Martial Eagle Polemaetus bellicosus, White Stork Ciconia ciconia, Secretarybird Sagittarius serpentarius, and various sit-and-wait raptors. These preliminary findings ...

Diego Velázquez e os retratos de Felipe IV: A pintura Barroca e a idéia de tempo na sociedade espanhola do século XVII

Directory of Open Access Journals (Sweden)

Susana Aparecida da Silva

2012-08-01

Full Text Available Esta pesquisa reflete a respeito da possibilidade de se analisar a idéia de tempo na Espanha Barroca do século XVII através de cinco retratos feitos pelo pintor espanhol Diego Velázquez (1599-1660. Estes retratos são feitos após o período em que o pintor é admitido na corte de Felipe IV da Espanha (1605-1665 como pintor oficial. As fontes visuais selecionadas para esta pesquisa no sentido de possibilitar a análise da idéia de tempo são retratos do rei feitos por Diego Velázquez e representam o rei jovem e posteriormente envelhecido. Acredita-se que a idéia de tempo para Velázquez tenha estreita relação com a sociedade barroca espanhola do século XVII na qual ele está inserido. Neste sentido, as representações do poder e do envelhecimento do monarca possíveis de serem vistas nas pinturas de Velázquez contribuem para se pensar a concepção de tempo do artista e da sociedade espanhola daquele período

First Report of Cucumber mosaic virus Isolated from Sambungai (Gynura procumbens

Directory of Open Access Journals (Sweden)

June Kwon

2017-12-01

Full Text Available In March 2016, an isolate of Cucumber mosaic virus (named Gyp-CMV was isolated from the Sambungai (Gynura procumbens showing the symptoms of mosaic and chlorosis. The isolate Gyp-CMV was characterized by disease reactions in several indicator plants, reverse transcription-polymerase chain reaction (RT-PCR, PCR-restriction fragment length polymorphism, and sequence analysis of movement protein (3a and coat protein (CP genes. Tobacco, tomato, pepper, ground cherry, and lambsquarters (Chenopodium quinoa and C. amaranticolor appeared typical CMV symptoms, but zucchini and cucumber were not infected. Phylogenetic analysis of the 3a and CP gene indicated that Gyp-CMV belongs to the CMV subgroup II. Sequence identities of the Gyp-CMV 3a and CP genes showed 99.3% and 100% to that of Hnt-CMV at amino acid level. To our knowledge, this is the first report of CMV infection in Gynura procumbens.

Presentación. hacienda y economía en la castilla del siglo XVII

Directory of Open Access Journals (Sweden)

José Ignacio ANDRÉS UCENDO

2011-07-01

Full Text Available La fiscalidad ha sido la gran culpable de la suerte que siguió la economía castellana en el siglo XVII. La presión fiscal no fue probablemente más acusada que en otros países, pero junto con la aparición de nuevas figuras fiscales, el uso y abuso de expedientes y los cambios en las formas de recaudación crearon poderosos desincentivos económicos que incidieron negativamente sobre las actividades comerciales y urbanas, de las que dependía el desarrollo de los mercados. Los trabajos incluidos en este Informe analizan algunas cuestiones de gran interés acerca de las repercusiones de la fiscalidad sobre las economías rurales y urbanas, el donativo de 1629, la deuda pública y el gasto en infraestructuras de las haciendas locales, que nos dan una idea de cómo la economía pudo verse afectada por la política fiscal de la Monarquía.

El autor ante sus lectores en el siglo XVII: el vértigo de la imprenta

Directory of Open Access Journals (Sweden)

Pedro Ruiz Pérez

2015-12-01

Full Text Available La imprenta, como cualquier otra tecnología, responde a unas demandas y produce un impacto en la ideología y el sistema de valores. En este caso afecta directamente a la posición de los autores, en su propia concepción, pero también en la relación con el texto y sus lectores. Entre el rechazo y la atracción, el efecto de la imprenta se traduce en un vértigo con directas manifestaciones en los textos y, sobre todo, en las declaraciones paratextuales. Se propone un acercamiento centrado de manera particular en la narrativa del siglo XVII, por su particular vinculación con la imprenta, distinta de la que mantenían la lírica o el teatro, y por los procesos de profesionalización de los autores que se dan en su espacio.

El arte del bordado en Navarra en los siglos XVI y XVII: Andrés de Salinas

Directory of Open Access Journals (Sweden)

Andueza Pérez, Alicia

2003-09-01

Full Text Available Given its classification as a decorative art, and its perception as mere artisanal work, scarce attention has been given to embroidery. Nevertheless, fortunately, in recent years there has been a resurgence of studies on this theme. This article, following these new trends, attempts to clarify certain aspects of this activity in the Navarre region during the sixteenth and seventeenth centuries.

Dada su condición de arte decorativa, y su consideración como una labor meramente artesanal, la atención que se le ha prestado al bordado es escasa. Por suerte, en los últimos años estamos asistiendo a un resurgir de los estudios sobre el tema. Este artículo, siguiendo estas nuevas tendencias, pretende esclarecer algunos aspectos sobre esta actividad en la Navarra de los siglos XVI y XVII.

20(R)-ginsenoside Rg3, a rare saponin from red ginseng, ameliorates acetaminophen-induced hepatotoxicity by suppressing PI3K/AKT pathway-mediated inflammation and apoptosis.

Science.gov (United States)

Zhou, Yan-Dan; Hou, Jin-Gang; Liu, Wei; Ren, Shen; Wang, Ying-Ping; Zhang, Rui; Chen, Chen; Wang, Zi; Li, Wei

2018-06-01

Although ginsenoside Rg3 was isolated as a major component of Korea red ginseng and confirmed to exert potential hepatoprotective effect on acetaminophen (APAP)-induced liver injury via induction of glutathione S-transferase (GST) in vitro, thein vivo hepatoprotective effect of Rg3 and the underlying molecular mechanism of action remain unclear. The current study was aimed to explore whether 20(R)-Ginsenoside Rg3 (20(R)-Rg3) could alleviate acetaminophen-induced liver injury in mice and to determine the involvement of PI3K/AKT signaling pathway. Our findings demonstrated that a single injection of APAP (250 mg/kg) increased the levels of alanine aminotransferase (ALT), aspartate aminotransferase (AST), tumor necrosis factor-α (TNF-α), and interleukin-1β (IL-1β); such increases were attenuated by pretreatment of mice with 20(R)-Rg3 for seven days. The depletion of glutathione (GSH), generation of malondialdehyde (MDA) and the over expression of cytochrome P450 E1 (CYP2E1) and 4-hydroxynonenal (4-HNE) caused by APAP exposure were also inhibited by 20(R)-Rg3 pretreatment. Moreover, 20(R)-Rg3 pretreatment significantly alleviated APAP-induced apoptosis, necrosis, and inflammatory infiltration in liver tissues. Importantly, 20(R)-Rg3 effectively attenuated APAP-induced liver injury in part via activating PI3K/AKT signaling pathway. In summary, 20(R)-Rg3 exerted liver protection against APAP-caused hepatotoxicity evidenced by inhibition of oxidative stress and inflammatory response, alleviation of hepatocellular necrosis and apoptosis via activation of PI3K/AKT signaling pathway, showing potential as a novel therapeutic agent to prevent liver damage. Copyright © 2018 Elsevier B.V. All rights reserved.

XVII International Scientific Conference ''RESHETNEV READINGS''

International Nuclear Information System (INIS)

2015-01-01

The International Scientific Conference 'RESHETNEV READINGS' is dedicated to the memory of Mikhail Reshetnev, an outstanding scientist, chief-constructor of space-rocket systems and communication satellites. The current volume represents selected proceedings of the main conference materials which were published by XVII International Scientific Conference 'RESHETNEV READINGS' held on November 12 – 14, 2013. Plenary sessions, round tables and forums will be attended by famous scientists, developers and designers representing the space technology sector, as well as professionals and experts in the IT industry. A number of outstanding academic figures expressed their interest in an event of such a level including Jaures Alferov, Vice-president of the Russian Academy of Sciences (RAS), Academician of RAS, Nobel laureate, Dirk Bochar, General Secretary of the European Federation of National Engineering Associates (FEANI), Prof. Yuri Gulyaev, Academician of RAS, Member of the Presidium of RAS, President of the International Union of Scientific and Engineering Associations, Director of the Institute of Radio Engineering and Electronics of RAS, as well as rectors of the largest universities in Russia, chief executives of well-known research enterprises and representatives of big businesses. We would like to thank our main sponsors such as JSC ''Reshetnev Information Satellite Systems'', JSC ''Krasnoyarsk Engineering Plant'', Central Design Bureau ''Geophysics'', Krasnoyarsk Region Authorities. These enterprises and companies are leading ones in the aerospace branch. It is a great pleasure to cooperate and train specialists for them. (preface)

Ginsenoside Re Ameliorates Brain Insulin Resistance and Cognitive Dysfunction in High Fat Diet-Induced C57BL/6 Mice.

Science.gov (United States)

Kim, Jong Min; Park, Chang Hyeon; Park, Seon Kyeong; Seung, Tae Wan; Kang, Jin Yong; Ha, Jeong Su; Lee, Du Sang; Lee, Uk; Kim, Dae-Ok; Heo, Ho Jin

2017-04-05

The ameliorating effects of ginsenoside Re (G Re) on high fat diet (HFD)-induced insulin resistance in C57BL/6 mice were investigated to assess its physiological function. In the results of behavioral tests, G Re improved cognitive dysfunction in diabetic mice using Y-maze, passive avoidance, and Morris water maze tests. G Re also significantly recovered hyperglycemia and fasting blood glucose level. In the results of serum analysis, G Re decreased triglyceride (TG), total cholesterol (TCHO), low-density lipoprotein cholesterol (LDLC), glutamic-oxaloacetic transaminase (GOT), and glutamic-pyruvic transaminase (GPT) and increased the ratio of high-density lipoprotein cholesterol (HDLC). G Re regulated acetylcholine (ACh), acetylcholinesterase (AChE), malondialdehyde (MDA), superoxide dismutase (SOD), and oxidized glutathione (GSH)/total GSH by regulating the c-Jun N-terminal protein kinase (JNK) pathway. These findings suggest that G Re could be used to improve HFD-induced insulin resistance condition by ameliorating hyperglycemia via protecting the cholinergic and antioxidant systems in the mouse brains.

Ginsenoside Rg1 alleviates corticosterone-induced dysfunction of gap junctions in astrocytes.

Science.gov (United States)

Xia, Cong-Yuan; Chu, Shi-Feng; Zhang, Shuai; Gao, Yan; Ren, Qian; Lou, Yu-Xia; Luo, Piao; Tian, Man-Tong; Wang, Zhi-Qi; Du, Guo-Hua; Tomioka, Yoshihisa; Yamakuni, Tohru; Zhang, Yi; Wang, Zhen-Zhen; Chen, Nai-Hong

2017-08-17

Ginsenoside Rg1 (Rg1), one of the major bioactive ingredients of Panax ginseng C. A. Mey, has neuroprotective effects in animal models of depression, but the mechanism underlying these effects is still largely unknown AIM OF THE STUDY: Gap junction intercellular communication (GJIC) dysfunction is a potentially novel pathogenic mechanism for depression. Thus, we investigated that whether antidepressant-like effects of Rg1 were related to GJIC. Primary rat prefrontal cortical and hippocampal astrocytes cultures were treated with 50μM CORT for 24h to induce gap junction damage. Rg1 (0.1, 1, or 10μM) or fluoxetine (1μM) was added 1h prior to CORT treatment. A scrape loading and dye transfer assay was performed to identify the functional capacity of gap junctions. Western blot was used to detect the expression and phosphorylation of connexin43 (Cx43), the major component of gap junctions. Treatment of primary astrocytes with CORT for 24h inhibited GJIC, decreased total Cx43 expression, and increased the phosphorylation of Cx43 at serine368 in a dose-dependent manner. Pre-treatment with 1μM and 10μM Rg1 significantly improved GJIC in CORT-treated astrocytes from the prefrontal cortex and hippocampus, respectively, and this was accompanied by upregulation of Cx43 expression and downregulation of Cx43 phosphorylation. These findings provide the first evidence indicating that Rg1 can alleviate CORT-induced gap junction dysfunction, which may have clinical significance in the treatment of depression. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

Pinturas, espacios y realidades complejas: un breve acercamiento a tres versiones indígenas del territorio novohispano de finales del siglo XVI y principios del XVII

OpenAIRE

Vicente Amparan, Martha

2016-01-01

Durante el Virreinato, las sociedades indígenas vivieron un reordenamiento territorial que las alejó de sus antiguos asentamientos para ser congregadas en “pueblos de indios”, de acuerdo con los patrones de asentamiento impuestos por los conquistadores. La nueva organización generó conflictos por la tierra y por el espacio que quedaron plasmados en las pinturas de finales del siglo XVI y principios del XVII, elaboradas por un tlacuiloque. En ellas podemos apreciar la manera en que los indios ...

A TRANSLATION OF THE SELECTED STORIES FROM THE MESNEVÎ WHICH WRITED BY A XVII. CENTURY POET SADÎKÎ XVII. YÜZYIL ŞÂİRİ SADÎKÎ’NİN MESNEVÎ’DEN SEÇME HİKÂYELER TERCÜMESİ

Directory of Open Access Journals (Sweden)

Sadık YAZAR

2009-10-01

Full Text Available In this article I will present a new work of Mesnevî literature (I mean the literary works which produced under the influence of Mewlânâ’s Mesnevî-i Ma’nevî which authored by a XVII. century poet Sadîkî and explain its importance for it is an example production of the classical Turkish (Ottoman literature and translations of Mesnevî. For this aim, I will take a glance at a few academical study that have been published on the translations and commentaries (sharh of Mesnevî, firstly. Than I will try to present Sadîkî and give information about his work that is composed of some selected stories from the Mesnevî. In the end of the article, some Latinized texts from this work will take place.

O exercício moral de memória da morte nos escritos religiosos do Brasil colonial (séculos XVII e XVIII)

OpenAIRE

Santos, Clara Braz dos [UNESP

2016-01-01

No Brasil, durante os séculos XVII e XVIII, pregadores e moralistas difundiram entre os colonos, por meio de sermões, livros de devoção, elogios e sonetos fúnebres, a ideia de que deveriam lembrar cotidianamente da morte, caso almejassem viver e morrer de acordo com os ditames da religião católica. A preocupação com os possíveis destinos das almas no além-túmulo – purgatório, inferno ou paraíso – foi fundamental para que esses letrados propagassem entre os colonos valores morais sobre a morte...

O papel do contraponto no desenvolvimento da harmonia : uma abordagem a partir do baixo contínuo italiano no século XVII

OpenAIRE

Gustavo Angelo Dias

2015-01-01

Resumo: Neste trabalho propomos uma investigação acerca do desenvolvimento da harmonia entre os séculos XVI e início do século XVIII, com especial ênfase no baixo contínuo italiano do século XVII, segundo algumas das fontes primárias mais relevantes publicadas na Itália neste período. Utilizando o tratado Le Istitutioni harmoniche (1558), de Gioseffo Zarlino como referência principal da teoria harmônica e contrapontística do renascimento, a tese está centrada na comparação entre estes procedi...

Griffon – what's in a name?

African Journals Online (AJOL)

Campbell Murn

genus name of Gyps for Gyps vulgaris [= G.fulvus], which he ... Appendix to this note my translation of Perrault's article; curiously he ... My translation of Mr. Perrault's article. ANATOMICAL DESCRIPTION OF. TWO GRIFONS. The description that previous. Authors made of the Grifon does not fit any known animal: besides the.

Impuestos sobre la renta de los eclesiásticos: el subsidio y excusado (Diócesis de Sevilla, mediados del siglo XVII

Directory of Open Access Journals (Sweden)

José Julián Hernández Borreguero

2007-12-01

Full Text Available A partir del siglo XVI se instauraron dos impuestos otorgados por el Papa al Rey de España, que pagaban cada uno de los eclesiásticos y beneficiados de los diezmos (incluidos nobles: el subsidio y el excusado, impuestos directos que gravaban sus ingresos anuales. En este artículo se explica el funcionamiento de esos dos impuestos a nivel nacional, el proceso de reparto entre todas las diócesis, así como se estudia la casuística concreta de su gestión en el arzobispado hispalense hacia mediados del siglo XVII, desde un punto de vista económico y contable.

Ginsenoside Rg1 protects rat bone marrow mesenchymal stem cells against ischemia induced apoptosis through miR-494-3p and ROCK-1.

Science.gov (United States)

Zheng, Hui-Zhen; Fu, Xue-Kun; Shang, Jiu-Long; Lu, Rong-Xi; Ou, Yong-Fang; Chen, Chun-Ling

2018-03-05

This study aimed to verify the cytoprotective effect of ginsenoside Rg1 in vivo, and to elucidate the mechanism of Rg1 in the ischemic microenvironment. Male rat bone marrow mesenchymal stem cells (rBMSCs) or rBMSCs treated with Rg1 were injected into ischemic region of the arterial embolism hind limb in female rats. Behavioral and histological data, obtained one-week post injection, showed that rBMSCs with Rg1 could improve the survival rate of BMSCs and enhance the therapeutic effects. rBMSCs treated with hypoxia and serum deprivation for 24h (H/SD-rBMSCs) showed the up-regulated expression of ras homolog family member A (RhoA), Rho associated coiled-coil containing protein kinase 1 (ROCK-1), myosin light chain 2 (MLC-2), Bcl2 associated agonist of cell death (Bad) and Bcl2 associated X, apoptosis regulator (Bax); while the expression of miR-148b-3p, miR-148b-5p and miR-494-3p was down-regulated. H/SD with Rg1 treatment (H/SD+Rg1-rBMSCs) inhibited the expression of ROCK-1, MLC-2, Bad and Bax, increased the expression of Bcl-2, miR-494-3p. After ROCK-1 knockout, the expression of Bad and Bax were downregulated and Bcl-2 upregulated, but Rg1 no longer altered their expression. Mir-494-3p functional study established that miR-494-3 mimic downregulated and miR-494-3 inhibitor upregulated ROCK-1 gene expression, Rg1 did not have the ability to change the ROCK gene expression after loss of function of miR-494-3p. Also, the function loss of mir-494-3p promoted apoptosis; otherwise reduced apoptosis. The anti-apoptotic effect of Rg1 disappeared after mir-494-3p loss or gain function. In conclusion, Ginsenoside Rg1 has shown to have protective effects on ischemic-induced rBMSCs apoptosis through mir-494-3p→ROCK-1→Bcl-2 signaling pathway. Copyright © 2018. Published by Elsevier B.V.

Ginsenoside Rg3 improves cardiac mitochondrial population quality: Mimetic exercise training

Energy Technology Data Exchange (ETDEWEB)

Sun, Mengwei [Key Laboratory of State General Administration of Sport, Shanghai Research Institute of Sports Science, Shanghai 200031 (China); Huang, Chenglin [Shanghai Key Laboratory of Vascular Biology, Department of Hypertension and Pharmacology, Ruijin Hospital, Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Wang, Cheng; Zheng, Jianheng; Zhang, Peng; Xu, Yangshu [Key Laboratory of State General Administration of Sport, Shanghai Research Institute of Sports Science, Shanghai 200031 (China); Chen, Hong, E-mail: hchen100@hotmail.com [Shanghai Key Laboratory of Vascular Biology, Department of Hypertension and Pharmacology, Ruijin Hospital, Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China); Shen, Weili, E-mail: weili_shen@hotmail.com [Shanghai Key Laboratory of Vascular Biology, Department of Hypertension and Pharmacology, Ruijin Hospital, Shanghai Jiaotong University, School of Medicine, Shanghai 200025 (China)

2013-11-08

Highlights: •Rg3 is an ergogenic aid. •Rg3 improves mitochondrial antioxidant capacity. •Rg3 regulates mitochondria dynamic remodeling. •Rg3 alone matches some the benefits of aerobic exercise. -- Abstract: Emerging evidence indicates exercise training could mediate mitochondrial quality control through the improvement of mitochondrial dynamics. Ginsenoside Rg3 (Rg3), one of the active ingredients in Panax ginseng, is well known in herbal medicine as a tonic and restorative agent. However, the molecular mechanism underlying the beneficial effects of Rg3 has been elusive. In the present study, we compared the effects of Rg3 administration with aerobic exercise on mitochondrial adaptation in cardiac muscle tissue of Sprague–Dawley (SD) rats. Three groups of SD rats were studied: (1) sedentary control, (2) Rg3-treated and (3) aerobic exercise trained. Both aerobic exercise training and Rg3 supplementation enhanced peroxisome proliferator-activated receptor coactivator 1 alpha (PGC-1α) and nuclear factor-E2-related factor 2 (Nrf2) protein levels in cardiac muscle. The activation of PGC-1α led to increased mRNA levels of mitochondrial transcription factor A (Tfam) and nuclear related factor 1(Nrf1), these changes were accompanied by increases in mitochondrial DNA copy number and complex protein levels, while activation of Nrf2 increased levels of phase II detoxifying enzymes, including nicotinamide adenine dinucleotide phosphate:quinone oxidoreductase 1(NQO1), superoxide dismutase (MnSOD) and catalase. Aerobic exercise also enhanced mitochondrial autophagy pathway activity, including increased conversion of LC3-I to LC3-II and greater expression of beclin1 and autophagy-related protein 7 (ATG7), these effects of aerobic exercise are comparable to that of Rg3. These results demonstrate that Rg3 mimics improved cardiac adaptations to exercise by regulating mitochondria dynamic remodeling and enhancing the quantity and quality of mitochondria.

Ginsenoside Rg3 improves cardiac mitochondrial population quality: Mimetic exercise training

International Nuclear Information System (INIS)

Sun, Mengwei; Huang, Chenglin; Wang, Cheng; Zheng, Jianheng; Zhang, Peng; Xu, Yangshu; Chen, Hong; Shen, Weili

2013-01-01

Highlights: •Rg3 is an ergogenic aid. •Rg3 improves mitochondrial antioxidant capacity. •Rg3 regulates mitochondria dynamic remodeling. •Rg3 alone matches some the benefits of aerobic exercise. -- Abstract: Emerging evidence indicates exercise training could mediate mitochondrial quality control through the improvement of mitochondrial dynamics. Ginsenoside Rg3 (Rg3), one of the active ingredients in Panax ginseng, is well known in herbal medicine as a tonic and restorative agent. However, the molecular mechanism underlying the beneficial effects of Rg3 has been elusive. In the present study, we compared the effects of Rg3 administration with aerobic exercise on mitochondrial adaptation in cardiac muscle tissue of Sprague–Dawley (SD) rats. Three groups of SD rats were studied: (1) sedentary control, (2) Rg3-treated and (3) aerobic exercise trained. Both aerobic exercise training and Rg3 supplementation enhanced peroxisome proliferator-activated receptor coactivator 1 alpha (PGC-1α) and nuclear factor-E2-related factor 2 (Nrf2) protein levels in cardiac muscle. The activation of PGC-1α led to increased mRNA levels of mitochondrial transcription factor A (Tfam) and nuclear related factor 1(Nrf1), these changes were accompanied by increases in mitochondrial DNA copy number and complex protein levels, while activation of Nrf2 increased levels of phase II detoxifying enzymes, including nicotinamide adenine dinucleotide phosphate:quinone oxidoreductase 1(NQO1), superoxide dismutase (MnSOD) and catalase. Aerobic exercise also enhanced mitochondrial autophagy pathway activity, including increased conversion of LC3-I to LC3-II and greater expression of beclin1 and autophagy-related protein 7 (ATG7), these effects of aerobic exercise are comparable to that of Rg3. These results demonstrate that Rg3 mimics improved cardiac adaptations to exercise by regulating mitochondria dynamic remodeling and enhancing the quantity and quality of mitochondria

Ginsenoside Rg5 improves cognitive dysfunction and beta-amyloid deposition in STZ-induced memory impaired rats via attenuating neuroinflammatory responses.

Science.gov (United States)

Chu, Shenghui; Gu, Junfei; Feng, Liang; Liu, Jiping; Zhang, Minghua; Jia, Xiaobin; Liu, Min; Yao, Danian

2014-04-01

Neuroinflammatory responses play a crucial role in the pathogenesis of Alzheimer's disease (AD). Ginsenoside Rg5 (Rg5), an abundant natural compound in Panax ginseng, has been found to be beneficial in treating AD. In the present study, we demonstrated that Rg5 improved cognitive dysfunction and attenuated neuroinflammatory responses in streptozotocin (STZ)-induced memory impaired rats. Cognitive deficits were ameliorated with Rg5 (5, 10 and 20mg/kg) treatment in a dose-dependent manner together with decreased levels of inflammatory cytokines TNF-α and IL-1β (Pred and immunohistochemistry staining results showed that Rg5 alleviated Aβ deposition but enhanced the expressions of insulin-like growth factors 1 (IGF-1) and brain derived neurophic factor (BDNF) in the hippocampus and cerebral cortex (Pmemory impairments in rats could be improved by Rg5, which was associated with attenuating neuroinflammatory responses. Our findings suggested that Rg5 could be a beneficial agent for the treatment of AD. Copyright © 2014 Elsevier B.V. All rights reserved.

Ginsenoside Rh2 Induces Human Hepatoma Cell Apoptosisvia Bax/Bak Triggered Cytochrome C Release and Caspase-9/Caspase-8 Activation

Directory of Open Access Journals (Sweden)

Xiao-Xi Guo

2012-11-01

Full Text Available Ginsenoside Rh2 (G-Rh2 has been shown to induce apoptotic cell death in a variety of cancer cells. However, the details of the signal transduction cascade involved in G-Rh2-induced cell death is unclear. In this manuscript we elucidate the molecular mechanism of G-Rh2-induced apoptosis in human hepatoma SK-HEP-1 cells by demonstrating that G-Rh2 causes rapid and dramatic translocation of both Bak and Bax, which subsequently triggers mitochondrial cytochrome c release and consequent caspase activation. Interestingly, siRNA-based gene inactivation of caspase-8 effectively delays caspase-9 activation and apoptosis induced by G-Rh2, indicating that caspase-8 also plays an important role in the G-Rh2-induced apoptosis program. Taken together, our results indicate that G-Rh2 employs a multi pro-apoptotic pathway to execute cancer cell death, suggesting a potential role for G-Rh2 as a powerful chemotherapeutic agent.

Oral nano-delivery of anticancer ginsenoside 25-OCH3-PPD, a natural inhibitor of the MDM2 oncogene: Nanoparticle preparation, characterization, in vitro and in vivo anti-prostate cancer activity, and mechanisms of action.

Science.gov (United States)

Voruganti, Sukesh; Qin, Jiang-Jiang; Sarkar, Sushanta; Nag, Subhasree; Walbi, Ismail A; Wang, Shu; Zhao, Yuqing; Wang, Wei; Zhang, Ruiwen

2015-08-28

The Mouse Double Minute 2 (MDM2) oncogene plays a critical role in cancer development and progression through p53-dependent and p53-independent mechanisms. Both natural and synthetic MDM2 inhibitors have been shown anticancer activity against several human cancers. We have recently identified a novel ginsenoside, 25-OCH3-PPD (GS25), one of the most active anticancer ginsenosides discovered thus far, and have demonstrated its MDM2 inhibition and anticancer activity in various human cancer models, including prostate cancer. However, the oral bioavailability of GS25 is limited, which hampers its further development as an oral anticancer agent. The present study was designed to develop a novel nanoparticle formulation for oral delivery of GS25. After GS25 was successfully encapsulated into PEG-PLGA nanoparticles (GS25NP) and its physicochemical properties were characterized, the efficiency of MDM2 targeting, anticancer efficacy, pharmacokinetics, and safety were evaluated in in vitro and in vivo models of human prostate cancer. Our results indicated that, compared with the unencapsulated GS25, GS25NP demonstrated better MDM2 inhibition, improved oral bioavailability and enhanced in vitro and in vivo activities. In conclusion, the validated nano-formulation for GS25 oral delivery improves its molecular targeting, oral bioavailability and anticancer efficacy, providing a basis for further development of GS25 as a novel agent for cancer therapy and prevention.

Introducción al estudio tipológico de las espadas españolas: siglos XVI-XVII

Directory of Open Access Journals (Sweden)

Dueñas Beraiz, Germán

2004-12-01

Full Text Available This article pretends to reflect on the spanish swords from 16^th and 17^th centuries. The history of this production has been eclipsed by Toledo fame. The identification of spanish types have been mainly made according its marks, signatures and some typologies, but little is know about another centers. Therefore this article studies the variety and richness of the spanish contemporary productions, not only from Toledo.

Este artículo pretende reflexionar sobre las espadas españolas de los siglos XVI y XVII. La historia de esta producción ha sido eclipsada por la fama de Toledo. La identificación de los tipos españoles se ha basado en sus marcas, firmas y algunas tipologías, pero se sabe muy poco sobre otros centros productores. Por ello este artículo aborda la variedad y riqueza de las producciones españolas contemporáneas, no sólo de Toledo.

[Contents of total anthocyanins and total saponins as well as composition of saponin monomers of Purple and Green Notoginseng Radix et Rhizoma].

Science.gov (United States)

Zhao, Chang-ling; Yang, Sheng-chao; Chen, Zhong-jian; Shen, Yong; Wei, Fu-gang; Wang, Wu; Long, Ting-ju

2014-10-01

The contents of total anthocyanins and total saponins as well as the composition of saponin monomers of Purple and Green Notoginseng Radix et Rhizoma were studied to compare the medicinal quality and commercial values. Three-year-old Notoginseng Radix et Rhizoma was selected as the research materials. The contents of total anthocyanins and total saponins were determined by spectrophotometry. The compositions of saponin monomers were monitored by HPLC. The significance of content differences was determined by variance analysis. The contents of total anthocyanins and total saponins of Purple Notoginseng Radix et Rhizomawere about 204.85% and 33.86% higher than those of Green Notoginseng Radix et Rhizoma respectively. The Purple and Green Notoginseng Radix et Rhizoma both contained five saponin monomers whose contents were as follows: ginsenoside Rg1 > ginsenoside Rb1 > notoginsenoside R1 > ginsenoside Rd > ginsenoside Re. The contents of notoginsenoside R1, ginsenoside Rd and ginsenoside Re of Purple Notoginseng Radix et Rhizoma were about 16.03%, 10.83% and 5.39% higher than those of Green Notoginseng Radix et Rhizoma respectively. However, the contents of ginsenoside Rg1 and ginsenoside Rb1 of Green Notoginseng Radix et Rhizoma were about 0.93% and 3.33% higher than those of Purple Notoginseng Radix et Rhizoma respectively. With respect to Green Notoginseng Radix et Rhizoma, the increase of the total anthocyanins in Purple Notoginseng Radix et Rhizoma reached a significant level, but the increases of total saponins, notoginsenoside R1, ginsenoside Rd and ginsenoside Re and the decreases of ginsenoside Rg1 and ginsenoside Rb1 did not. The total anthocyanins accumulation in Notoginseng Radix et Rhizoma implies the content increases of the total saponins, notoginsenoside R1, ginsenoside Rd and ginsenoside Re, and the slight decreases of ginsenoside Rg1 and ginsenoside Rb1 contents; but the type and relative contents of saponin monomers remain unchanged. The medicinal

Removing the threat of diclofenac to critically endangered Asian vultures.

Directory of Open Access Journals (Sweden)

Gerry Swan

2006-03-01

Full Text Available Veterinary use of the nonsteroidal anti-inflammatory (NSAID drug diclofenac in South Asia has resulted in the collapse of populations of three vulture species of the genus Gyps to the most severe category of global extinction risk. Vultures are exposed to diclofenac when scavenging on livestock treated with the drug shortly before death. Diclofenac causes kidney damage, increased serum uric acid concentrations, visceral gout, and death. Concern about this issue led the Indian Government to announce its intention to ban the veterinary use of diclofenac by September 2005. Implementation of a ban is still in progress late in 2005, and to facilitate this we sought potential alternative NSAIDs by obtaining information from captive bird collections worldwide. We found that the NSAID meloxicam had been administered to 35 captive Gyps vultures with no apparent ill effects. We then undertook a phased programme of safety testing of meloxicam on the African white-backed vulture Gyps africanus, which we had previously established to be as susceptible to diclofenac poisoning as the endangered Asian Gyps vultures. We estimated the likely maximum level of exposure (MLE of wild vultures and dosed birds by gavage (oral administration with increasing quantities of the drug until the likely MLE was exceeded in a sample of 40 G. africanus. Subsequently, six G. africanus were fed tissues from cattle which had been treated with a higher than standard veterinary course of meloxicam prior to death. In the final phase, ten Asian vultures of two of the endangered species (Gyps bengalensis, Gyps indicus were dosed with meloxicam by gavage; five of them at more than the likely MLE dosage. All meloxicam-treated birds survived all treatments, and none suffered any obvious clinical effects. Serum uric acid concentrations remained within the normal limits throughout, and were significantly lower than those from birds treated with diclofenac in other studies. We conclude that

Effects of heavy metals on biomarkers for oxidative stress in Griffon vulture (Gyps fulvus)

International Nuclear Information System (INIS)

Espín, Silvia; Martínez-López, Emma; Jiménez, Pedro; María-Mojica, Pedro; García-Fernández, Antonio J.

2014-01-01

Metals are involved in the formation of reactive oxygen species (ROS) which may result in metal-related oxidative stress that can lead to oxidative damage to lipids, DNA and proteins. It is necessary to understand the mechanisms of metal toxicity in wild birds, and the concentrations that cause effects on oxidative stress biomarkers. The aim of this study is to assess the concentrations of lead (Pb), cadmium (Cd), mercury (Hg), copper (Cu) and zinc (Zn) with regards to oxidative stress in blood samples of 66 Griffon vultures (Gyps fulvus) from two areas of the Autonomous Community of Valencia (East of Spain). The two study areas (Alcoy n=36 and Cinctorres n=30) were selected as random locations of interest that had not yet been studied, and are feeding stations where supplementary food, mainly of pork origin, is provided for vultures. Given that the two study areas are not considered polluted sites, we expected to find low metal concentrations. However, there are no known threshold concentrations at which metals can affect antioxidant systems, and low metal levels may have an effect on antioxidant biomolecules. In this study, since sampling was done at the beginning of the hunting season, the low Pb levels found in most Griffon vultures from Alcoy and Cinctorres (median=12.37 and 16.26 μg/dl, respectively) are suggestive of background levels usually found in vultures that feed on pork carcasses all year round. The ingestion of game meat with bullet fragments in carcasses or with Pb shots embedded in the flesh could be the cause of the high blood Pb concentrations found in three vultures from Cinctorres (83, 290 and 362 μg/dl). Griffon vultures feeding in Cinctorres had enhanced CAT and GST activities and tGSH concentrations, which may be interpreted as protective response against the higher TBARS levels. This study provides threshold concentrations at which metals affect antioxidant system derived from 66 samples of Griffon vulture. Blood Cd concentrations

Effects of heavy metals on biomarkers for oxidative stress in Griffon vulture (Gyps fulvus)

Energy Technology Data Exchange (ETDEWEB)

Espín, Silvia, E-mail: silvia.espin@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); Martínez-López, Emma, E-mail: emmaml@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); Jiménez, Pedro, E-mail: pjjm@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); María-Mojica, Pedro, E-mail: pmmojica@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain); “Santa Faz” Wildlife Recovery Centre, Comunidad Valenciana, Alicante (Spain); García-Fernández, Antonio J., E-mail: ajgf@um.es [Department of Toxicology, Faculty of Veterinary Medicine, University of Murcia, Campus de Espinardo, 30100 Murcia (Spain)

2014-02-01

Metals are involved in the formation of reactive oxygen species (ROS) which may result in metal-related oxidative stress that can lead to oxidative damage to lipids, DNA and proteins. It is necessary to understand the mechanisms of metal toxicity in wild birds, and the concentrations that cause effects on oxidative stress biomarkers. The aim of this study is to assess the concentrations of lead (Pb), cadmium (Cd), mercury (Hg), copper (Cu) and zinc (Zn) with regards to oxidative stress in blood samples of 66 Griffon vultures (Gyps fulvus) from two areas of the Autonomous Community of Valencia (East of Spain). The two study areas (Alcoy n=36 and Cinctorres n=30) were selected as random locations of interest that had not yet been studied, and are feeding stations where supplementary food, mainly of pork origin, is provided for vultures. Given that the two study areas are not considered polluted sites, we expected to find low metal concentrations. However, there are no known threshold concentrations at which metals can affect antioxidant systems, and low metal levels may have an effect on antioxidant biomolecules. In this study, since sampling was done at the beginning of the hunting season, the low Pb levels found in most Griffon vultures from Alcoy and Cinctorres (median=12.37 and 16.26 μg/dl, respectively) are suggestive of background levels usually found in vultures that feed on pork carcasses all year round. The ingestion of game meat with bullet fragments in carcasses or with Pb shots embedded in the flesh could be the cause of the high blood Pb concentrations found in three vultures from Cinctorres (83, 290 and 362 μg/dl). Griffon vultures feeding in Cinctorres had enhanced CAT and GST activities and tGSH concentrations, which may be interpreted as protective response against the higher TBARS levels. This study provides threshold concentrations at which metals affect antioxidant system derived from 66 samples of Griffon vulture. Blood Cd concentrations

Liposome-based delivery systems for ginsenoside Rh2: in vitro and in vivo comparisons

Energy Technology Data Exchange (ETDEWEB)

Xu, Linqiang [China Pharmaceutical University, Department of Pharmaceutics, State Key Laboratory of Natural Medicines (China); Yu, Hua [University of Macao, Institute of Chinese Medical Sciences (China); Yin, Shaoping; Zhang, Ruixia; Zhou, Yudan; Li, Juan, E-mail: lijuancpu@163.com [China Pharmaceutical University, Department of Pharmaceutics, State Key Laboratory of Natural Medicines (China)

2015-10-15

The Ginsenoside Rh2 (Rh2) has been shown to possess anti-cancer properties both in vitro and in vivo. However, the poor bioavailability and fast plasma elimination limit the further clinical applications of Rh2 for cancer treatments. In the present study, three types of Rh2-loaded liposomes including Rh2-loaded normal liposome (Rh2-LP), Rh2-loaded cationic liposome (Rh2-CLP), and Rh2-loaded Methoxy poly(ethylene glycol)-poly(lactide) (mPEG-PLA) liposome (Rh2-PLP) have been optimized and prepared with mean particle size of 80–125 nm. Compared to Rh2-LP, surface modifications with mPEG or octadecylamine significantly improve the physicochemical and biological properties both in vitro and in vivo. Moreover, PLP presented better tumor accumulation of the fluorescent cyanine dye, 1,1′-dioctadecyl-3,3,3′,3′-tetramethylindotricarbocyanine iodide (DiR) in HepG2-xenografted nude mice than CLP (1.3-fold) or LP (1.6-fold) and prolong the resident time of DiR in tumor and organs (more than 24 h). The in vivo anti-cancer efficacy assessments indicate that Rh2-PLP presents the most activity on suppressing tumor growth in HepG2-xenografted mice than Rh2-LP and Rh2-CLP and without any significant toxicity. Our results indicate that mPEG-PLA modified liposome should be a potential and promising strategy to enhance the therapeutic index for anti-cancer agents.

NARRATIVAS HAGIOGRÁFICAS Y REPRESENTACIONES DEMONOLÓGICAS: EL DEMONIO EN LOS CLAUSTROS DEL PERÚ VIRREINAL. SIGLO XVII

Directory of Open Access Journals (Sweden)

René Millar Carvacho

2011-12-01

Full Text Available En el Perú del siglo XVII, caracterizado por una intensa religiosidad, los hombres y mujeres virtuosos vivieron en una permanente confrontación con el demonio, la que fue entendida como expresión del conflicto que se daba entre el Bien y el Mal desde el comienzo de los tiempos y que no culminaría sino hasta el término de ellos. El demonio, al intentar la perdición de los "santos", pretendía destruir la obra de Dios, en la medida en que aquellos eran sus elegidos. Pero, por otra parte, el demonio actuaba en estas materias con permiso de Dios, que buscaba de esa manera probar la fortaleza de sus hijos predilectos. En el presente artículo, utilizando los relatos hagiográficos, se analizan esos fenómenos y se describen las estrategias que utilizaba el demonio para hacer caer a los "santos", se examinan los medios a los que estos recurrían en sus luchas y el significado que tenían esas confrontaciones. Buscamos comprender por qué para la sociedad peruana del siglo XVII, y todavía más para los "santos", el demonio mantuvo un protagonismo en la cotidianeidad a lo largo de toda la centuria, mientras que en Europa su imagen tendía a diluirse.In seventeenth century Peru, which was characterized by an intense religiosity, virtuous men and women lived in a permanent confrontation with the devil that was understood as an expression of the conflict between Good and Evil that existed from the beginning of time and would last until the end of time. The devil, attempting the perdition of the "saints", tried to destroy the work of God, because they were his chosen. But, on the other hand, the devil acted in these matters with Gods permission who in this way tried to test the strength of his favored children. Using hagiographic accounts, this article analyzes these phenomena and describes the strategies that the devil used in order to make the "saints" fall. It also examines the means those turned to in their struggles and the meaning that those

Militares en el Mundo Urbano Fronterizo Castellano (siglos XVI-XVII Soldiers within the frontier urban communities of Castile (XVI-XVII centuries

Directory of Open Access Journals (Sweden)

Susana TRUCHUElO GARCÍA

2012-12-01

Full Text Available En este artículo se estudian diversos espacios urbanos fronterizos y costeros que albergaban presidios reales en Castilla en los siglos XVI y XVII. Se valoran las prácticas de gobierno que relacionaron, por una parte, a los vecinos, sujetos a la jurisdicción de los alcaldes y el corregidor, y, por otra, a los soldados, beneficiados por el fuero militar. Muchas de las discordias estuvieron causadas por las competencias de jurisdicción entre los distintos poderes, por el aumento de atribuciones de los militares en los contextos bélicos, por el control ejercido por los militares en las milicias concejiles y por la participación de los soldados en las instituciones de gobierno de la ciudad. Este estudio nos permite comprender el proceso de definición de una identidad particular en las ciudades fronterizas, sustentada en la exclusión de la comunidad de todo elemento que intentara segregarse del marco de acción de las autoridades urbanas y de la jurisdicción ordinaria.From different viewpoints, this article analyzes urban frontier coastal spaces in early modern Castile (16th and 17th centuries. The central focus is on the government practices that had to deal with quite different affairs, but mainly on arbitration of conflicts between urban neighbors and soldiers. The first were under the main magistrate so-called Corregidor jurisdiction, helped in this task by alcaldes (a special variety of mayors. The soldiers had specific military jurisdiction apart from that ordinary for the neighborhood. Many disputes were jurisdictional conflicts due to military special competences in war contexts, when the army widened its powers to control council regiments (milicias concejiles, and also to deal with the military participation in urban in institutions and government. These problems analysis points out the features that create a particular urban-frontier identity, based on the definition of urban community with the exclusion of individuals, groups and

Edificios protoindustriales para la producción de vino en Sicilia. Los palmentosy las bodegas del Etna desde el s. XVII al XIX

Directory of Open Access Journals (Sweden)

Cascone, G.

1997-08-01

Full Text Available In the Etnian region, during XVII and XIX centuries wine production begins to be made in a proto-industrial way. Great industries for wine production are built in these dates with a great technological and architectural specialization. Many of these constructions are in use today with good conservation state, but others are abandoned or ruined. In this paper the main characteristics of the "palmenti" and wine cellars that yet exist are analyzed. Architectural aspects are related with simple functionality aspects devoting special attention to the press machinery. The present state of this architectural patrimony and reasons to preserve and reuse it are discussed. Several ways and proposals to achieve this are defined at the end.

En la región del Etna, entre los siglos XVII y XIX, la producción del vino empieza a hacerse de un modo protoindustrial. En tales fechas se construyen numerosas infraestructuras de grandes dimensiones para producir vino, denotando una gran especialización tecnológica y arquitectónica. Muchas de estas construcciones se usan aún hoy, manteniéndose en buen estado; otras, sin embargo, avanzan hacia el abandono y el deterioro. En el presente estudio se analizan las características principales de las bodegas y de los "palmentos" que han llegado hasta nosotros. Se relacionan los aspectos arquitectónicos con los puramente funcionales y se dedica una atención especial a la maquinaria de prensado. Se detalla al final el estado actual en el que se encuentra este patrimonio arquitectónico y se discuten las razones que hoy día animan a conservarlo y a volver a ponerlo en funcionamiento. Por último, se definen rápidamente los modos concretos y las propuestas para llevarlo a cabo.

Component Analysis of Cultivated Ginseng, Red Ginseng, Cultivated Wild Ginseng, and Red Wild Ginseng Using HPLC Method

Directory of Open Access Journals (Sweden)

Jang Ho, Lee

2008-06-01

Full Text Available Objectives : The aim of this experiment is to provide an differentiation of ginseng, red ginseng, cultivated wild ginseng(CWG, and red wild ginseng(RWG through component analysis using HPLC(High Performance Liquid Chromatography, hereafter HPLC. Methods : Comparative analyses of ginsenoside Rg3, ginsenoside Rh2, and ginsenosides Rb1 and Rg1 of various ginsengs were conducted using HPLC. Results : 1. CWG was relatively heat-resistant and showed slow change in color during the process of steaming and drying, compared to cultivated ginseng. 2. Ginsenoside Rg3 was not detected in cultivated ginseng and CWG, whereas it was high in red ginseng and RWG. Ginsenoside Rg3 was more generated in red ginseng than in RWG. 3. Ginsenoside Rh2 appreared during steaming and drying of cultivated ginseng, whereas it was more increased during steaming and drying of CWG. 4. Ginsenoside Rg1 content was more increased during steaming and drying of cultivated ginseng, whereas it was more decreased during steaming and drying of CWG. 5. Ginsenoside Rb1 content was increased about 500% during steaming and drying of cultivated ginseng, whereas it was increased about 30% during steaming and drying of CWG, indicating that ginsenoside Rb1 was more generated in red ginseng than in RWG. 6. Ginsenoside Rg3 content was higher, whereas ginsenoside Rg1 content was lower in 11th RWG than in 9th RWG, indicating that ginsenoside Rg3 content was increased and Rg1 content was decreased as steaming and drying continued to proceed. Ginsenoside Rh2 and Rb1 contents began to be increased, followed by decreased after 9th steaming and drying process. Conclusions : Above experiment data can be an important indicator for the identification of ginseng, red ginseng, CWG, and RWG. And the following studies will be need for making good product using CWG.

El clero y el delito de proposiciones en Zacatecas: los errores manifestados en los sermones, siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Georgina Quiñones Flores

2014-04-01

Full Text Available El delito de proposiciones consistía en las expresiones que refl ejaban puntos contrarios con la doctrina de la Iglesia católica. Por ello, pertenecía a la jurisdicción del Santo Ofi cio, que recibió denuncias incluso contra el clero por cometer esta transgresión, sobre todo durante los sermones, por lo que se cree que causaban confusión entre los oyentes. Pero ¿realmente provocaban escándalo entre la población o solo entre los eclesiásticos?, ¿acaso se trataba de errores de entendimiento por la poca instrucción de los predicadores?, o ¿se usaba el púlpito para expresar los confl ictos de la Iglesia? A estas preguntas se les dará respuesta en este texto, que se ubica en Zacatecas en los siglos XVI y XVII.

Cardioprotective Effects of 20(S-Ginsenoside Rh2 against Doxorubicin-Induced Cardiotoxicity In Vitro and In Vivo

Directory of Open Access Journals (Sweden)

Hongbo Wang

2012-01-01

Full Text Available Doxorubicin (DOX is considered as one of the best antineoplastic agents. However, its clinical use is restricted by its associated cardiotoxicity, which is mediated by the production of reactive oxygen species. In this study, 20(S-ginsenoside Rh2 (Rh2 was explored whether it had protective effects against DOX-induced cardiotoxicity. In vitro study on H9C2 cell line, as well as in vivo investigation in one mouse and one rat model of DOX-induced cardiomyopathy, was carried out. The results showed that pretreatment with Rh2 significantly increased the viability of DOX-injured H9C2 cells. In the mouse model, Rh2 could suppress the DOX-induced release of the cardiac enzymes into serum and improved the occurred pathological changes through ameliorating the decreased antioxidant biomolecules and the cumulated lipid peroxidation malondialdehyde in heart tissues. In the rat model, Rh2 could attenuate the change of ECG resulting from DOX administration. Furthermore, Rh2 enhanced the antitumor activity of DOX in A549 cells. Our findings thus demonstrated that Rh2 pretreatment could effectively alleviate heart injury induced by DOX, and Rh2 might act as a novel protective agent in the clinical usefulness of DOX.

Jesuit missions on the Guayrá area on the first decades of the XVII century Las misiones jesuitas en la región del Guayrá en las primeras décadas del siglo XVII

Directory of Open Access Journals (Sweden)

Julia A. Ossanna

2008-01-01

Full Text Available Jesuits missions on the basin of the Plata River are vastly known on national historiography. From the geographical relationship of the Azara to the last studies of Di Stefano and Zanatta on its "Historia de la Iglesia Argentina ", the history of the "30 towns" on the argentine province of Misiones has been greatly study -and wrote over- in the national history. This is perceptible as much in the idyllic imaginary of communion between Jesuits and guaranies as in the works that shows the complex alliances system that made possible the apparent guaraní submission to the spain dominion. But all this images must be considered as the last phase of a long process that -with its forward and backwards - begun at the early XVII century, when the Jesuits started its evangelization chores with the indigenous people. It's our intention to work the first two decades of the foundation and work of Jesuit missions on Guayrá (1609-1629, when the strategies and structures of domination are taking form, the try and error method is and everyday occurrence and the fights between indigenous people, Jesuits, Spanish and Portuguese are framed on such an unstable border as it was the guayrense area at that time.Las misiones jesuitas en el espacio de la cuenca del Plata son bastante conocidas en la historiográfica nacional. Desde la relación geográfica de Azara hasta los últimos aportes de Di Stefano y Zanatta en su "Historia de la Iglesia Argentina", la historia de los "30 pueblos" en la provincia argentina de Misiones ha dado mucho que hablar -y escribir- a lo largo de la historia nacional. Esto es perceptible tanto en las imágenes idílicas de comunión entre jesuitas y guaraníes hasta los trabajos que develan los complejos sistemas de alianzas que posibilitaban la aparente sumisión guaraní al dominio español. Pero todas estas imágenes deben considerarse como el estado final de un proceso que -con sus marchas y contramarchas- se inicia a principios del

Moscow Autocracy of XVI - XVII Centuries: Eastern ‘’Despotism’’ or an Early Modern European Monarchy?

Directory of Open Access Journals (Sweden)

Vasilij A. Zajcev

2017-06-01

Full Text Available The article considers the problems related to the peculiarities of the Russian state political and legal development during the early New Time (XVI-XVII centuries in a comparative-historical aspect against the background of similar processes taking place in neighboring European states. The authors come to the conclusion that, despite certain, dictated by objective reasons (first of all, the conditions for the emergence and subsequent development, there are more common features than the differences between the processes of the political and legal sphere development in Russia and Western Europe. The fact that this community escaped from the view of researchers is related, in the authors' opinion, to the fact that foreign observers, describing the political system of an early Russian state, dealt only with an outer shell, while its internal contents remained if not a secret, then, in any case, a mystery for them. They were not admitted to the Russian political cuisine, and therefore the details of Russian political and legal institution functioning remained unavailable to them.

The skin protective effects of compound K, a metabolite of ginsenoside Rb1 from Panax ginseng.

Science.gov (United States)

Kim, Eunji; Kim, Donghyun; Yoo, Sulgi; Hong, Yo Han; Han, Sang Yun; Jeong, Seonggu; Jeong, Deok; Kim, Jong-Hoon; Cho, Jae Youl; Park, Junseong

2018-04-01

Compound K (CK) is a ginsenoside, a metabolite of Panax ginseng . There is interest both in increasing skin health and antiaging using natural skin care products. In this study, we explored the possibility of using CK as a cosmetic ingredient. To assess the antiaging effect of CK, RT-PCR was performed, and expression levels of matrix metalloproteinase-1, cyclooxygenase-2, and type I collagen were measured under UVB irradiation conditions. The skin hydrating effect of CK was tested by RT-PCR, and its regulation was explored through immunoblotting. Melanin content, melanin secretion, and tyrosinase activity assays were performed. CK treatment reduced the production of matrix metalloproteinase-1 and cyclooxygenase-2 in UVB irradiated NIH3T3 cells and recovered type I collagen expression level. Expression of skin hydrating factors-filaggrin, transglutaminase, and hyaluronic acid synthases-1 and -2-were augmented by CK and were modulated through the inhibitor of κBα, c-Jun N-terminal kinase, or extracellular signal-regulated kinases pathway. In the melanogenic response, CK did not regulate tyrosinase activity and melanin secretion, but increased melanin content in B16F10 cells was observed. Our data showed that CK has antiaging and hydrating effects. We suggest that CK could be used in cosmetic products to protect the skin from UVB rays and increase skin moisture level.

Transformaciones y formas de legitimación en la autoridad de los caciques coloniales de Jujuy: Siglo XVII Transformations and forms of legitimacy within colonial caciques authority: Province of Jujuy, 17th century

Directory of Open Access Journals (Sweden)

Gabriela Sica

2009-06-01

Full Text Available Este trabajo intenta analizar las transformaciones de la autoridad en los jefes étnicos en la jurisdicción de la ciudad de San Salvador de Jujuy (Gobernación del Tucumán durante el siglo XVII. Parte de estas transformaciones estaban condicionadas por la concesión de encomiendas y la creación de los pueblos de indios y nuevas instituciones, como los cabildos indígenas. Estas circunstancias limitaron el poder de las antiguas autoridades, sin embargo a lo largo del siglo XVII surgieron nuevos cargos como el de cacique gobernador y nuevas formas de legitimación que intentaban contrarrestar estos cambios.This paper attempts to analyze some changes within the ethnic leaders' authority in the jurisdiction of San Salvador de Jujuy city ( Gobernación del Tucumán during the seventeenth century. Some of these changes were influenced by the granting of encomiendas and the creation of Indians towns and new institutions such as Indian cabildos. These circumstances limited the power of ancient authorities, however during the seventeenth century new offices, such as the cacique de Gobernador, and new forms of legitimacy emerged in order to counterbalance the above-mentioned changes.

Ginsenoside Rg1 and platelet-rich fibrin enhance human breast adipose-derived stem cells function for soft tissue regeneration

Science.gov (United States)

Li, Hong-Mian; Peng, Qi-Liu; Huang, Min-Hong; Li, De-Quan; Liang, Yi-Dan; Chi, Gang-Yi; Li, De-Hui; Yu, Bing-Chao; Huang, Ji-Rong

2016-01-01

Adipose-derived stem cells (ASCs) can be used to repair soft tissue defects, wounds, burns, and scars and to regenerate various damaged tissues. The cell differentiation capacity of ASCs is crucial for engineered adipose tissue regeneration in reconstructive and plastic surgery. We previously reported that ginsenoside Rg1 (G-Rg1 or Rg1) promotes proliferation and differentiation of ASCs in vitro and in vivio. Here we show that both G-Rg1 and platelet-rich fibrin (PRF) improve the proliferation, differentiation, and soft tissue regeneration capacity of human breast adipose-derived stem cells (HBASCs) on collagen type I sponge scaffolds in vitro and in vivo. Three months after transplantation, tissue wet weight, adipocyte number, intracellular lipid, microvessel density, and gene and protein expression of VEGF, HIF-1α, and PPARγ were higher in both G-Rg1- and PRF-treated HBASCs than in control grafts. More extensive new adipose tissue formation was evident after treatment with G-Rg1 or PRF. In summary, G-Rg1 and/or PRF co-administration improves the function of HBASCs for soft tissue regeneration engineering. PMID:27191987

Las tablas, breves “diccionarios morales” en la edición de obras del XVII

Directory of Open Access Journals (Sweden)

Beatriz Gutiérrez Mueller

2015-03-01

Full Text Available A mediados del siglo XVI, se inició la costumbre de agregar un índice, más comúnmente llamado tabla, colocado por lo común al final del volumen impreso como guía de lectura y que constaba de unos pocos folios sin numeración. Para mediados del XVII, sin embargo, las tablas se fueron convirtiendo en abultados resúmenes de lo que contenía un libro y, en algunos casos, en lo que podría denominarse “breves diccionarios morales”, como en el volumen V de las Obras completas de Juan de Palafox y Mendoza, de 1665. Si bien muchas fueron escuetas, hubo casos de tablas narrativas, como la que aparece en una obra de Juan Bautista Poza [1647]. En Arte de predicar la palabra de Dios [1667], incluso, se ofrece una manera de hacerlas. En este artículo podrá apreciarse que existía un criterio editorial moralizante en las prensas españolas del Barroco, a la hora de seleccionar qué contenidos debían indizarse, sin dejar de ser las tablas, como hasta nuestros días, un lugar útil que facilita la búsqueda de un tema.

Qualitative and quantitative analysis of arsenic and mercury in human remains of the XVI-XVII centuries from the Moscow Kremlin necropolises by neutron activation analysis at the IREN facility and the IBR-2 reactor of FLNP, JINR

International Nuclear Information System (INIS)

Panova, T.D.; Dmitriev, A.Yu.; Borzakov, S.B.; Khramko, K.

2017-01-01

The neutron activation analysis (NAA) of three samples of human remains of the XVI-XVII centuries from the necropolises of the Moscow Kremlin has been carried out at FLNP JINR. The samples were irradiated at two facilities: at the IREN source of resonance neutrons and at the IBR-2 reactor. Spectra of induced activity of the irradiated samples were measured by using the automatic measurement system developed at FLNP JINR. This system consists of a high-purity germanium detector with spectrometric electronics, a sample changer, and a control software. Mass fractions of arsenic, mercury and other elements were calculated by relative and absolute NAA methods. The obtained values confirmed the fact of an acute mercury poisoning of the first wife of Tsar Ivan Vasilievich the Terrible - Tsarina Anastasia Romanovna. Increased mercury content was detected in the bone remains of the son of Tsar Ivan the Terrible, Tsarevich Ivan Ivanovich, and Prince M. V. Skopin-Shuisky. The obtained results allow us to introduce into scientific circulation the exact values of mass fraction of mercury, arsenic and some other elements in the samples from the graves of Russian historical figures of the second half of XVI - early XVII centuries. [ru

The Development of Local Self-Government in Russia in the Late XVII – First Quarter of XVIII Century

Directory of Open Access Journals (Sweden)

Bykov Aleksandr V.

2018-03-01

Full Text Available On the basis of analysis of normative-legal acts, with the involvement of Russian scientists of XIX – beginning of XX centuries and results of modern studies of the development of local self-government in the Russian Empire of the XVII – first quarter of XVIII century the article is focused on issues of regulatory-legal regulation, the ratio of state and local interests in the activities of local administration bodies, relations of the crown (appointed by the Central government, the Czar and elected bodies of local governance. The Author reveals the motivation of the central government (the Czar to the formation of a new local government system, its features, functions. The legal bases and the principles of election of officers of local authorities are also discussed. It is concluded that the attempt to introduce in Russia the local municipal city self-government on foreign models was unsuccessful. The Author expresses an opinion on the limited nature of elected bodies of local governance, the primacy of the interests of the central government in their activities.

Component analysis of cultivated ginseng, cultivated wild ginseng, and natural wild ginseng by structural parts using HPLC method

Directory of Open Access Journals (Sweden)

Young-Ju,Han

2007-02-01

Full Text Available Objectives : The aim of this experiments is to provide an objective differentiation of ginseng, Korean and Chinese cultivated wild ginseng, and natural wild ginseng through components analysis of different parts of ginseng. Methods : Comparative analyses of ginsenoside-, ginsenoside-, and ginsenosides and from the root, stem, and leaves of ginseng, Korean and Chinese cultivated wild ginseng, and natural wild ginseng were conducted using HPLC. Results : 1. For content comparison of leaves, ginseng showed highest content of ginsenoside than other samples. Natural wild ginseng showed relatively high content of ginsenosides and than other samples. 2. For content comparison of the stem, ginseng and 10 years old Chinese cultivated wild ginseng didn't contain ginsenoside . Natural wild ginseng showed higher content of ginsenosides and than other samples. 3. For content comparison of the root, ginsenoside was found only in 5 and 10 years old Korean cultivated wild ginseng. 4. Distribution of contents by the parts of ginseng was similar in ginseng and Chinese cultivated wild ginseng. Conclusions : Above experiment data can be an important indicator for the identification of ginseng, Korean and Chinese cultivated wild ginseng, and natural wild ginseng.

Alcaldes de minas, capitulares, cateadores y mineros: Una reflexión sobre las administración de la justicia en las causas mineras de la puna de Jujuy (siglo XVII)

OpenAIRE

Becerra, María Florencia; Estruch, Dolores

2011-01-01

A partir de realizar un recorrido por los conflictos jurisdiccionales que, a lo largo del siglo XVII, mantuvo la sala capitular de Jujuy con el teniente y alcalde mayor en minas del extremo septentrional de la jurisdicción jujeña (Puna de Jujuy, específicamente los actuales departamentos de Rinconada y Santa Catalina), buscamos desarrollar un doble objetivo. En primer lugar, nos proponemos analizar la dinámica que se estableció entre las prácticas concretas de los actores y la normativa que o...

The skin protective effects of compound K, a metabolite of ginsenoside Rb1 from Panax ginseng

Directory of Open Access Journals (Sweden)

Eunji Kim

2018-04-01

Full Text Available Background: Compound K (CK is a ginsenoside, a metabolite of Panax ginseng. There is interest both in increasing skin health and antiaging using natural skin care products. In this study, we explored the possibility of using CK as a cosmetic ingredient. Methods: To assess the antiaging effect of CK, RT-PCR was performed, and expression levels of matrix metalloproteinase-1, cyclooxygenase-2, and type I collagen were measured under UVB irradiation conditions. The skin hydrating effect of CK was tested by RT-PCR, and its regulation was explored through immunoblotting. Melanin content, melanin secretion, and tyrosinase activity assays were performed. Results: CK treatment reduced the production of matrix metalloproteinase-1 and cyclooxygenase-2 in UVB irradiated NIH3T3 cells and recovered type I collagen expression level. Expression of skin hydrating factors—filaggrin, transglutaminase, and hyaluronic acid synthases-1 and -2—were augmented by CK and were modulated through the inhibitor of κBα, c-Jun N-terminal kinase, or extracellular signal-regulated kinases pathway. In the melanogenic response, CK did not regulate tyrosinase activity and melanin secretion, but increased melanin content in B16F10 cells was observed. Conclusion: Our data showed that CK has antiaging and hydrating effects. We suggest that CK could be used in cosmetic products to protect the skin from UVB rays and increase skin moisture level. Keywords: compound K, melanogenesis, Panax ginseng, skin protection, UVB irradiation

Possible role of ginsenoside Rb1 in skin wound healing via regulating senescent skin dermal fibroblast.

Science.gov (United States)

Hou, Jingang; Kim, Sunchang

2018-05-05

Cellular senescence suppresses cancer by inducing irreversible cell growth arrest. Nevertheless, senescent cells is proposed as causal link with aging and aging-related pathologies. The physiological beneficial functions of senescent cells are still of paucity. Here we show that senescent human dermal fibroblast accelerates keratinocytes scratch wound healing and stimulates differentiation of fibroblast. Using oxidative stress (100 μM H 2 O 2 exposure for 1 h) induction, we successfully triggered fibroblast senescence and developed senescence associated secretory phenotype (SASP). The induction of SASP was regulated by p38MAPK/MSK2/NF-κB pathway. Interestingly, inhibition of p38MAPK activation only partially suppressed SASP. However, SASP was significantly inhibited by SB747651A, a specific MSK inhibitor. Additionally, we demonstrate that SASP stimulates migration of keratinocytes and myofibroblast transition of fibroblast, through fold-increased secretion of growth factors, platelet-derived growth factor AA (PDGF-AA) and AB (PDGF-AB), transforming growth factor beta 1 (TGF-β1) and beta 2 (TGF-β2), vascular endothelial growth factor A (VEGF-A) and D (VEGF-D), vascular endothelial growth factor receptor 2 (VEGFR2) and 3 (VEGFR3). Importantly, we also confirmed ginsenoside Rb1 promoted SASP-mediated healing process via p38MAPK/MSK2/NF-κB pathway. The results pointed to senescent fibroblast as a potential mechanism of wound healing control in human skin. Further, it provided a candidate targeted for wound therapy. Copyright © 2018 Elsevier Inc. All rights reserved.

Pharmacokinetic evaluation of Shenfu Injection in beagle dogs after intravenous drip administration

Directory of Open Access Journals (Sweden)

Yuqiao Zhang

2016-10-01

Full Text Available Shenfu Injection (SFI is a well-defined Chinese herbal formulation that is obtained from red ginseng and processed aconite root. The main active constituents in SFI are ginsenosides and aconitum alkaloids. In this work, ginsenosides (ginsenoside Rg1, ginsenoside Rb1 and ginsenoside Rc and aconitum alkaloids (benzoylmesaconine and fuziline were used as the index components to explore the pharmacokinetic behavior of SFI. A selective and sensitive HPLC–MS/MS method was developed for the quantification of ginsenosides and aconitum alkaloids in dog plasma and was used to characterize the pharmacokinetics of the five index components after intravenous drip of three different dosages of SFI in beagle dogs. The pharmacokinetic properties of the index components were linear over the dose range of 2–8 mL/kg.

El estilo "rasgueado" de la guitarra barroca y su influencia en la guitarra flamenca: fuentes escritas y musicales, siglo XVII

Directory of Open Access Journals (Sweden)

Norberto Torres Cortés

2012-01-01

Full Text Available En nuestra tesis doctoral (Torres, 2009, hemos podido observar, utilizando fuentes musicológicas, iconográficas y escritas, el paso de la guitarra popular rasgueada a la guitarra flamenca en España, y particularmente en Andalucía, desde el siglo XVI al XIX. El trabajo que proponemos a continuación se centrará en las fuentes del siglo XVII, con la popularidad de la guitarra española o rasgueada durante el Barroco, los barberos como primeros tocaores de este estilo, la guitarra rasgueada en el teatro del Siglo de Oro, el análisis de fuentes musicales italianas y francesas que dan cuenta de la popularidad del rasgueado en Europa, el estudio del repertorio rasgueado de Luis de Briceño y Gaspar Sanz, siempre desde el contraste entre fuentes musicales y escritas, para señalar los elementos que perdurarán y cristalizarán en el toque flamenco decimonónico.

A Amazônia imaginada nos memoriais enviados ao Consejo de Indias no século XVII

Directory of Open Access Journals (Sweden)

Francismar Alex Lopes de Carvalho

Full Text Available Resumo: Por todo o século XVII, colonos e missionários exploraram assiduamente as terras baixas amazônicas, localizadas a leste do vice-reinado do Peru. Nos memoriais que enviaram ao Consejo de Indias, em que solicitavam mercês, apresentaram diversas imagens dos índios, relacionando-os com ricos territórios que imaginavam existir na Amazônia, como o El Dorado e o Paititi. Este artigo propõe uma análise mais aprofundada dessas imagens, entendidas não tanto como a permanência de uma predisposição mítica, mas como uma estratégia discursiva na dura negociação por mercês, honras e privilégios que os referidos atores estabeleciam com a Coroa espanhola. Embora os memoriais permitissem ao Consejo de Indias ter notícia de regiões distantes e de como colonos e missionários atuavam nelas, a própria função política do documento influía poderosamente no tipo de imagens que apresentavam dos indígenas e das paisagens fronteiriças.

Carnaval y teatro en los siglos XVI y XVII: El Cortesano de Luis de Millán y la comedia burlesca barroca

Directory of Open Access Journals (Sweden)

Adelaida Cortijo Ocaña

2004-12-01

Full Text Available La comedia burlesca es un subgénero teatral del siglo XVII que incluye unas cincuenta piezas conocidas, que se imprimieron —sólo una media docena después del siglo XVII— bajo el nombre genérico de 'burlescas', 'de disparates', 'de chanza' y 'de chistes'. Afloran aproximadamente durante el reinado de Felipe IV y se basan en el disparate como resorte central de la risa. Pueden englobarse dentro de otras modalidades burlesco-satíricas de la literatura renacentista y barroca, como la lírica satírico-burlesca (romances, contrafacta, etc., el diálogo satírico, los vejámenes, las pullas, las fiestas de locos, las sales, etc. «Se sitúan en el extremo opuesto a la tragedia y a las formas de la comedia seria»…

Escenarios de la conflictividad: elecciones municipales en la Corona de Castilla afines del siglo XVII

Directory of Open Access Journals (Sweden)

Jesús BRAVO LOZANO

2009-12-01

Full Text Available RESUMEN: Las elecciones municipales en los pueblos de la Corona de Castilla hacen aflorar las tensiones propias de cualquier comunidad organizada. A finales del siglo XVII estas tensiones parecen agudizarse, o mostrarse por primera vez allí donde no eran patentes. Tal es el caso de Carrascosa del Campo (provincia de Cuenca. La pugna por el control del ayuntamiento y sus recursos enfrenta a dos familias, pero la realidad se encarga de redimensionar la pugna familiar convirtiéndola en una pugna política entre dos bandos, mucho más complejos que los entramados familiares. La violencia individual se recubre de política y provoca la intervención del Consejo de Castilla.ABSTRACT: Municipal elections in the villages of the Crown of Castile bring out the usual tensions of any organised community. Towards the end of the XVIIth century these tensions seem to become more acute, or else they surface for the first time in places where they had been latent. Such is the case of Carrascosa del Campo, in the province of Cuenca. Two families compete there for the control of the village council, but this dispute between families develops eventually into a political fight between factions of a complexity which goes considerably beyond that of family networks. Individual violence acquires a political colouring and provokes the intervention of the Council of Castile.

Examen de una polémica sobre los intercambios exteriores a principios del siglo XVII

Directory of Open Access Journals (Sweden)

Miguel Ángel ECHEVARRÍA BACIGALUPE

2009-12-01

Full Text Available Dentro de la profusa literatura característica de la época mercantilista, es justo rescatar del olvido los diferentes puntos de vista sustentados alrededor del comercio internacional por dos personas muy vinculadas, cada una a su manera, con esa actividad. Uno es Juan de Gauna, arbitrista inspirador de la política económica del rey de España en los albores del siglo XVII; el otro es Mateo Welser, una de las cabezas de la conocida sociedad que lleva el nombre familiar, y Tesorero del Imperio. En uno y en otro hallamos numerosos rasgos de originalidad, tantos como para dedicarles este trabajo, aunque bien es cierto que parte de sus opiniones halla fundamento en ideas que por aquel tiempo circulaban entre hombres de negocios, mercaderes, teólogos, políticos; en suma, gentes preocupadas por la «república». Pero es preciso hacer constar que si hemos escogido esta cuestión se debe a lo relativamente insólito de las proposiciones de Gauna y de Welser, dentro de una época de arbitrios muchas veces sin consistencia intelectual alguna, y de salidas a la desesperada en busca de una solución económica a la pugna entre los intereses de España y de las Provincias Unidas, apoyadas estas últimas por potencias vecinas como Inglaterra o Francia.

Ginsenoside Rg1 improves bone marrow haematopoietic activity via extramedullary haematopoiesis of the spleen.

Science.gov (United States)

Liu, Hua-Hsing; Chen, Fei-Peng; Liu, Rong-Kai; Lin, Chun-Lin; Chang, Ko-Tung

2015-11-01

Cyclophosphamide (CY) is a chemotherapeutic agent used for cancer and immunological diseases. It induces cytotoxicity of bone marrow and causes myelosuppression and extramedullary haematopoiesis (EMH) in treated patients. EMH is characterized with the emergence of multipotent haematopoietic progenitors most likely in the spleen and liver. Previous studies indicated that a Chinese medicine, ginsenoside Rg1, confers a significant effect to elevate the number of lineage (Lin(-) ) Sca-1(+) c-Kit(+) haematopoietic stem and progenitor cells (HSPCs) and restore the function of bone marrow in CY-treated myelosuppressed mice. However, whether the amelioration of bone marrow by Rg1 accompanies an alleviation of EMH in the spleen was still unknown. In our study, the cellularity and weight of the spleen were significantly reduced after Rg1 treatment in CY-treated mice. Moreover, the number of c-Kit(+) HSPCs was significantly decreased but not as a result of apoptosis, indicating that Rg1 alleviated EMH of the spleen induced by CY. Unexpectedly, the proliferation activity of c-Kit(+) HSPCs was only up-regulated in the spleen, but not in the bone marrow, after Rg1 treatment in CY-treated mice. We also found that a fraction of c-Kit(+) /CD45(+) HSPCs was simultaneously increased in the circulation after Rg1 treatment. Interestingly, the effects of Rg1 on the elevation of HSPCs in bone marrow and in the peripheral blood were suppressed in CY-treated splenectomized mice. These results demonstrated that Rg1 improves myelosuppression induced by CY through its action on the proliferation of HSPCs in EMH of the spleen and migration of HSPCs from the spleen to the bone marrow. © 2015 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

Natural product ginsenoside 25-OCH3-PPD inhibits breast cancer growth and metastasis through down-regulating MDM2.

Science.gov (United States)

Wang, Wei; Zhang, Xu; Qin, Jiang-Jiang; Voruganti, Sukesh; Nag, Subhasree Ashok; Wang, Ming-Hai; Wang, Hui; Zhang, Ruiwen

2012-01-01

Although ginseng and related herbs have a long history of utility for various health benefits, their application in cancer therapy and underlying mechanisms of action are not fully understood. Our recent work has shown that 20(S)-25-methoxyl-dammarane-3β, 12β, 20-triol (25-OCH(3)-PPD), a newly identified ginsenoside from Panax notoginseng, exerts activities against a variety of cancer cells in vitro and in vivo. This study was designed to investigate its anti-breast cancer activity and the underlying mechanisms of action. We observed that 25-OCH(3)-PPD decreased the survival of breast cancer cells by induction of apoptosis and G1 phase arrest and inhibited the growth of breast cancer xenografts in vivo. We further demonstrated that, in a dose- and time-dependent manner, 25-OCH(3)-PPD inhibited MDM2 expression at both transcriptional and post-translational levels in human breast cancer cells with various p53 statuses (wild type and mutant). Moreover, 25-OCH(3)-PPD inhibited in vitro cell migration, reduced the expression of epithelial-to-mesenchymal transition (EMT) markers, and prevented in vivo metastasis of breast cancer. In summary, 25-OCH(3)-PPD is a potential therapeutic and anti-metastatic agent for human breast cancer through down-regulating MDM2. Further preclinical and clinical development of this agent is warranted.

Pivotal Roles of Ginsenoside Rg3 in Tumor Apoptosis Through Regulation of Reactive Oxygen Species.

Science.gov (United States)

Sun, Hwa Yeon; Lee, Jun Hee; Han, Yong-Seok; Yoon, Yeo Min; Yun, Chul Won; Kim, Jae Heon; Song, Yun Seob; Lee, Sang Hun

2016-09-01

Elevated production of reactive oxygen species (ROS) is observed in various cancer types and pathophysiological conditions. In cancer cells, ROS induce cell proliferation, genetic instability, and a malignant phenotype. Ginsenoside Rg3 is the main pharmacologically active component in ginseng and has been reported to have an antioxidant effect. To overcome lung cancer by regulating the ROS level, we investigated the antitumor effect and mechanism of Rg3 and its antioxidative property on Lewis lung carcinoma (LLC) cells. Inhibition of ROS was suppressed in LLC cells by Rg3 treatment, and these cells were used to investigate the antioxidant, antiproliferative, and antitumor effects in LLC cells. ROS production was increased in cells grown in serum-containing media (conditioned media) compared to those grown in serum-free media. The high level of ROS induced LLC cell proliferation, but treatment with Rg3 (200 ng/ml) resulted in reduction of ROS, leading to inhibition of cell proliferation. Treatment with Rg3 significantly reduced cyclin and cyclin-dependent kinase expression in LLC cells. Additionally, Rg3 treatment significantly suppressed activation of mitogen-activated protein kinases and induced LLC cell apoptosis through activation of pro-apoptotic proteins and suppression of anti-apoptotic proteins. Taken together, these findings demonstrate the role of Rg3 in reduction of the intracellular ROS level, attenuation of proliferation via augmentation of cell cycle- and cell proliferation-associated proteins, and activation of apoptosis through regulation of apoptosis-associated proteins in LLC. These findings suggest that Rg3 could be used as a therapeutic agent in lung cancer. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

Ginsenoside Rh1 Improves the Effect of Dexamethasone on Autoantibodies Production and Lymphoproliferation in MRL/lpr Mice

Directory of Open Access Journals (Sweden)

Yinglu Feng

2015-01-01

Full Text Available Ginsenoside Rh1 is able to upregulate glucocorticoid receptor (GR level, suggesting Rh1 may improve glucocorticoid efficacy in hormone-dependent diseases. Therefore, we investigated whether Rh1 could enhance the effect of dexamethasone (Dex in the treatment of MRL/lpr mice. MRL/lpr mice were treated with vehicle, Dex, Rh1, or Dex + Rh1 for 4 weeks. Dex significantly reduced the proteinuria and anti-dsDNA and anti-ANA autoantibodies. The levels of proteinuria and anti-dsDNA and anti-ANA autoantibodies were further decreased in Dex + Rh1 group. Dex, Rh1, or Dex + Rh1 did not alter the proportion of CD4+ splenic lymphocytes, whereas the proportion of CD8+ splenic lymphocytes was significantly increased in Dex and Dex + Rh1 groups. Dex + Rh1 significantly decreased the ratio of CD4+/CD8+ splenic lymphocytes compared with control. Con A-induced CD4+ splenic lymphocytes proliferation was increased in Dex-treated mice and was inhibited in Dex + Rh1-treated mice. Th1 cytokine IFN-γ mRNA was suppressed and Th2 cytokine IL-4 mRNA was increased by Dex. The effect of Dex on IFN-γ and IL-4 mRNA was enhanced by Rh1. In conclusion, our data suggest that Rh1 may enhance the effect of Dex in the treatment of MRL/lpr mice through regulating CD4+ T cells activation and Th1/Th2 balance.

El oratorio de San Felipe Neri y la controversia sobre las comedias en la Valencia del siglo XVII

Directory of Open Access Journals (Sweden)

Callado Estela, Emilio

2011-06-01

Full Text Available The present article analyzes some of the religious implications deriving from the famous controversy about the legality or illegality of theatre in the 17th century and in the city of Valencia. The question arose from an episode in which Don Luis Crespi de Borja was directly implicated. Crespi was the founder of the Oratory of Saint Philip Neri in the Valencian region and a persistent fighter against comedy. As a consequence of his position in this affair members of the Oratory were pursued by other ecclesiastical sectors favouring theatre.

El presente artículo analiza algunas de la implicaciones religiosas de la famosa controversia sobre la licitud o ilicitud del teatro, en el siglo XVII y en la ciudad de Valencia, a partir de un episodio protagonizado por don Luis Crespí de Borja, fundador del Oratorio de San Felipe Neri en tierras valencianas y consumado azote de las comedias, cuyo posicionamiento en este particular valdría a los oratorianos la persecución por parte de otros sectores eclesiásticos partidarios del arte escénico.

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

Ginseng, one of the most widely used herbal medicines, has a wide range of therapeutic and pharmacological applications. Ginsenosides are the major bioactive ingredients of ginseng, which are responsible for various pharmacological activities of ginseng. Ginsenoside Rh2, known as an antitumour ginsenoside, exists as ...

Pedro Claver y la labor de evangelización en Cartagena de Indias (Siglo XVII: Fuentes claves para analizar a los africanos en el Nuevo Mundo

Directory of Open Access Journals (Sweden)

Paola Vargas Arana

2006-12-01

Full Text Available El artículo analiza el documento de canonización de Pedro Claver referido a su trabajo de evangelización de africanos en Cartagena de Indias durante el siglo XVII. El objetivo es cuestionar la labor y la utilidad del santo en la formación identitaria del puerto. En particular propone que el santo intentó hacer del cristianismo uno de los pilares de esa identidad, al punto de generar alianzas entre los sectores europeos que se hallaban en pugna por el control político y económico del puerto. Sin embargo, fracasó en la empresa de extirpar las herencias africanas recreadas como respuesta a las tentativas de evangelización de Claver.

Financial services in England in the late XVII century and first equity market boom (1691–1693

Directory of Open Access Journals (Sweden)

S.Z. Moshenskyi

2016-09-01

Full Text Available The article shows the formation of the British financial services industry in the 1690's and the reasons of the first joint-stock companies’ boom of 1691–1693's. The author describes the course of events of this boom, and data on the volume of transactions in shares. The reasons of the joint-stock boom end are associated with very low capitalization of most of the new companies. The consequence of rapid economic growth in England in the late XVII century was the appearance and rapid development of financial services. Financial intermediaries appeared first and their services, in particular the services of insurance companies, were in demand. The rapid increase in the number of insurance companies has become prerequisite for becoming financial capitalism that led to the emergence of other intermediaries which provided financial services. Among them there were the so-called "notaries" that offered a full range of services related to land transactions and "bankers, jewelers," that woke the first private bankers. Thus, in the early 1690's London had a favorable environment for the rapid growth of the financial market, which was the main precondition for expanding market shares and led to the joint-stock boom.

A New Dammarane-type Triterpene Saponin from the Root of Aralia elata

Directory of Open Access Journals (Sweden)

Wu Xiaopeng

2014-07-01

Full Text Available A new dammarane-type triterpene glycoside (1 and compounds Ginsenoside F 5 (2 , Ginsenoside F 3 (3, Ginsenoside F 2 (4 , Ginsenoside Rg 2 (5 were isolated from the root of Aralia elata Seem.. The new compound was established as 12-oxo-3β, 6α, 20 (S-trihydroxydammar-24-ene-3-O-β- D -gluco pranos yl (1→2 β- D -glucopyranoside . All the structures of the compounds were elucidated on the basis of extensive spectral and chemical evidence.

Municipio y crédito en el Aragón moderno : el endeudamiento censal del concejo darocense (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

1999-01-01

Full Text Available Este artículo analiza la situación financiera de los municipios en Aragón durante los siglos XVI y XVII a través de un ejemplo concreto: el Concejo de Daroca. El constante recurso al crédito generó un creciente endeudamiento que provocó su bancarrota durante la segunda mitad del siglo XVII. El estudio muestra la evolución de este proceso de endeudamiento y sus causas. Establece asimismo la extracción social de los acreedores del Concejo y las principales decisiones municipales sobre el tema.This paper studies the financial situation of Town Counciis in Aragón during the sixteenth and seventeenth centuries through a case study: the Daroca Town Council. Accumulating loans led to a progressive increase of debts, therefore municipal finances fell into bankrupcy during the second half of the seventeenth century. The research shows the evolution of this indebtedness process and its reasons. The paper also explores the social background of the Town CouncH's creditors and the main decisions by municipal authorities about this matter.

Alkaline Waterflooding Demonstration Project, Ranger Zone, Long Beach Unit, Wilmington Field, California. Fourth annual report, June 1979-May 1980. Volume 3. Appendices II-XVII

Energy Technology Data Exchange (ETDEWEB)

Carmichael, J.D.

1981-03-01

Volume 3 contains Appendices II through XVII: mixing instructions for sodium orthosilicate; oil displacement studies using THUMS C-331 crude oil and extracted reservoir core material from well B-110; clay mineral analysis of B-827-A cores; sieve analysis of 4 Fo sand samples from B-110-IA and 4 Fo sand samples from B-827-A; core record; delayed secondary caustic consumption tests; long-term alkaline consumption in reservoir sands; demulsification study for THUMS Long Beach Company, Island White; operating plans and instructions for DOE injection demonstration project, alkaline injection; caustic pilot-produced water test graphs; well test irregularities (6/1/79-5/31/80); alkaline flood pump changes (6/1/79-5/31/80); monthly DOE pilot chemical waterflood injection reports (preflush injection, alkaline-salt injection, and alkaline injection without salt); and caustic safety procedures-alkaline chemicals.

Immunogenic Cell Death Induced by Ginsenoside Rg3: Significance in Dendritic Cell-based Anti-tumor Immunotherapy.

Science.gov (United States)

Son, Keum-Joo; Choi, Ki Ryung; Lee, Seog Jae; Lee, Hyunah

2016-02-01

Cancer is one of the leading causes of morbidity and mortality worldwide; therefore there is a need to discover new therapeutic modules with improved efficacy and safety. Immune-(cell) therapy is a promising therapeutic strategy for the treatment of intractable cancers. The effectiveness of certain chemotherapeutics in inducing immunogenic tumor cell death thus promoting cancer eradication has been reported. Ginsenoside Rg3 is a ginseng saponin that has antitumor and immunomodulatory activity. In this study, we treated tumor cells with Rg3 to verify the significance of inducing immunogenic tumor cell death in antitumor therapy, especially in DC-based immunotherapy. Rg3 killed the both immunogenic (B16F10 melanoma cells) and non-immunogenic (LLC: Lewis Lung Carcinoma cells) tumor cells by inducing apoptosis. Surface expression of immunogenic death markers including calreticulin and heat shock proteins and the transcription of relevant genes were increased in the Rg3-dying tumor. Increased calreticulin expression was directly related to the uptake of dying tumor cells by dendritic cells (DCs): the proportion of CRT(+) CD11c(+) cells was increased in the Rg3-treated group. Interestingly, tumor cells dying by immunogenic cell death secreted IFN-γ, an effector molecule for antitumor activity in T cells. Along with the Rg3-induced suppression of pro-angiogenic (TNF-α) and immunosuppressive cytokine (TGF-β) secretion, IFN-γ production from the Rg3-treated tumor cells may also indicate Rg3 as an effective anticancer immunotherapeutic strategy. The data clearly suggests that Rg3-induced immunogenic tumor cell death due its cytotoxic effect and its ability to induce DC function. This indicates that Rg3 may be an effective immunotherapeutic strategy.

A Metabolomic Approach for the Discrimination of Red Ginseng Root Parts and Targeted Validation.

Science.gov (United States)

In, Gyo; Seo, Hyun Kyu; Park, Hee-Won; Jang, Kyoung Hwa

2017-03-15

Ginsenosides are used as existing markers of red ginseng (RG) quality, and ginsenoside ratios are also indicative of the different components of red ginseng. For the analysis and classification of ginsenoside content, red ginseng was separated into three parts, namely, main roots, lateral roots, and fine roots, and each extract was subjected to ultra-performance liquid chromatography quadruple time-of-flight mass spectrometry (UPLC-QToF-MS) with multivariate statistical analysis. Principal component analysis (PCA) showed a clear discrimination between the extracts of main roots and fine roots and suggested discrimination markers (four for the main roots and five for the fine roots). The fine root markers were identified as ginsenoside. We identified two markers for the main roots of red ginseng in this study. Moreover, the contents of 22 ginsenosides were analyzed in all three components of red ginseng. Fine roots have the highest protopanaxadiol (PPD)/protopanaxatriol (PPT) ratio. The PPD group of ginsenosides, which is quantitatively dominant in fine roots, clearly distinguishes the main roots from the other parts.

Creación divina y libertad humana en Jesuitas Novohispanos. Siglo XVII

Directory of Open Access Journals (Sweden)

Ramón Kuri Camacho

2007-12-01

Full Text Available The intention of this work is to study the novohispano seventeen century, especially those aspects related between thought and freedom, creativity and Jesuit spirituality, purification of the reason that entails the education of intelligence. The practice of the freedom and an asceticism of the subjectivity, accustoms to the idea that freedom and intelligence they overlap the one in the other, transferring them by excess of sense to the “spiritual senses”. To let itself strip of the sense origin, practice the freedom and the creativity, “transpose” an hidden sense, showing and hiding at the same time the latent sense in the manifest sense, representing not it reality that we see but the one that we do not see, the unit in the otherness, the unit in movement towards the infinite through the finite, the invisible through the visible, is the baroque enterprise of the Jesuit Company.//El propósito de este trabajo es estudiar el siglo XVII novohispano, especialmente aquellos aspectos de la relación entre pensamiento y libertad, creatividad y espiritualidad jesuitas, purificación de la razón que conlleva la educación de la inteligencia. La práctica de la libertad y una ascesis de la subjetividad, acostumbran a la idea de que libertad e inteligencia se imbrican el uno en el otro, transfiriéndolos por exceso de sentido a los “sentidos espirituales”. Dejarse desposeer del origen del sentido, practicar la libertad y la creatividad, “transponer” un sentido oculto, mostrando y ocultando al mismo tiempo el sentido latente en el sentido manifiesto, representando no la realidad que vemos sino la que no vemos, la unidad en la alteridad, la unidad en movimiento hacia lo infinito a través de lo finito, lo invisible a través de lo visible, es la empresa barroca de la Compañía de Jesús.

España y Japón en el siglo XVII: las dos embajadas de la era Keichô (1596-1615

Directory of Open Access Journals (Sweden)

Carlos Martínez Shaw

2016-10-01

Full Text Available A principios del siglo XVII, Japón envió dos embajadas a España para entablar una negociación sobre asuntos políticos, económicos y misionales. La que debe ser llamada “primera embajada de la era Keichô” ofreció a los barcos españoles una escala segura en los puertos japoneses a cambio de abrir alguno de esos puertos al comercio con la plaza novohispana de Acapulco, pero el denodado esfuerzo del franciscano Alonso Muñoz ante el Consejo de Indias no consiguió la adhesión de las autoridades hispanas. Por su parte, la que debe ser llamada “segunda embajada de la era Keichô”, que llevaba a su frente a Tsunenaga Hasekura, llegó a Sevilla cuando ya podía considerarse definitivo el fracaso de las negociaciones, pese a lo cual obtuvo en su momento una mayor visualización y hasta ahora una mayor resonancia historiográfica.

La construcción de un mito : fortuna crítica de Juan de Juanes en los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Miguel Falomir Faus

1999-01-01

Full Text Available Este artículo pretende analizar los inicios de la fortuna crítica de Juan de Juanes en los siglos XVI y XVII. La «leyenda» de Juanes se asentó en su triple condición de gloria local, pintor ejemplar y artista piadoso, y quienes la forjaron, de Escolano a Vicente Vitoria pasando por Pacheco o Jusepe Martínez, no dudaron en potenciar, e incluso distorsionar, aquellas facetas de la personalidad de Juanes afines a sus intereses particulares.This article seeks to analyze the origins of the historiographical treatment of Juan de Juanes in the sixteenth and seventeenth centuries. The «myth» of Juanes was posited on three aspects: as exemplary and illustrious citizen, model forpainters, and pious artist. Those who forged this image of the artist, from Escolano to Vicente Vitoria and passing by Pacheco or Jusepe Martínez, did not doubt in emphasizing and even distorting those aspects of his personality and life that affirmed their individual interests.

Los criados salmantinos durante el siglo XVII (1601-1650: conflictividad social y actitudes ante la muerte

Directory of Open Access Journals (Sweden)

Francisco Javier LORENZO PINAR

2011-03-01

Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} A través de la documentación de los protocolos notariales y de los litigios del Archivo Histórico Diocesano, el presente artículo trata de aproximarnos a las situaciones conflictivas en las que se vieron envueltos los criados salmantinos en la primera mitad del siglo XVII (estupros, amancebamientos, pendencias, etc. así como sus actitudes ante la muerte y las relaciones que mantuvieron con sus amos y compañeros de trabajo reflejadas a través de los testamentos.

RESEÑA de : López Villalba, José Miguel. Las finanzas de un concejo castellano: Piedrahíta, siglos xv–xvii. Estudio y documentos. Volumen XIII (1521–1522. Ávila: Ediciones de la Institución Gran Duque de Alba de la Excma. Diputación Provincial de Ávila.

Directory of Open Access Journals (Sweden)

Pedro Luis Lorenzo Cadarso

2015-06-01

Full Text Available RESEÑA de : López Villalba, José Miguel. Las finanzas de un concejo castellano: Piedrahíta, siglos xv–xvii. Estudio y documentos. Volumen XIII (1521–1522. Ávila: Ediciones de la Institución Gran Duque de Alba de la Excma. Diputación Provincial de Ávila.

Ginsenoside Rh2 Improves Cardiac Fibrosis via PPARδ–STAT3 Signaling in Type 1-Like Diabetic Rats

Directory of Open Access Journals (Sweden)

Shih-Hsiang Lo

2017-06-01

Full Text Available Ginsenoside Rh2 (Rh2 is an active principal ingredient contained in ginseng (Panax ginseng Meyer, a medicinal herb used to enhance health worldwide. The present study is designed to investigate the effect of Rh2 on myocardial fibrosis in diabetic rats. In a streptozotocin-induced model of type-1 diabetic rats (STZ-diabetic rats, the increased fasting blood glucose levels and heart weight/body weight (HW/BW ratio were substantially alleviated by Rh2. Moreover, Rh2 improved cardiac performance in STZ-diabetic rats. Histological results from Masson staining showed that Rh2 attenuated cardiac fibrosis in STZ-diabetic rats. The effects of Rh2 were reversed by GSK0660 at a dose sufficient to inhibit peroxisome proliferator-activated receptor δ (PPARδ in STZ-diabetic rats. The role of PPARδ was subsequently investigated in vitro. Rh2 restored the decreased PPARδ expression level in high glucose-cultured cardiomyocytes. Moreover, increased protein levels of fibrotic signals, including signal transducer and activator of transcription 3 (STAT3, connective tissue growth factor (CCN2 and fibronectin, were reduced by Rh2 in high glucose-cultured cardiomyocytes. These effects of Rh2 were reversed by GSK0660 or siRNA specific for PPARδ Taken together, PPARδ activation may inhibit STAT3 activation to reduce CCN2 and fibronectin expression in diabetic rats with cardiac fibrosis. Moreover, Rh2 improves cardiac function and fibrosis by increasing PPARδ signaling. Therefore, Rh2 is suitable to develop as an alternative remedy for cardiac fibrosis.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 92 ---YSSRYIGSLVGDVHRTLIYGGVFGYPGDKKNPNGKLRLLYECAPMAYLMEQAGGIAT 348 ... ... YS+RYIGSLVGD HRTL+YGG++GYP D+K+ NGKLRLLYECAPM++++EQAGG ... + Sbjct: 240 GKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSFIVEQAGGKGS 299 ...

Comparison of pharmacological effects of ginsenoside Rg1 and Rb1%人参皂甙Rg1和Rb1药理作用的比较

Institute of Scientific and Technical Information of China (English)

张均田

2000-01-01

Ginseng has long been used as a tonic and agent for prolonging life span in chinese traditional medicine． Using morden technology，ginsenoside Rgl and Rbl were proved to be main active principles of ginseng．Both conpounds showed the same effect in improving learning and memory， increasing Bmax of M-cholinergic receptors and accelerating cerebral protein and acetylcholine biosynthesis．However，Rgl but not Rbl had immunoregulatory action in aged rats and anti-osteoporosis effect in ovariectomized rats as well as enhanced basic synaptic transmission and magnitude of LTP induced by HFS． On the other hand，Rbl had anti-stress effects in antagonizing acute,chronic and repeated stress induced reduction of sexual behaviour and decrease of plasma andogen or estrogen．Rgl showed no such effect even aggravate stress induced damage．Rhl possessed anti-oxidant activity and prolong survival time of mice in cold(－10℃) condition．There was no any anti-cold effect with Rgl .These diference of biological activities between Rgl and Rbl may be arributed to their structures containing different number of glucoses．

Compound K Production from Red Ginseng Extract by β-Glycosidase from Sulfolobus solfataricus Supplemented with α-L-Arabinofuranosidase from Caldicellulosiruptor saccharolyticus.

Directory of Open Access Journals (Sweden)

Kyung-Chul Shin

Full Text Available Ginsenoside compound K (C-K is attracting a lot of interest because of its biological and pharmaceutical activities, including hepatoprotective, antitumor, anti-wrinkling, and anti-skin aging activities. C-K has been used as the principal ingredient in skin care products. For the effective application of ginseng extracts to the manufacture of cosmetics, the PPD-type ginsenosides in ginseng extracts should be converted to C-K by enzymatic conversion. For increased yield of C-K from the protopanaxadiol (PPD-type ginsenosides in red-ginseng extract (RGE, the α-L-arabinofuranoside-hydrolyzing α-L-arabinofuranosidase from Caldicellulosiruptor saccharolyticus (CS-abf was used along with the β-D-glucopyranoside/α-L-arabinopyranoside-hydrolyzing β-glycosidase from Sulfolobus solfataricus (SS-bgly because SS-bgly showed very low hydrolytic activity on the α-L-arabinofuranoside linkage in ginsenosides. The optimal reaction conditions for C-K production were as follows: pH 6.0, 80°C, 2 U/mL SS-bgly, 3 U/mL CS-abf, and 7.5 g/L PPD-type ginsenosides in RGE. Under these optimized conditions, SS-bgly supplemented with CS-abf produced 4.2 g/L C-K from 7.5 g/L PPD-type ginsenosides in 12 h without other ginsenosides, with a molar yield of 100% and a productivity of 348 mg/L/h. To the best of our knowledge, this is the highest concentration and productivity of C-K from ginseng extract ever published in literature.

Geothermal Program Review XVII: proceedings. Building on 25 years of Geothermal Partnership with Industry

Energy Technology Data Exchange (ETDEWEB)

NONE

1999-10-01

The US Department of Energy's Office (DOE) of Geothermal Technologies conducted its annual Program Review XVII in Berkeley, California, on May 18--20, 1999. The theme this year was "Building on 25 Years of Geothermal Partnership with Industry". In 1974, Congress enacted Public Law 93-410 which sanctioned the Geothermal Energy Coordination and Management Project, the Federal Government's initial partnering with the US geothermal industry. The annual program review provides a forum to foster this federal partnership with the US geothermal industry through the presentation of DOE-funded research papers from leaders in the field, speakers who are prominent in the industry, topical panel discussions and workshops, planning sessions, and the opportunity to exchange ideas. Speakers and researchers from both industry and DOE presented an annual update on research in progress, discussed changes in the environment and deregulated energy market, and exchanged ideas to refine the DOE Strategic Plan for research and development of geothermal resources in the new century. A panel discussion on Climate Change and environmental issues and regulations provided insight into the opportunities and challenges that geothermal project developers encounter. This year, a pilot peer review process was integrated with the program review. A team of geothermal industry experts were asked to evaluate the research in progress that was presented. The evaluation was based on the Government Performance and Results Act (GPRA) criteria and the goals and objectives of the Geothermal Program as set forth in the Strategic Plan. Despite the short timeframe and cursory guidance provided to both the principle investigators and the peer reviewers, the pilot process was successful. Based on post review comments by both presenters and reviewers, the process will be refined for next year's program review.

Política municipal y la producción artesana : las tejerías de Daroca (siglos XV-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

1998-01-01

Full Text Available Artículo relativo al papel desempeñado por el Concejo sobre la producción de materiales de construcción en la ciudad de Daroca durante los siglos xv, xvi y XVII. Su principal objetivo era crear las condiciones más favorables para asegurar a los habitantes de la ciudad un suministro suficiente a un precio asequible. El control público atravesará sucesivas fases de crecimiento y contracción al adaptarse a la evolución de las relaciones sociales y económicas dentro de la ciudad y a las circunstancias del momento.This paper studies the role developped by the town council for the production of building meteríais in the Aragonesa town of Daroca during the fifteenth, sixteenth and seventeenth centuries. The main goal of the town council was to créate the more favourable conditions in order to get a sufficient supply ans a reasonable price for the population. This public control will pass trough different periods of growth and decrease as a result of its adaptation to the evolution of the socio-economic relations inside the town and to the specific circunstances of each period.

Effects of Ginsenoside Rg1 on Learning and Memory in a Reward-directed Instrumental Conditioning Task in Chronic Restraint Stressed Rats.

Science.gov (United States)

Kezhu, Wang; Pan, Xu; Cong, Lu; Liming, Dong; Beiyue, Zhang; Jingwei, Lu; Yanyan, Yang; Xinmin, Liu

2017-01-01

Ginsenoside Rg1 is one of the major active ingredients of Panax ginseng and has showed notable improving learning and memory effects in several behavioral tasks, such as water maze, shuttle-box, and step-through, based on avoidance. However, there was no report about the role of Rg1 on the performance of reward-directed instrumental conditioning, which could reflect the adaptive capacity to ever-changing environments. Thus, in this study, the reward devaluation test and conditional visual discrimination task were conducted to study the ameliorating effects of Rg1 on cognitive deficits, especially the loss of adaptation capacity in chronic restraint stress (CRS) rat model. Our results showed that rat subjected to CRS became insensitive to the changes in outcome value, and it significantly harmed the rat's performance in conditional visual discrimination task. Moreover, the levels of BDNF, TrkB, and Erk phosphorylation were decreased in the prefrontal cortex of CRS rats. However, these changes were effectively reversed by Rg1 (5 and 10 mg/kg, i.p.). Therefore, it demonstrated that Rg1 has a good ability to improve learning and memory and also ameliorate impaired adaptive capacity induced by CRS. This amelioration effect of Rg1 might be mediated partially by BDNF/TrkB/Erk pathway in prefrontal cortex. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

La espiritualidad de Hipólita de Rocabertí y la construcción de su imagen en el siglo XVII

Directory of Open Access Journals (Sweden)

Alabrús Iglesias, Rosa María

2015-06-01

Full Text Available The article analyzes the objective characteristics of spirituality of Hipólita de Rocabertí expressed in his Autobiography. It contrast the religiosity of the Dominican nun with the construction of her image in the Seventeenth century: the gloss of the jesuit Jaume Puig, the biography written by Antonio de Lorea and the promotion and operation of the beatification developeds for his nephew Juan Tomás Rocabertí. There are studied the reasons of his process of unsuccessful beatification.El artículo analiza las características objetivas de la espiritualidad de Hipólita de Rocabertí, manifestadas en su Autobiografía. Se contrasta la religiosidad de la monja dominica con los esfuerzos de construcción de su imagen en el siglo XVII: la glosa del jesuita Jaume Puig, la biografía escrita por Antonio de Lorea y la operación de promoción a la beatificación que desarrolló su sobrino Juan Tomás de Rocabertí. Se estudian las causas de su proceso de beatificación fallida.

EDXRF portable system used in the analysis of altars, sculptures and paintings from XVII and XVIII centuries in Brazil

International Nuclear Information System (INIS)

Freitas, R.P.; Calza, C.; Lopes, R.T.; Santos, R.O.

2011-01-01

Full text: The preservation of cultural heritage has acquired increasing interest in the last decades and many scientific techniques have been employed to analyze paintings, manuscripts, ceramics, glasses, statues, coins and metal artifacts in order to solve problems related to restoration, conservation, dating and attribution of artworks. There is also an increasing trend for non-destructive investigations since most of the samples are unique and precious objects of art and archaeology. X-Ray fluorescence (XRF) is the most widely used investigative technique in the field of archaeometry, due to a number of favorable analytical characteristics, such as multielemental and non-destructive analysis, high sensitivity and applicability to a wide range of samples. In this work, XRF was used to analyze altars, sculptures and paintings in the Saint Anthony Convent (Rio de Janeiro, Brazil). The cornerstone of this convent was launched in 1608, by the Franciscan friars, and the construction of the church was finished in 1620. The Saint Anthony sculpture in the main altar is one of the few remaining pieces from the XVII century in Rio de Janeiro. The splendid Baroque carvings of the chapel, covered with integral gilding, in the national Portuguese style, dates from 1716 to 1719. The results obtained during the analyses have been used in the meticulous process of restoration, developed in the last two years, in order to recover the original splendour of this important piece of our cultural heritage. The analyses were carried out with an EDXRF portable system developed in the Nuclear Instrumentation Laboratory, consisting of an X-ray tube Oxford TF3005 with W anode, operating at 25 kV and 100 μA, and a Si-PIN XR-100CR detector from Amptek. In each sample were obtained several spectra, with an acquisition time of 300 s and a beam collimation of 1.5 and 2 mm. The spectra were analyzed using the software QXAS-AXIL from IAEA. The analysis of the golden carvings of the altars, in

Ginsenoside Rb1 Protects Neonatal Rat Cardiomyocytes from Hypoxia/Ischemia Induced Apoptosis and Inhibits Activation of the Mitochondrial Apoptotic Pathway

Directory of Open Access Journals (Sweden)

Xu Yan

2014-01-01

Full Text Available Aim. To investigate the effect of Ginsenoside Rb1 (GS-Rb1 on hypoxia/ischemia (H/I injury in cardiomyocytes in vitro and the mitochondrial apoptotic pathway mediated mechanism. Methods. Neonatal rat cardiomyocytes (NRCMs for the H/I groups were kept in DMEM without glucose and serum, and were placed into a hypoxic jar for 24 h. GS-Rb1 at concentrations from 2.5 to 40 µM was given during hypoxic period for 24 h. NRCMs injury was determined by MTT and lactate dehydrogenase (LDH leakage assay. Cell apoptosis, ROS accumulation, and mitochondrial membrane potential (MMP were assessed by flow cytometry. Cytosolic translocation of mitochondrial cytochrome c and Bcl-2 family proteins were determined by Western blot. Caspase-3 and caspase-9 activities were determined by the assay kit. Results. GS-Rb1 significantly reduced cell death and LDH leakage induced by H/I. It also reduced H/I induced NRCMs apoptosis induced by H/I, in accordance with a minimal reactive oxygen species (ROS burst. Moreover, GS-Rb1 markedly decreased the translocation of cytochrome c from the mitochondria to the cytosol, increased the Bcl-2/ Bax ratio, and preserved mitochondrial transmembrane potential (ΔΨm. Its administration also inhibited activities of caspase-9 and caspase-3. Conclusion. Administration of GS-Rb1 during H/I in vitro is involved in cardioprotection by inhibiting apoptosis, which may be due to inhibition of the mitochondrial apoptotic pathway.

Ginsenoside Rg1 Ameliorates Behavioral Abnormalities and Modulates the Hippocampal Proteomic Change in Triple Transgenic Mice of Alzheimer’s Disease

Directory of Open Access Journals (Sweden)

Lulin Nie

2017-01-01

Full Text Available Alzheimer’s disease (AD is one of the most common neurodegenerative diseases, so far, there are no effective measures to prevent and cure this deadly condition. Ginsenoside Rg1 (Rg1 was shown to improve behavioral abnormalities in AD; however, the potential mechanisms remain unclear. In this study, we pretreated 7-month-old 3xTg-AD mice for 6 weeks with Rg1 and evaluated the effects of Rg1 on the behaviors and the protein expression of hippocampal tissues. The behavioral tests showed that Rg1 could improve the memory impairment and ameliorate the depression-like behaviors of 3xTg-AD mice. Proteomic results revealed a total of 28 differentially expressed hippocampal proteins between Rg1-treated and nontreated 3xTg-AD mice. Among these proteins, complexin-2 (CPLX2, synapsin-2 (SYN2, and synaptosomal-associated protein 25 (SNP25 were significantly downregulated in the hippocampus of 3xTg-AD mice compared with the WT mice, and the treatment of Rg1 modulated the expression of CPLX2 and SNP25 in the hippocampus of 3xTg-AD mice. The expression of CPLX2, SYN2, and SNP25 was further validated by Western blot analysis. Taken together, we concluded that Rg1 could be a potential candidate drug to improve the behavioral deficits in AD via modulating the expression of the proteins (i.e., CPLX2, SYN2, and SNP25.

The Synergistic Effects of Heat Shock Protein 70 and Ginsenoside Rg1 against Tert-Butyl Hydroperoxide Damage Model In Vitro

Directory of Open Access Journals (Sweden)

Dan Lu

2015-01-01

Full Text Available Neural stem cells (NSCs transplanted is one of the hottest research to treat Alzheimer’s disease (AD, but cholinergic neurons from stem cells were also susceptible to cell death which Heat shock protein 70 (HSP70 was affirmed to reverse. Related to cognitive impairment, cholinergic nervous cells should be investigated and ginsenoside Rg1 (G-Rg1 was considered to increase them. We chose tert-butyl hydroperoxide (t-BHP damage model to study in vitro. Functional properties of our recombination plasmid pEGFP-C2-HSP70 were affirmed by SH-SY5Y cells. To opposite the transitory appearance of HSP70, NSCs used as the vectors of HSP70 gene overexpressed HSP70 for at least 7 days in vitro. After transfection for 3 days, G-Rg1 pretreatment for 4 hours, and coculture for 3 days, the expression of acetylcholinesterase (ChAT, synaptophysin, and the ratio of NeuN and GFAP were assessed by western blot; Morphological properties were detected by 3D reconstruction and immunofluorescence. ChAT was markedly improved in the groups contained G-Rg1. In coculture system, the ratio of neurons/astrocytes and the filaments of neurons were increased; apoptosis cells were decreased, compared to monotherapy (P<0.05. In conclusion, we demonstrated that, as a safe cotreatment affirmed in vitro, overexpression of HSP70 in NSCs plus G-Rg1 promoted nervous cells regeneration from chronic oxidative damage.

EL PAPEL Y LA MEMORIA. MEDIOS DE CONSTRUCCIÓN DE LOS PROCESOS DE IDENTIFICACIÓN LOCAL EN LOS PUEBLOS DE INDIOS DE JUJUY. SIGLO XVII

Directory of Open Access Journals (Sweden)

Gabriela Sica

2008-01-01

Full Text Available Este trabajo analiza los modos de construcción de identidades locales centradas en los pueblos de indios de la jurisdicción de San Salvador de Jujuy (Gobernación de Tucumán durante el siglo XVII. En este proceso tuvieron una activa participación los caciques y autoridades de los pueblos de indios con acciones que tendían a proteger el espacio y la supervivencia de los propios pueblos como así también las tierras comunales. Estas significaban tanto el medio de sustento económico como el espacio de la reproducción social de los integrantes de los pueblos de indios. Para asegurar la tenencia de las tierras comunales se recurría al uso de documentos escritos y rituales de posesión, que permitían la legitimación dentro de la sociedad colonial, pero estos papeles se combinaban con el uso de la memoria y la tradición oral.

Ginsenoside Rg3 enhances radiosensitization of hypoxic oesophageal cancer cell lines through vascular endothelial growth factor and hypoxia inducible factor 1α.

Science.gov (United States)

Ge, Xiaolin; Zhen, Fuxi; Yang, Baixia; Yang, Xi; Cai, Jing; Zhang, Chi; Zhang, Sheng; Cao, Yuandong; Ma, Jianxin; Cheng, Hongyan; Sun, Xinchen

2014-06-01

To determine if the pretreatment of hypoxic human oesophageal carcinoma cell lines (EC109, TE1 and KYSE170) with ginsenoside Rg3 (Rg3) increases their radiosensitivity to X-rays. The growth inhibitory effect of different Rg3 concentrations was measured using the 3-(4,5-dimethylthiazol-2-yl)-2,5- diphenyltetrazolium bromide (MTT) assay. Radiation sensitivity was measured using a clone formation assay and flow cytometry was used to measure the effects of Rg3 on radiation-induced apoptosis. Western blot analysis was used to measure the effects of Rg3 on the levels of hypoxia inducible factor (HIF)-1α and vascular endothelial growth factor (VEGF). Rg3 inhibited EC109, TE1 and KYSE170 cell growth in a dose- and time-dependent manner. Pretreatment with 10 µmol/ml Rg3 increased EC109, TE1 and KYSE170 radiosensitivity. Rg3 plus radiation significantly increased the apoptosis rate compared with radiation alone. Rg3 also decreased VEGF and HIF-1α protein levels in EC109 cells in a dose-dependent manner. The combination of Rg3 and radiation increased the fragmentation of double-stranded DNA. Rg3 enhanced the radiosensitivity of human oesophageal carcinoma cell lines cultured under hypoxic conditions possibly by downregulating VEGF and HIF-1α protein levels. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Chemical differentiation and quality evaluation of commercial Asian and American ginsengs based on a UHPLC-QTOF/MS/MS metabolomics approach.

Science.gov (United States)

Chen, Yujie; Zhao, Zhongzhen; Chen, Hubiao; Yi, Tao; Qin, Minjian; Liang, Zhitao

2015-01-01

Asian and American ginsengs are widely used medicinal materials and are being used more and more in health products. The two materials look alike but function differently. Various forms of both types of ginseng are found in the market, causing confusion for consumers in their choice. To evaluate the overall quality of commercial Asian and American ginsengs and investigate the characteristic chemical markers for differentiating between them. This article investigated 17 Asian and 21 American ginseng samples using an ultra-HPLC combined with quadrupole time-of-flight MS/MS technique. The data were processed by principal component analysis and orthogonal partial least squared discriminant analysis. In the chromatograms, a total of 40 peaks were detected. Among them, six were positively identified, and all of the remainder were tentatively identified. According to statistical results, ginsenosides Rf, Rb2 and Rc together with their isomers and derivatives were more likely to be present in Asian ginsengs, whereas ginsenoside Rb1 , pseudoginsenoside F11 and ginsenoside Rd together with their isomers and derivatives tended to be present in American ginsengs. For Asian ginsengs, ginsenoside Ra3 and 20-β-D-glucopyranosyl-ginsenoside-Rf were more likely to be present in forest samples, whereas contents of floralquinquenoside B, ginsenosides Ro and Rc, and zingibroside R1 were higher in sun-dried ginsengs. For American ginseng, wild samples often had more of the notoginsenosides R1 and Rw2 and less of the ginsenosides Rd, Rd isomer and 20 (S)-Rg3 than cultivated samples. The method provided important fingerprint information for authentication and evaluation of Asian and American ginsengs from various commercial products. Copyright © 2014 John Wiley & Sons, Ltd.

Brain Transport Profiles of Ginsenoside Rb1 by Glucose Transporter 1: In Vitro and in Vivo

Directory of Open Access Journals (Sweden)

Yu-Zhu Wang

2018-04-01

Full Text Available Ginsenoside Rb1 (Rb1 has been demonstrated its protection for central nervous system and is apparently highly distributed to the brain. The objective of this study was to characterize Rb1 transport at the blood–brain barrier (BBB using primary cultured rat brain microvascular endothelial cells (rBMEC, an in vitro BBB model. The initial uptake velocity of Rb1 in rBMEC was temperature- and concentration-dependent, and was significantly reduced by phloretin, an inhibitor of GLUT1 transporter, but was independent of metabolic inhibitor. Furthermore, the transport of Rb1 into rBMEC was significantly diminished in the presence of natural substrate α-D-glucose, suggesting a facilitated transport of Rb1 via GLUT1 transporter. The impact of GLUT1 on the distribution of Rb1 between brain and plasma was studied experimentally in rats. Administration of phloretin (5 mg/kg, i.v. to normal rats for consecutive 1 week before Rb1 (10 mg/kg, i.v. at 0.5, 2, and 6 h did not alter Rb1 concentrations in plasma, but resulted in significant decreased brain concentrations of Rb1 compared to in the phloretin-untreated normal rats (489.6 ± 58.3 versus 105.1 ± 15.1 ng/g, 193.8 ± 11.1 versus 84.8 ± 4.1 ng/g, and 114.2 ± 24.0 versus 39.9 ± 4.9 ng/g, respectively. The expression of GLUT1 in the phloretin-treated group by western blotting analysis in vitro and in vivo experiments was significantly decreased, indicating that the decreased transport of Rb1 in brain was well related to the down-regulated function and level of GLUT1. Therefore, our in vitro and in vivo results indicate that the transport of Rb1 at the BBB is at least partly mediated by GLUT1 transporter.

Reconfiguración de alianzas políticas en contextos críticos: los caciques de San Andrés de Machaca (Pacajes, Audiencia de Charcas, siglos XV-XVII

Directory of Open Access Journals (Sweden)

Ariel Jorge Morrone

2015-02-01

Full Text Available Este trabajo explora las estrategias de reconfiguración política articuladas por los líderes étnicos de San Andrés de Machaca (actual provincia Ingavi, departamento de La Paz, Bolivia, en tres contextos críticos: la invasión incaica (a mediados del siglo xv, la sistematización del orden colonial hispánico (fines del siglo xvi y el desarrollo posterior de este sistema (primera mitad del siglo xvii. Cada situación definió nuevas reglas del juego político, ante las cuales las autoridades étnicas apelaron a una variedad de prácticas: la reorganización territorial, la asignación de recursos (de consumo y de prestigio, los rituales de negociación, la memoria genealógica y el tramado de redes personales.

Minería y metalurgia en la antigua gobernación del Tucumán (siglos XVI - XVII: Colonial Tucumán 16th and 17th Centuries Minig and metallurgy

Directory of Open Access Journals (Sweden)

Geraldine Gluzman

2007-12-01

Full Text Available La actividad minera y la producción metalúrgica constituyen aspectos que jugaron papeles cruciales a lo largo del devenir histórico de las poblaciones nativas del Noroeste argentino. Por un lado, durante los tiempos prehispánicos, los objetos de metal y la producción metalúrgica acreditaron una alta valorización social. Por otro, la obtención de ganancias a partir del aprovechamiento minero se desarrolló como la actividad primordial detrás de los procesos de conquista y colonización del Nuevo Mundo durante los siglos XVI y XVII. Mientras es conocido que la extracción de metal fue uno de los principales espacios de explotación de mano de obra indígena en el Alto Perú, poco interés tuvo su análisis en el contexto de las rebeliones indígenas ocurridas en el valle Calchaquí hasta 1665. El objetivo es abordar los conflictos desplegados en esta región durante los siglos XVI y XVII tomando como eje la minería y metalurgia en la Antigua Gobernación del Tucumán.Mining activity and metallurgical production were aspects that played important roles during the history of the native Northwestern Argentine population. On the one hand, during the prehispanic times, metal objects and metallurgical production had a high social value. On the other hand, profiting from mining was the primary activity during the processes of conquest and colonization in the New World during the 16th and 17th centuries. While it is known that the extraction of metal was one of the main elements of exploitation of indigenous labor force in Alto Peru, little attention has been paid to its analysis in the context of the native rebellions in the Calchaqui valley before 1665. The objective is to study the conflicts in this area during the 16th and 17th centuries, focusing on mining and metallurgy in the Antigua Gobernación del Tucumán.

Ginsenoside Rb1 Attenuates Oxygen-Glucose Deprivation-Induced Apoptosis in SH-SY5Y Cells via Protection of Mitochondria and Inhibition of AIF and Cytochrome c Release

Directory of Open Access Journals (Sweden)

Pengfei Ge

2013-10-01

Full Text Available To investigate the role of mitochondria in the protective effects of ginsenoside Rb1 on cellular apoptosis caused by oxygen-glucose deprivation, in this study, MTT assay, TUNEL staining, flow cytometry, immunocytochemistry and western blotting were used to examine the cellular viability, apoptosis, ROS level, mitochondrial membrane potential, and the distribution of apoptosis inducing factor, cytochrome c, Bax and Bcl-2 in nucleus, mitochondria and cytoplasm. We found that pretreatment with GRb1 improved the cellular viability damaged by OGD. Moreover, GRb1 inhibited apoptosis in SH-SY5Y cells induced by OGD. Further studies showed that the elevation of cellular reactive oxygen species levels and the reduction of mitochondrial membrane potential caused by OGD were both counteracted by GRb1. Additionally, GRb1 not only suppressed the translocation of apoptosis inducing factor into nucleus and cytochrome c into cytoplasm, but also inhibited the increase of Bax within mitochondria and alleviated the decrease of mitochondrial Bcl-2. Our study indicates that the protection of GRb1 on OGD-induced apoptosis in SH-SY5Y cells is associated with its protection on mitochondrial function and inhibition of release of AIF and cytochrome c.

Religión, género y construcción de una sexualidad en los Andes (Siglos XVI y XVII. Una acercamiento provisional

Directory of Open Access Journals (Sweden)

Armas Asin, Fernando

2001-12-01

Full Text Available This study emphasizes the conceptual changes in regard to sex, sexuality and general genre relations in the Andes, in the 16th and 17th centuries, in the context of the establishment of the colonial society. It is analyzed the way in which a new discourse on the body was developed as a consequence of the deeply represive baroque culture. This culture recreated religious values which controlled every aspect of the daily life. It also enforced a rigid legislation which ruled through society as a whole.

El estudio busca enfatizar los cambios conceptuales que se produjeron en torno al sexo, la sexualidad, y, en términos generales, en las relaciones de género en los Andes en los siglos XVI y XVII, en un contexto de establecimiento de la sociedad colonial. Se analiza cómo se construyó un nuevo discurso sobre el cuerpo en los Andes como consecuencia de la cultura barroca, profundamente represiva. Dicha cultura recreó valores religiosos que controlaban todos los aspectos de la vida diaria, además de poner en marcha una legislación muy rígida que reguló toda la sociedad.

Microanálise de longa duração em demografia urbana: Santa Maria de Torres Vedras entre os séculos XVII e XX» [em linha]. In: X Congresso da Associação de Demografia Histórica

OpenAIRE

Silva, Carlos Guardado da; Amorim, Maria Norberta; Silva, Paula Correia da

2013-01-01

Com objetivo de pontuar o país, no projeto Espaços Urbanos. Dinâmicas demográficas e sociais (séculos XVII a XX), coordenado por Carlota Santos, partindo-se de uma investigação já em curso sobre cidades do Norte de Portugal e nas Ilhas, optou-se pela incidência sobre uma cidade do Centro, Torres Vedras. No que respeita a Torres Vedras, gerou-se uma oportunidade de convergência de interesses entre investigadores e autarquia, iniciando-se um ambicioso projeto de reconstituição integrada das ...

Alteraciones del paisaje ecológico araucano por la asimilación mapuche de la agroganadería hispano-mediterránea (siglos XVI y XVII Araucanian ecological landscape disturbances by the mapuche assimilation of the Hispanic-Mediterranean farming (16th and 17th centuries

Directory of Open Access Journals (Sweden)

FERNANDO TORREJÓN

2002-12-01

Full Text Available Las características biogeográficas de la América templada favorecieron la introducción y propagación de especies animales y vegetales que sustentaron al modelo agroganadero hispano-mediterráneo. Los efectos de este fenómeno generaron alteraciones ecológicas, especialmente en los territorios habitados por aborígenes carentes de actividades productivas intensivas, como fue el caso de la Araucanía. Mediante un análisis histórico documental, la presente investigación reconoció las principales características del proceso de alteración del paisaje ecológico araucano entre los siglos XVI y XVII: (i en el siglo XVI, la introducción de especies exóticas desarticuló el sistema económico mapuche, (ii tanto la relativa pristinidad de la Araucanía como el proceso bélico de los siglos XVI y XVII, favorecieron la introducción y propagación de las nuevas especies, (iii durante el siglo XVI coexistieron especies nativas e introducidas, sin embargo, durante el siglo XVII preponderaron las exóticas, y (iv este predominio habría generado la extinción local de especies animales y vegetales nativas, alterando definitivamente el paisaje ecológico araucanoThe bio-geographic characteristics of the temperate America favored the introduction and spreading of exotic plant and animal species that supported the Hispanic-Mediterranean farming model. The effects of this situation produced ecological alterations on the territories inhabited by Indians without intense productive systems; as the Araucanía case. Through a historical and documental analysis this paper reports the main characteristics of the Araucanian ecological landscape disruption process during the 16th and 17th centuries: (i during the 16th century, the introduction of exotic species dislocated the Mapuche economic system, (ii both the relative Araucanía pristine conditions and the warlike process, occurred between the 16th and 17th centuries, favored the introduction and

Caminos, poblamiento y ganado entre la Nueva España y el Nuevo Reino de León: siglos XVII y XVIII

Directory of Open Access Journals (Sweden)

Ana Gabriela Arreola Meneses

2016-06-01

Full Text Available En el presente artículo se expone la importancia de los caminos ganaderos entre el Nuevo Reino de León y la Nueva España a partir de tres momentos, en el primero, se aborda la apertura de caminos como parte de un proceso más amplio como lo fue el poblamiento del sur del Nuevo Reino de León en el siglo XVII; posteriormente, veremos el acondicionamiento de los caminos con fines económicos para movilizar grandes hatos de ganado menor desde y hacia la Nueva España, en este apartado no sólo aborda lo espacial, también se integran aspectos sociales sobre los sujetos que transitaban los caminos y su  interacción con el contexto del Noreste novohispano; finalmente se concluye con la presencia de las haciendas ganaderas del Fondo Piadoso de las Californias y la consecuente re-conformación de la dinámica trashumante donde los caminos hacia el sur del Nuevo Reino de León se incorporaron a un sistema espacial más amplio y especifico que lo unía con las haciendas de trasquila y matanza que pertenecían a los jesuitas.

Las familias indígenas de Santafé, Nuevo Reino de Granada, según los testamentos de los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Sandra Turbay Ceballos

2012-01-01

Full Text Available El análisis de 89 testamentos indígenas de Santafé, capital del Nuevo Reino de Granada, de los siglos XVI y XVII, da cuenta de las transformaciones de la familia muisca en la ciudad colonial. Desapareció la poliginia y el precio de la novia, y se legitimó el matrimonio a través del sacramento católico; se instauró la costumbre de la dote mediterránea y los hijos empezaron a heredar los bienes de su padre. Sin embargo, los testamentos demuestran la persistencia de algunos rasgos matrilineales en los legados que los hombres dejaban a los hijos de sus hermanas y en la sucesión de los cacicazgos. La migración masiva de indígenas a la nueva ciudad promovió el mestizaje y la reconfiguración de las familias indígenas que acogieron en su seno a huérfanos de diferente condición. Algunas mujeres alcanzaron posiciones inéditas y recurrieron a la Real Audiencia para defender los derechos que creían conculcados por sus maridos indígenas o por los padres españoles de sus hijos.

Los soportes textiles de pintura de caballete en México, siglos XVII-XIX. Aportaciones históricas tras su restauración

Directory of Open Access Journals (Sweden)

Rita Sumano González

2012-12-01

Full Text Available El presente artículo aborda la forma en que ciertos lienzos textiles fueron usados como soportes de pintura de caballete en México durante los siglos XVII al XIX. Se llevó a cabo un estudio usando como fuente primaria doscientos informes de trabajo de pinturas que habían sido restauradas por el Seminario Taller de Restauración de Pintura de Caballete de la Escuela Nacional de Conservación, Restauración y Museografía en México (STRPC-ENCRyM-INAH. Los registros de técnica de factura de los soportes se organizaron de acuerdo a una ficha de análisis textil y se vertieron en una base de datos, para después interpretarlos utilizando estadística descriptiva. Los resultados del análisis estadístico orientaron la investigación histórica, que se sirvió de fuentes vivas, materiales, bibliográficas y documentales. De esta investigación se desprendieron datos relevantes sobre la forma en que los lienzos fueron usados como soportes de pintura de caballete lo que puede contribuir a su estudio y a una mejor conservación de las pinturas.

El patronato de la nación flamenca gaditana en los siglos XVII y XVIII: trasfondo social y económico de una institución piadosa

Directory of Open Access Journals (Sweden)

Ana CRESPO SOLANA

2009-12-01

Full Text Available RESUMEN: En este artículo se analiza el desarrollo, durante más de un siglo, de una faceta poco conocida de las comunidades mercantiles extranjeras residentes en las ciudades españolas durante la edad moderna. Con documentos, en su mayor parte inéditos, referentes a la que se denominó «Ilustre y Antigua Nación Flamenca de Sevilla y Cádiz», hemos intentado realizar una descripción de las actividades de tipo asistenciales llevadas a cabo por la cofradía de mercaderes formada por comerciantes originarios de los Países Bajos, tanto meridionales como de la misma República Holandesa, que residieron en Sevilla y, especialmente, en Cádiz. Esta comunidad tenía adscrito a la fundación de su cofradía la administración de un patronato que comprendía, a su vez, el control sobre numerosos bienes muebles e inmuebles de gran valor. Así, la descripción de esta actividad religiosa y piadosa, con marcados tintes gremiales, nos aporta una visión no menos interesante, en comparación con la puramente económica, de la importancia que tenía la integración de estas comunidades en la sociedad española de los siglos XVII y XVIII.ABSTRACT: In this article we offer information on the development, along the centuries, of a not very well-known facet of the foreign merchants communities settled in the Spanish cities during the Modern Age. With not-published documents, relating to the one denominated «Ilustre y Antigua Nación Flamenca» of Seville and Cádiz, we have tried to carry out a description of the beneficent activities carried out by the colony of merchants formed by natives of the Southern Low Countries and of the Dutch Republic, in Seville and, especially, in Cádiz. This community had attributed to the foundation of its brotherhood the administration of a «Patronato» that included the control of numerous furniture and properties of great value. This way, the description of this religious and compassionate activity not contributes us a

Ginseng pharmacology: a new paradigm based on gintonin-lysophosphatidic acid receptor interactions

Directory of Open Access Journals (Sweden)

Seung-Yeol eNah

2015-10-01

Full Text Available Ginseng, the root of Panax ginseng, is used as a traditional medicine. Despite the long history of the use of ginseng, there is no specific scientific or clinical rationale for ginseng pharmacology besides its application as a general tonic. The ambiguous description of ginseng pharmacology might be due to the absence of a predominant active ingredient that represents ginseng pharmacology. Recent studies show that ginseng abundantly contains lysophosphatidic acids (LPAs, which are phospholipid-derived growth factor with diverse biological functions including those claimed to be exhibited by ginseng. LPAs in ginseng form a complex with ginseng proteins, which can bind and deliver LPA to its cognate receptors with a high affinity. As a first messenger, gintonin produces second messenger Ca2+ via G protein-coupled LPA receptors. Ca2+ is an intracellular mediator of gintonin and initiates a cascade of amplifications for further intercellular communications by activation of Ca2+-dependent kinases, receptors, gliotransmitter and neurotransmitter release. Ginsenosides, which have been regarded as primary ingredients of ginseng, cannot elicit intracellular [Ca2+]i transients, since they lack specific cell surface receptor. However, ginsenosides exhibit non-specific ion channel and receptor regulations. This is the key characteristic that distinguishes gintonin from ginsenosides. Although the current discourse on ginseng pharmacology is focused on ginsenosides, gintonin can definitely provide a mode of action for ginseng pharmacology that ginsenosides cannot. This review article introduces a novel concept of ginseng ligand-LPA receptor interaction and proposes to establish a paradigm that shifts the focus from ginsenosides to gintonin as a major ingredient representing ginseng pharmacology.

Ginsenoside Compound K suppresses the hepatic gluconeogenesis via activating adenosine-5'monophosphate kinase: A study in vitro and in vivo.

Science.gov (United States)

Wei, Shengnan; Li, Wei; Yu, Yang; Yao, Fan; A, Lixiang; Lan, Xiaoxin; Guan, Fengying; Zhang, Ming; Chen, Li

2015-10-15

Compound K (CK) is a final intestinal metabolite of protopanaxadiol-type ginsenoside. We have reported that CK presented anti-diabetic effect via diminishing the expressions of hepatic gluconeogenesis key enzyme. Here, we further explore the possible mechanism of CK on suppression hepatic gluconeogenesis via activation of adenosine-5'monophosphate kinase (AMPK) on type 2 diabetes mice in vivo and in HepG2 cells. Type 2 diabetes mice model was developed by high fat diet combined with STZ injection. 30mg/kg/d CK was orally administrated for 4weeks, the fasting blood glucose level and 2h OGTT were conducted, and the protein expression of AMPK, peroxisome proliferator-activated receptor-γ coactivator-1α (PGC-1α), Phosphoenolpyruvate carboxykinase (PEPCK) and Glucose-6-phosphatase (G6Pase) were examined. The mechanism of Compound K on hepatic gluconeogenesis was further explored in HepG2 hepatocytes. Glucose production, the protein expression of AMPK, PEPCK, G6pase and PGC-1α, hepatic nuclear factor 4α (HNF-4α) and forkhead transcription factor O1 (FOXO1) were determined after Compound K treatment at the presence of AMPK inhibitor Compound C. We observed that CK inhibited the expression of PEPCK and G6Pase in the liver and in HepG2 hepatocytes. Meanwhile, CK treatment remarkably increased the activation of AMPK, while decreasing the expressions of PGC-1α, HNF-4α and FOXO1. However, AMPK inhibitor Compound C could reverse these effects of CK on gluconeogenesis in part. The results indicated that the effect of CK on suppression hepatic gluconeogenesis might be via the activation the AMPK activity. Copyright © 2015. Published by Elsevier Inc.

Ginsenoside 25-OCH3-PPD promotes activity of LXRs to ameliorate P2X7R-mediated NLRP3 inflammasome in the development of hepatic fibrosis.

Science.gov (United States)

Han, Xin; Song, Jian; Lian, Li-Hua; Yao, You-Li; Shao, Dan-Yang; Fan, Ying; Hou, Li-Shuang; Wang, Ge; Zheng, Shuang; Wu, Yan-Ling; Nan, Ji-Xing

2018-06-22

Ginseng is widely used in energy drinks, dietary supplements and herbal medicines, and its pharmacological actions are related with energy metabolism. As an important modulating energy metabolism pathway, liver X receptors (LXRs) can promote the resolving of hepatic fibrosis and inflammation. The present study aims to evaluate the regulation of 25-OCH3-PPD, a ginsenoside isolated from Panax ginseng, against hepatic fibrosis and inflammation in thioacetamide (TAA)-stimulated mice by activating LXRs pathway. 25-OCH3-PPD decreases serum ALT/AST levels and improves the histological pathology of liver in TAA-induced mice; attenuates transcripts of pro-fibrogenic markers associated with hepatic stellate cell activation; attenuates the levels of pro-Inflammatory cytokines and blocks apoptosis happened in liver; inhibits NLRP3 inflammasome by affecting P2X7R activation; regulates PI3K/Akt and LKB1/AMPK-SIRT1. 25-OCH3-PPD also facilitates LX25Rs and FXR activities decreased by TAA stimulation. 25-OCH3-PPD also decreases α-SMA via regulation of LXRs and P2X7R-NLRP3 in vitro. Our data suggest the possibility that 25-OCH3-PPD promotes activity of LXRs to ameliorate P2X7R-mediated NLRP3 inflammasome in the development of hepatic fibrosis.

[Балтийский вопрос в конце XVI-XVII вв. Сборник научных статей] / Andres Adamson

Index Scriptorium Estoniae

Adamson, Andres, 1964-

2011-01-01

Arvustus: Балтийский вопрос в конце XVI-XVII вв. Сборник научных статей / Hrsg. von Александр Филюшкин (Москва : Квардига, 2010)

Himalayan Vultures in Khodpe, far-west Nepal: is there any threat?

Directory of Open Access Journals (Sweden)

Manoj Kumar Joshi

2015-11-01

Full Text Available There is evidence that Himalayan Vulture Gyps himalayensis is susceptible to the veterinary drug diclofenac, which is responsible for the decline of other Gyps species across South Asia.  Unlike other Gyps species, there is little quantitative data to assess Himalayan Vultures population.  Based on observation, we analyzed the flock size and breeding success of the Himalayan Vultures on two cliffs of Khodpe in Baitadi District, far-west Nepal.  The mean flock size of Himalayan Vulture was 25.83±6.33.  Overall breeding success was 90.9% based on active nests.  We also conducted a questionnaire survey to assess the perceived threats in the view of local people to vultures and these threats include loss of food, veterinary drug, lack of proper nest sites, and lack of public awareness.  Additionally, 76% of the respondents felt that vultures were decreasing in the area, 94.7% were not aware of the toxicity of diclofenac to vultures, and very few (2% knew about the availability of meloxicam as a safe alternative drug.  The colony we studied is one of the few remaining known breeding populations, which provide baseline information from far-west Nepal, thus we recommend for conservation and continuous monitoring of this species to understand their population change and breeding biology. 

La Radiología en la Pintura Santafereña del Siglo XVII

Directory of Open Access Journals (Sweden)

Hernando Morales

1979-10-01

Full Text Available

Gregorio Vázquez de Arce y Ceballos, considerado como el más grande pintor que produjera América en el siglo XVII y sus obras como las más representativas de la América Virreinal, comparte con los Echaves de México y con -Miguel de Santiago del Ecuador el privilegio de haber legado a la posteridad una imagen del acaecer colonial, una crónica religiosa y un testimonio conmovedor del nacimiento de una raza, documentos que constituyen una de las bases históricas de nuestra cultura.

Innumerables han sido los estudios publicados sobre tan insigne pintor, y si nos atrevemos a mostrar una nueva faceta de tan compleja personalidad, es por la discutible autoridad que nos confiere el haber trabajado con pinturas coloniales americanas durante varios
años, y por el respaldo y apoyo que nos prestó el Profesor Francisco Gil Tovar, Director del Museo de Arte Colonial, profundo conocedor del tema, quien permitió el estudio, fotografía y radiografía de toda la colección del Museo de Arte Colonial de Bogotá, material sobre el cual basamos nuestro estudio. También incluímos algunas obras de colecciones privadas
facilitadas por sus dueños.

La producción pictórica de Gregorio Vázquez y la de su taller en Bogotá fue enorme, y más grande aún la influencia que ejerció sobre casi dos siglos de pintura neogranadina. Considerado "El Maestro" fue imitado y copiado; y aún en su taller se ejecutaron obras
con poco o mucho de su mano que se distribuyeron ampliamente y que hoy llevan el interrogante de la autenticidad de muchas telas.

Material y Método
Son muchos los estudios que pueden practicarse en una pintura colonial americana. Casi siempre en lo que toca con su procedencia, antigüedad, estado de conservación, posibles retoques y, naturalmente, su calidad artística. Son muchos los datos que proporcionan
la tela, los pigmentos, la distribución de color, la composición, el

Un manual español de administración y contabilidad señorial de principios de siglo XVII: el compendio en materia de acrecentar Estado y hazienda, tocante al oficio de contador, de Gabriel Pérez del Barrio Angulo

OpenAIRE

José María González Ferrando

2013-01-01

Frente a lo ocurrido en Inglaterra, donde cuentan con manuscritos sobre administración y contabilidad señorial desde el siglo XIII, en España sólo se conocen hasta ahora cuatro textos de los siglos XV al XVII en que sus autores se ocupan con mayor o menor detalle de este asunto, pero de los que sólo uno, publicado inicialmente en 1613, puede equipararse en cierto modo a los ingleses: el ‘Compendio en razón de acrecentar Estado y Hacienda y Oficio de Contador’ de Gabriel Pérez del Barrio. E...

Non-antibiotic agent ginsenoside 20(S)-Rh2 enhanced the antibacterial effects of ciprofloxacin in vitro and in vivo as a potential NorA inhibitor.

Science.gov (United States)

Zhang, Jingwei; Sun, Yuan; Wang, Yaoyao; Lu, Meng; He, Jichao; Liu, Jiali; Chen, Qianying; Zhang, Xiaoxuan; Zhou, Fang; Wang, Guangji; Sun, Xianqiang

2014-10-05

The aim of this study is to explore the potential enhancing effect of ginsenoside 20(S)-Rh2 (Rh2) towards ciprofloxacin (CIP) against Staphylococcus aureus (S. aureus) infection in vitro and in vivo, and analyze the possible mechanisms through NorA inhibition from a target cellular pharmacokinetic view. In combination with non-toxic dosage of Rh2, the susceptibilities of S. aureus strains to CIP were significantly augmented, and the antibacterial kinetics of CIP in the S. aureus strains were markedly promoted. This enhancing effect of Rh2 towards CIP was also observed in S. aureus infected peritonitis mice, with elevated survival rate and reduced bacteria counts in blood. However, Rh2 did not influence the plasma concentrations of CIP. Further analysis indicated that Rh2 significantly promoted the accumulations of CIP in S. aureus, and inhibited the NorA mediated efflux of pyronin Y. The expressions of NorA gene on S. aureus were positively correlated with the enhancing effect of Rh2 with CIP. This is the first report of the enhancing effect of Rh2 with CIP for S. aureus infection in vitro and in vivo, of which it is probably that Rh2 inhibited NorA-mediated efflux and promoted the accumulation of CIP in the bacteria. Copyright © 2014 Elsevier B.V. All rights reserved.

Painters in the Splendor of Tunja: Naming Unrecognized Artists to Bring them out of Anonymity (XVI and XVII centuries

Directory of Open Access Journals (Sweden)

Laura Liliana Vargas Murcia

2017-07-01

Full Text Available Tunja has stood out as one of the riches cities of New Kingdom of Granada, regarding the presence of painting in the last decades of the XVI century and the first half of the XVIIth. Its painters were of importance not only in this city but in the rest of the Province as well, with the churches and museums of Boyacá containing images that were essential elements in the indoctrination of indigenous communities. Civil mural works of art in Tunja have been an object of study mostly for their interpretation, and less regarding the identities of their makers. As far as easel painting, Angelino Medoro eclipsed the names of other artists who contributed to making Tunja one the the most representative cities of the Mannerism and Renaissance of Hispanic America. This article presents the names of some of the active painters of this period, their lives and production, seeking the recognition of these characters, whose names have been brought out of anonymity in the latest years. The starting point for the information search was the research of Magdalena Corradine Mora on the inhabitants of Tunja in the first decades of the XVII century, and the search for information in the Boyacá Regional Historical Archive. In calling attention upon these artists, we hope that, in the future, the identification of their works may be initiated as well as the research, conservation and dissemination of these works, due to the fact that this heritage is not always in ideal conditions, nor is it perceived and valued as is deserved.

Pola makan dan kebugaran jasmani atlet pencak silat selama pelatihan daerah Pekan Olahraga Nasional XVII Provinsi Bali tahun 2008

Directory of Open Access Journals (Sweden)

Putu Ayu Widiastuti

2009-07-01

Full Text Available Background : The fulfillment of nutrient intake is a basic need of athletes. The result of observation to some athletes with varied branches of sport indicates that nutrition and physical exercise will simultaneously bring better output. Presently, attention to the administration of nutrition for athletes is lacking, moreover at local level. Meanwhile, providing good nutrition is as important as maintaining sports achievement. Objective : The study aimed to identify support of eating pattern to physical exercise of Bali self-defence athletes during local training of National Sports Week XVII Province of Bali. Method : This was a descriptive analytical study which used qualitative and quantitave approaches and cross sectional design. Subjects of the study were all of 26 self defence athletes participating in local training at National Sports Week Province of Bali. Data gathered were eating pattern, physical fitness (VO2 max and body fat percent, and physiological condition (hemoglobin level. Support of eating pattern to physical exercise was measured in terms of physical fitness using regression and correlation analysis.  Result : Most of nutrient intakes of Bali self-defences athletes were low in carbohydrate but high in fat and protein. Statistical analysis showed that there were correlation and effect of vitamin C and Fe intake to VO2 max. There were correlation and effect of carbohydrate to body fat percent. There was protein affected hemoglobin level.  Conclusion : Adequate consumption of nutrients was needed to support athletes in doing physical exercise during training period.

Las relaciones de visitas «ad limina» de los obispos de Osma en los siglos XVI-XVII

Directory of Open Access Journals (Sweden)

Gonzalo Millán, David

2002-12-01

Full Text Available Review, analysis and study of the «relationes» or reports presented to the Sacred Congregation Council, by the bishops of Osma, owing to the visits «ad limina » that they carried out in the last years of the sixteenth century and thruoghout the seventeenth century. There are twelve relations in all, which correspond to the bishops, Pedro de Rojas (1595, Friar Enrique Enríquez (1607, Cristóbal de Lobera (1619, Friar Domingo Pimentel (1635, Martin Carrillo y Alderete (1637, Antonio Valdés (1644, 1647, 1649 and Friar Sebastián de Arévalo y Torres (1686, 1690, 1695, 1700. At the end the texts of said relations are offered transcribed in acordance with the documents kept in the Vatican Archives.

Reseña, análisis y estudio de las 'relationes' o informes presentados a la Sagrada Congregación del Concilio, por los obispos de Osma, con motivo de las visitas «ad limina» que realizaron en los últimos años del siglo XVI y durante todo el siglo XVII Son en total doce relaciones que corresponden a los obispos, D. Pedro de Rojas (1595, Fr. Enrique Enríquez (1607, D. Cristóbal de Lobera (1619, Fr. Domingo Pimentel (1635, D. Martín Carrillo y Alderete (1637, D. Antonio Valdés (1644, 1647, 1649 y Fr. Sebastián de Arévalo y Torres (1686, 1690, 1695, 1700. Al final se ofrecen transcritos los textos de dichas relaciones conforme a los documentos conservados en el Archivo Vaticano.

Uma Estranha Diáspora Rumo a Portugal: Judeus e Cristãos-Novos Reduzidos à Fé Católica no século XVII

Directory of Open Access Journals (Sweden)

Braga, Isabel M. R. Mendes Drumond

2002-12-01

Full Text Available The present paper deals with a number of Jewish and new Christian people, descendants of Peninsular Jews, who arrived in Portugal in the 16^th century and consequently converted to Catholicism. The source material used in this study are the Books of Converted Jews that belonged to the Holy Office of Inquisition. These books provide information on the nature of the people (age, status, birthplace, place of residence, the way they experienced their religion in different parts of Europe, and the true or apparently true reasons for their conversion.

Este artículo aborda el tema de algunos judíos y cristianos nuevos descendientes de judíos peninsulares que, en el siglo XVII, llegaron a Portugal y se convirtieron al catolicismo. Las fuentes para este estudio son los libros de convertidos del Santo Oficio de la Inquisición. Éstos nos proporcionan datos acerca de las personas (edad, estado civil, lugar de nacimiento y de residencia y, especialmente, sobre la vivencia del judaísmo en diferentes partes de Europa, así como sobre las motivaciones, reales o aparentes, para la conversión.

La performance teatral de las máquinas maravillosas. Configuraciones ambivalentes de la técnica y el teatro en los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Sabine Friedrich

2015-12-01

Full Text Available El artículo explora las formas de representación y a la dimensión epistemológica de la máquina en el campo discursivo de los siglos XVI y XVII, cuando todavía no existe una diferencia fundamental entre los discursos científicos, paracientíficos, filosóficos y estéticos. A partir de las investigaciones de Jan Lazardzig, analiza el carácter paradójico de la ingeniería mecánica entre la funcionalidad y la admiración, la racionalidad y lo maravilloso dentro del contexto español en el Siglo de Oro. En este sentido, el artículo examina las formas de performance teatral de la máquina como objeto admirable y maravilloso: por un lado en el teatro de máquinas cortesano y por el otro en los libros de máquinas en la tradición del Theatrum machinarum. Analizamos así los paralelismos y las diferencias respecto a sus estructuras, sus modos de representación y sus dimensiones pragmáticas.

Como güelfos y gibelinos: los colegios de San Bernardo y San Antonio Abad en el Cuzco durante el siglo XVII

Directory of Open Access Journals (Sweden)

Guibovich Pérez, Pedro M

2006-04-01

Full Text Available This article deals with the conflicts that involved the San Bernardo and San Antonio schools all along the seventeenth century. The author proposes a new approach to explain the social history of colonial Cuzco. He mantains that the root of the confrontation has to do with the privileges that enjoy the jesuits in the provision of academical degrees, a basic requirement to obtain appointments in the civil and eclesiastical administration. To understand this social dinamic, he reconstructs the institutional history of both schools, and reveals the interests that defend the main actors of this secular conflict.

Los conflictos que enfrentaron a los colegios de San Bernardo y San Antonio Abad a lo largo del siglo XVII es el tema central de estudio de este ensayo. El autor propone una nueva lectura a este episodio de la historia social del Cuzco colonial. Sostiene que en la raíz de los enfrentamientos estuvo el privilegio que gozaban los jesuitas para la concesión de grados académicos, requisitos fundamentales para obtener cargos en la administración civil y eclesiástica. Para entender la dinámica social, el autor reconstruye la historia institucional de los colegios y los intereses en juego de los principales protagonistas del secular conflicto.

Neuroprotective Effect of the Ginsenoside Rg1 on Cerebral Ischemic Injury In Vivo and In Vitro Is Mediated by PPARγ-Regulated Antioxidative and Anti-Inflammatory Pathways

Directory of Open Access Journals (Sweden)

Yang Li

2017-01-01

Full Text Available The ginsenoside Rg1 exerts a neuroprotective effect during cerebral ischemia/reperfusion injury. Rg1 has been previously reported to improve PPARγ expression and signaling, consequently enhancing its regulatory processes. Due to PPARγ’s role in the suppression of oxidative stress and inflammation, Rg1’s PPARγ-normalizing capacity may play a role in the observed neuroprotective action of Rg1 during ischemic brain injury. We utilized a middle cerebral artery ischemia/reperfusion injury model in rats in addition to an oxygen glucose deprivation model in cortical neurons to elucidate the mechanisms underlying the neuroprotective effects of Rg1. We found that Rg1 significantly increased PPARγ expression and reduced multiple indicators of oxidative stress and inflammation. Ultimately, Rg1 treatment improved neurological function and diminished brain edema, indicating that Rg1 may exert its neuroprotective action on cerebral ischemia/reperfusion injury through the activation of PPARγ signaling. In addition, the present findings suggested that Rg1 was a potent PPARγ agonist in that it upregulated PPARγ expression and was inhibited by GW9662, a selective PPARγ antagonist. These findings expand our previous understanding of the molecular basis of the therapeutic action of Rg1 in cerebral ischemic injury, laying the ground work for expanded study and clinical optimization of the compound.

Círculos sociales, contextos normativos y crédito: Buenos Aires, siglo XVII Social Circles, Normative Frameworks and Credit: Buenos Aires, 17th Century

Directory of Open Access Journals (Sweden)

Martín L. E. Wasserman

2013-04-01

Full Text Available El presente artículo se propone indagar en los órdenes normativos, círculos de sociabilidad y dispositivos institucionales a los cuales los actores apelaban para interactuar económica y comercialmente en Buenos Aires durante la primera mitad del siglo XVII. Recurriendo al endeudamiento interpersonal como observatorio, se avanzará en la comprensión de la práctica consistente en formalizar legalmente, ante el escribano, las obligaciones derivadas de las deudas. Mediante este abordaje se intentará indagar en el peso que las redes de parentesco detentaron como uno de los órdenes normativos e institucionales posibles para la interacción económica del temprano Río de la Plata.This article aims to investigate the normative orders, sociability circles and institutional arrangements that actors used for their economic and commercial interaction during the first half of the 17th century in Buenos Aires. By studying interpersonal borrowing as observatory, we will advance in understanding the practice of registering the debts with the notary. Through this approach we will try to investigate the actual weight of the interpersonal networks as one of the institutional and normative contexts available for economic interaction in the early Rio de la Plata.

História e romance: a idéia de história em As aventuras de Telêmaco e as relações entre o texto histórico e a prosa ficcional na passagem dos séculos XVII-XVIII - History and romance: the concept of history in As aventuras de Telêmaco and thye relationshi

Directory of Open Access Journals (Sweden)

João Paulo Martins

2011-04-01

Full Text Available Resumo O romance moderno emerge na passagem do século XVII para o XVIII, tornando-se nesse último um gênero literário que cai no gosto dos leitores. Esse texto pretende analisar as relações entre a prosa ficcional, o romance e seu aspecto realista, e a narrativa histórica feitas nesse período; bem como a manifestação dessas relações no romance pedagógico As Aventuras de Telêmaco de Fénelon, um dos romances mais lidos durante todo o século XVIII. Pretende-se também analisar a idéia de história presente neste romance e o seu diálogo com as concepções de história no Antigo Regime. Palavras-chave: romance; escrita histórica; idéia de história.   HISTORY AND ROMANCE: THE CONCEPT OF “HISTORY” IN “AS AVENTURAS DE TELÊMACO” AND THYE RELATIONSHIPS BETWEEN THE HISTORICAL TEXT AND THE FICTIONAL PROSE BETWEEN THE XVII AND THE XVIII CENTURIES Abstract The novel rises in the passage of 17th to 18th century, becoming a literary genre that captivates readers from 18th century on. This article intends to analyse the relationships beteween fictional prose, novel and its realistic side, and historic narrative written at that time. It is as well intended to analyse the manifestation of these relationships in the pedagogical novel As Aventuras de Telêmaco by Fénelon, which is one of the novels most read throughout the 18th century. At last, the following paper plans to enquiry the idea of history existing in this novel and its dialogue with the conceptions of history at the Ancien Régime. Keywords: novel; historical writing; idea of history.   HISTORIA Y NOVELA: LA IDEA DE HISTORIA EN LAS AVENTURAS DE TELÉMACO Y LAS RELACIONES ENTRE EL TEXTO HISTÓRICO Y LA PROSA DE FICCIÓN EN EL PASAJE DE LOS SIGLOS XVII-XVIII Resumen La novela moderna emerge en el pasaje del siglo XVII para el XVIII, tornándose en ese último un género literario que cae en el gusto de los lectores. Ese texto pretende analizar las relaciones entre la

[Expression of saponin biosynthesis related genes in different tissues of Panax quinquefolius].

Science.gov (United States)

Wang, Kang-Yu; Liu, Wei-Can; Zhang, Mei-Ping; Zhao, Ming-Zhu; Wang, Yan-Fang; Li, Li; Sun, Chun-Yu; Hu, Ke-Xin; Cong, Yue-Yi; Wang, Yi

2018-01-01

The relationship between saponin content of Panax quinquefolius in different parts of the organization and expression of ginsenoside biosynthesis related gene was obtained by the correlation analysis between saponin content and gene expression. The 14 tissue parts of P. quinquefolius were studied, six saponins in P. quinquefolius. Samples (ginsenoside Rg₁, Re, Rb₁, Rc, Rb₂ and Rd), group saponins and total saponins were determined by high performance liquid chromatography and vanillin-sulfuric acid colorimetric method. Simultaneously, the expression levels of 7 ginsenoside biosynthesis related genes ( SQS, OSC, DS, β-AS, SQE, P450 and FPS ) in different tissues of P. quinquefolius were determined by Real-time fluorescence quantitative PCR. Although 7 kinds of ginsenoside biosynthesis related enzyme gene in the P. quinquefolius involved in ginsenoside synthesis, the expression of β-AS and P450 genes had no significant effect on the content of monosodium saponins, grouping saponins and total saponins, FPS, SQS, OSC, DS and SQE had significant or extremely significant on the contents of single saponins Re, Rg1, Rb1, Rd, group saponin PPD and PPT, total saponin TMS and total saponin TS ( P saponins, grouping saponins and total saponins in P. quinquefolius was affected by the interaction of multiple enzyme genes in the saponin synthesis pathway, the content of saponins in different tissues of P. quinquefolius was determined by the differences in the expression of key enzymes in the biosynthetic pathway. Therefore, this study further clarified that FPS, SQS, OSC, DS and SQE was the key enzyme to control the synthesis of saponins in P. quinquefolius by correlation analysis, the biosynthesis of ginsenosides in P. quinquefolius was regulated by these five kind of enzymes in cluster co-expression of interaction mode. Copyright© by the Chinese Pharmaceutical Association.

Reclutamiento militar, articulación política y mecanismos de clase en el alto valle del Ebro durante el siglo XVII : el concejo de Calahorra

Directory of Open Access Journals (Sweden)

Julio Luis Arroyo Vozmediano

2007-01-01

Full Text Available El propósito del autor es tratar de elucidar los procedimientos y mecanismos con los que se articulaba la relación entre el poder central de la monarquía hispana y los centros periféricos, en este caso el de la ciudad de Calahorra y sus anejos. A través del estudio de diversos expedientes de levas y reclutas producidas en la ciudad durante el siglo XVII, con oportunidad de las diversas guerras con Francia, se estudian sus procedimientos, su ejecución y las repercusiones que en los distintos grupos sociales causaban aquéllas.The aim of the author is to clarify the procedures and mechanisms with which the relations between the central power of the Hispanic monarchy and the peripheral centers were articulated, dealing with the case of Calahorra. Through the study of diverse files of levies and recruits produced in the city during the 17th Century, in the occasion of the diverse wars against France, their procedures, their execution and the repercussions caused in the different social groups are analysed here.

Inventarium Librorum Musicae: nueva aportación documental sobre el archivo musical de la Catedral de Cuenca (siglos XVII-XVIII

Directory of Open Access Journals (Sweden)

de la Fuente Charfolé, José Luis

2007-12-01

Full Text Available Considering the recovery and study of descriptive documents as a fundamental element of historic and historiographic reconstruction and review of musical practice in general, and cathedral music in particular, is a topic whose value should be increased as a critical manoeuvre. With that purpose, in the present article, transcribed documentation contributes essential data for a qualitative review on the first polyphonic batches —of which we have evidence— written in the Cathedral of Cuenca. It is our understanding that the content of the present inventories transcends simple qualification of scores and certifies that the quality of Cuenca’s music chapel, since the beginning of the 17th century, was comparable to that of other Hispanic chapels of greater notoriety.Considerar la recuperación y estudio de documentos descriptivos un elemento fundamental de la reconstrucción y revisión histórico-historiográfica de la práctica musical en general, y catedralicia en particular, es un tópico que debe revalorizarse como maniobra crítica. A tal efecto, en el presente artículo, la documentación trancrita aporta datos esenciales para la crítica cualitativa de los primeros fondos polifónicos de que hay constancia escrita en la Catedral de Cuenca. A nuestro entender, el contenido de los presentes inventarios trasciende la simple cuantificación de partituras y certifica que la calidad de la capilla musical conquense, desde comienzos del siglo XVII, fue equiparable al de otras capillas hispanas de mayor notoriedad.

Municipio y mercado en el Aragón moderno : el abasto de trigo en Zaragoza (siglos XVI-XVII

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

2002-01-01

Full Text Available Estudio relativo a la política desarrollada por el Concejo de Zaragoza sobre el comercio de cereal durante los siglos XVI y XVII. La prosperidad económica del reino de Aragón, la ciudad y municipio de Zaragoza durante el siglo XVI permitieron aumentar el control público sobre el mercado de cereal para asegurar a la población un suministro suficiente, así como sustentar la demanda local. Sin embargo, el declive económico del reino de Aragón y el creciente endeudamiento municipal durante el siglo XVII obligaron a reducir la intervención y defensa pública de la demanda local en el mercado de cereal. El reajuste de la política municipal promovió la paulatina integración del mercado aragonés, proceso que continuó en el siglo XVIII para afianzarse durante la crisis final del Antiguo Régimen.This paper studies municipal politics carried out by the Zaragoza city council concerning the cereal trade during tfie sixteenthi and seventeenth centuries. Economic prosperity in the kingdom of Aragón, Zaragoza city and council during the sixteenth century allowed to increase public control of cereal transactions in order to supply efficiently the population, as well as to support local demand. However, economic decline of the kingdom and raising municipal indebtedness during the seventeenth century led to reduce public intervention and support of local demand on the cereal market. Readjustment of municipal politics gradually prometed the integration of the market in Aragón. This process continued during the eighteenth century and became firmly established during the final crisis of the «Ancien Régime».

[Index screening and comprehensive evaluation of phenotypic traits of low nitrogen tolerance using BILs population derived from Dongxiang wild rice (Oryza rufipogon Griff)].

Science.gov (United States)

Hu, Biao-lin; Li, Xia; Wan, Yong; Qiu, Zai-hui; Nie, Yuan-yuan; Xie, Jian-kun

2015-08-01

To identify the low nitrogen tolerance of Dongxiang wild rice (DXWR) and its progenies, ten phenotypic traits including plant height (PH), heading day (HD), panicle length (PL), number of effective tillers per plant (NETP), number of filled grains per panicle (NFGP), number of grains per panicle (NGP), grain density (GD), spikelet fertility (SF), 1000-grain mass (TGM) and grain yield per plant (GYP) were studied under normal and low nitrogen treatments, using backcross inbred lines (BILs) of Xieqingzao B//DXWR/Xieqingzao B in BC1 F12. Comprehensive evaluation on the low nitrogen tolerance of the BILs population was conducted using principal component analysis and the subordinate function. The evaluation results indicated that the low nitrogen tolerance of the line 116, 143 and 157 was the strongest, which could be served as the intermediate materials for genetic studies on the low nitrogen tolerance of DXWR and breeding for the low nitrogen tolerance in rice. The optimal regression equation of the low nitrogen tolerance in rice was established using stepwise regression analysis. The relative values of five traits including PH, NGP, SF, TGM and GYP were screened out and could be used as comprehensive evaluation indices for the low nitrogen tolerance in the whole growth stage. Therefore, more attention should be paid to the relative values of these five traits, especially for NGP and GYP, in the genetic improvement of the low nitrogen tolerance in rice.

Vulture News - Vol 55 (2006)

African Journals Online (AJOL)

First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Martin Gilbert, Song Chansocheat, Nadia Sureda, 4-5 ...

Semisynthesis and bioactive evaluation of oxidized products from 20(S)-ginsenoside Rg3, Rh2, protopanaxadiol (PPD) and their 20(R)-epimers as cytotoxic agents.

Science.gov (United States)

Yang, Jie; Li, Xuwen; Sun, Ting; Gao, Yan; Chen, Yanxin; Jin, Yongri; Li, Yang

2016-02-01

A series of oxidized products have been systematically semisynthesized from 20(S)-ginsenoside Rg3, Rh2, 20(S)-protopanaxadiol (PPD) and their 20(R)-epimers and the majority of these products were evaluated for their cytotoxic activity against HeLa cells and HepG2 cells by MTT assay for the first time. Twenty-two products were obtained and elucidated based on comprehensive (1)H NMR, (13)C NMR, two-dimensional (2D) NMR, and mass spectral data and the results reported in previous literature. All the four ocotillol type saponins (20S,24R(δ86, δ85); 20S,24S(δ87, δ88); 20R,24R(δ86, δ86); 20R,24S(δ86, δ87) were obtained. In addition, eight compounds (3, 8, 9, 10, 15, 16, 19 and 22) with the cyclized side chain were firstly identified. Most of the tested compounds possessed cytotoxicity to a certain degree against the two types of cells which implied these oxidized products could play a certain role on anti-cancer functions of the raw materials in vivo. Meanwhile, the results proved that the configurations at C-20 or C-24 and the number of glycosyl at C-3 have important influence on the cytotoxicity. The products 1, 2, 11-17, 20 and 22 should possess great activities and deserved further investigation as potential cytotoxic agents. Copyright © 2015 Elsevier Inc. All rights reserved.

GC-MS Metabolomic Analysis to Reveal the Metabolites and Biological Pathways Involved in the Developmental Stages and Tissue Response of Panax ginseng

Directory of Open Access Journals (Sweden)

Jia Liu

2017-03-01

Full Text Available Ginsenosides, the major compounds present in ginseng, are known to have numerous physiological and pharmacological effects. The physiological processes, enzymes and genes involved in ginsenoside synthesis in P. ginseng have been well characterized. However, relatively little information is known about the dynamic metabolic changes that occur during ginsenoside accumulation in ginseng. To explore this topic, we isolated metabolites from different tissues at different growth stages, and identified and characterized them by using gas chromatography coupled with mass spectrometry (GC-MS. The results showed that a total of 30, 16, 20, 36 and 31 metabolites were identified and involved in different developmental stages in leaf, stem, petiole, lateral root and main root, respectively. To investigate the contribution of tissue to the biosynthesis of ginsenosides, we examined the metabolic changes of leaf, stem, petiole, lateral root and main root during five development stages: 1-, 2-, 3-, 4- and 5-years. The score plots of partial least squares-discriminate analysis (PLS-DA showed clear discrimination between growth stages and tissue samples. Kyoto Encyclopedia of Genes and Genomes (KEGG pathway analysis in the same tissue at different growth stages indicated profound biochemical changes in several pathways, including carbohydrate metabolism and pentose phosphate metabolism, in addition, the tissues displayed significant variations in amino acid metabolism, sugar metabolism and energy metabolism. These results should facilitate further dissection of the metabolic flux regulation of ginsenoside accumulation in different developmental stages or different tissues of ginseng.

Ginsenoside Re protects against phencyclidine-induced behavioral changes and mitochondrial dysfunction via interactive modulation of glutathione peroxidase-1 and NADPH oxidase in the dorsolateral cortex of mice.

Science.gov (United States)

Tran, The-Vinh; Shin, Eun-Joo; Dang, Duy-Khanh; Ko, Sung Kwon; Jeong, Ji Hoon; Nah, Seung-Yeol; Jang, Choon-Gon; Lee, Yu Jeung; Toriumi, Kazuya; Nabeshima, Toshitaka; Kim, Hyoung-Chun

2017-12-01

We investigated whether ginsenoside Re (Re) modulates phencyclidine (PCP)-induced sociability deficits and recognition memory impairments to extend our recent finding. We examined the role of GPx-1 gene in the pharmacological activity of Re against mitochondrial dysfunction induced by PCP in the dorsolateral cortex of mice. Since mitochondrial oxidative stress activates NADPH oxidase (PHOX), we applied PHOX inhibitor apocynin for evaluating interactive modulation between GPx-1 and PHOX against PCP neurotoxicity. Sociability deficits and recognition memory impairments induced by PCP were more pronounced in GPx-1 knockout (KO) than in wild type (WT) mice. PCP-induced mitochondrial oxidative stress, mitochondrial dysfunction, and membrane translocation of p47phox were more evident in GPx-1 KO than in WT. Re treatment significantly attenuated PCP-induced neurotoxic changes. Re also significantly attenuated PCP-induced sociability deficits and recognition memory impairments. The attenuation by Re was comparable to that by apocynin. The attenuation was more obvious in GPx-1 KO than in WT. Importantly, apocynin did not show any additional positive effects on the neuroprotective activity of Re, indicating that PHOX is a molecular target for therapeutic activity of Re. Our results suggest that Re requires interactive modulation between GPx activity and PHOX (p47phox) to exhibit neuroprotective potentials against PCP insult. Copyright © 2017 Elsevier Ltd. All rights reserved.

Articles

African Journals Online (AJOL)

2011-09-01

Sep 1, 2011 ... that an exchange of information can occur at a colony, ... events, low adult survival rates and high emigration rates, and these sinks are therefore prone to ..... Eurasian griffons Gyps fulvus in the island of Crete, Greece. Wildlife ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

Education Environnementale et de. Protection des Oiseaux au Maroc) has produced a poster on the Griffon Vulture. Gyps fulvus, in collaboration with the. HCEFLCD (Haut Commissariat au. Eaux et Forêts et à la Lutte Contre la. Désertification) and ...

Cristianos nuevos de origen ibérico en el Reino de Nápoles en el siglo XVII

Directory of Open Access Journals (Sweden)

Huerga Criado, Pilar

2012-12-01

Full Text Available In 1541, in the Kingdom of Naples, the Jews were expelled or converted to Christianity resulting in an important community of New Christians that flourished and remained until the mid-17^th. During a process of social assimilation and consequently dissolution, a significant number of the members of the community was subject to the Roman Inquisition. The faith trials reveal how complex the community composition was, linked mainly to two outstanding families: the Vaaz, of Portuguese origin, and the Vargas, natives of the Kingdom of Aragon. These families had acquired feudal properties, nobility titles and preeminent positions in magistracy, attributes which placed them among those who held effective power. But the community included more humble families and individuals as well. Internal conflicts led to a break in solidarity and inquisitors took advantage of lack of protection by judging and imposing severe sentences reserved for the Crypto-Jews.

En el Reino de Nápoles, de donde fueron expulsados los judíos en 1541, se desarrolló una importante comunidad de cristianos nuevos que pervivió hasta mediados del siglo XVII. Entonces, cuando la comunidad se hallaba en vías de asimilación social, y por tanto de disolución, la Inquisición romana procedió contra muchos de sus miembros. Los procesos de fe desvelan la compleja composición de la comunidad, aglutinada en torno a dos grandes redes de parentesco: la de los Vaaz, de origen portugués, y la de los Vargas, originarios de la Corona de Aragón. Estas familias habían logrado posesiones feudales, títulos de nobleza y puestos preeminentes en la magistratura, atributos que los situaban entre los poderosos: pero la comunidad incluía también a familias e individuos más humildes. Sus contradicciones internas provocaron la ruptura de la solidaridad y esa falta de protección fue aprovechada por los inquisidores para juzgarlos e imponerles las penas reservadas para los herejes

Chile como un “Flandes indiano” en las crónicas de los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Álvaro Baraibar

2013-12-01

Full Text Available La idea de un nuevo Flandes o de un segundo Flandes o simplemente de otro Flandes apareció en diferentes momentos en el territorio de la Monarquía Hispánica referida a Aragón, Cataluña o Messina. El recuerdo de la guerra pervivió en el imaginario colectivo español más allá del final del conflicto, cuando Flandes era ya un aliado de la Corona española frente a Francia. Cuando en el desarrollo de la conquista de las Indias Occidentales Chile se convierte en el gran problema militar con motivo de la resistencia de los indígenas de la Araucanía, la idea de un segundo Flandes aparecerá también en tierras americanas. Este trabajo pretende mostrar el proceso y los contextos en que Flandes se hizo presente en el discurso que se elaboró sobre el Reino de Chile en las crónicas de los siglos XVI y XVII, hasta que Diego de Rosales acuñara el término “Flandes indiano”. The idea of a new Flanders or of a second or simply of another one appeared in different moments in the territory of Hispanic Monarchy referred to Aragón, Catalonia or Messina. The memory of this war survived in the Spanish collective imaginary even long after the end of the conflict, when Flanders was an ally of the Spanish Crown against France. When Chile becomes the great military problem due to native resistance to conquest, the idea of a second Flanders will turn up in America. This article tries to show the process and contexts in which Flanders becomes visible in the discourse elaborated around the kingdom of Chile in the chronicles of 16th and 17th Centuries, until Diego de Rosales, the first writer to use the term “Indian Flanders”.

Embajadas paralelas : breve período de paz entre las continuasluchas que mantuvieron España y Franciaen el siglo XVII

Directory of Open Access Journals (Sweden)

Isabel Yetano

2010-01-01

Full Text Available Las relaciones diplomáticas entre España y Francia a lo largo del siglo XVII fueron esporádicas ya que se interrumpieron en varias ocasiones debido a las guerras entre ambos países. Tras la Paz de los Pirineos se inicia una etapa de buena correspondencia y el arzobispo de Embrún es enviado a Madrid para representar al Rey Cristianísismo ante S.M. Católica. Al mismo tiempo el marqués de La Fuente es enviado a París para representar a S.M. Católica ante el Rey Cristianísimo. Tanto el recibimiento como la despedida de los dos embajadores y, por supuesto su estancia, son muestra de las dificultades de una etapa (1660-1667 que está presidida por el incumplimiento que hace Luis XIV de la Paz de los Pirineos.During the seventeenth century, diplomatic relations between Spain and France were sporadic due to several disruptions because of wars between both countries. Shortly after the Pyrenees Peace Treaty, a period of active correspondence was initiated and the archbishop of Embrun was sent to Madrid to represent Louis XIV at the Spanish court. At the same time the marquis de la Fuente was sent to Paris to represent Felipe IV at the French court. Both the reception and the stay of the two ambassadors were signs of the difficulties of a time (1660-1667 dominated by Louis XIV s non-fulfillment of the Pyrenees Peace Treaty.

Sibilas en Europa y América: repercusiones del Sibyllarum Icones de Crispijn de Passe en los siglos XVII y XVIII

Directory of Open Access Journals (Sweden)

Rodríguez Romero, Agustina

2015-09-01

Full Text Available Prints published in the sixteenth and seventeenth centuries in Flanders were reworked throughout Europe many times over. This paper is a study of the complex network of republishing and new productions of one such set of prints: the Sibyllarum icones elegantissimi, engraved by Crispijn de Passe in 1601. As a result of this research, the authors propose new engraved sources for three well-known derivatives of this series: the paintings of Philippe de Champaigne in the Luxembourg Palace in Paris; the woodcuts published in Spain by Baltasar Porreño; and the paintings in the Palacio de Autonomía in Mexico City by Pedro Sandoval. All three can be traced to Jacques Granthomme, working in Paris c.1609.Los grabados publicados en Flandes en los siglos XVI y XVII fueron retrabajados repetidamente por toda Europa. Este ensayo es un estudio de la compleja red de reediciones y reelaboraciones de una de estas series de grabados: el Sibyllarum icones elegantissimi, producida por Crispijn de Passe en 1601. A consecuencia de nuestras investigaciones podemos proponer nuevas fuentes grabadas para tres célebres derivados de esta serie: las pinturas de Philippe de Champaigne del Palacio de Luxemburgo de París, las xilografías publicadas en España por Baltasar Porreño, y las pinturas de Pedro Sandoval del Palacio de la Autonomía de la ciudad de México. Todas derivarían de Jacques Granthomme, quien trabajara en París ca. 1609.

The Amelioration of N-Acetyl-p-Benzoquinone Imine Toxicity by Ginsenoside Rg3: The Role of Nrf2-Mediated Detoxification and Mrp1/Mrp3 Transports

Directory of Open Access Journals (Sweden)

Sang Il Gum

2013-01-01

Full Text Available Previously, we found that Korean red ginseng suppressed acetaminophen (APAP-induced hepatotoxicity via alteration of its metabolic profile involving GSTA2 induction and that ginsenoside Rg3 was a major component of this gene induction. In the present study, therefore, we assessed the protective effect of Rg3 against N-acetyl-p-benzoquinone imine (NAPQI, a toxic metabolic intermediate of APAP. Excess NAPQI resulted in GSH depletion with increases in the ALT and AST activities in H4IIE cells. Rg3 pretreatment reversed GSH depletion by NAPQI. Rg3 resulted in increased mRNA levels of the catalytic and modulatory subunit of glutamate cysteine ligase (GCL, the rate-limiting steps in GSH synthesis and subsequently increased GSH content. Rg3 increased levels of nuclear Nrf2, an essential transcriptional factor of these genes. The knockdown or knockout of the Nrf2 gene abrogated the inductions of mRNA and protein by Rg3. Abolishment of the reversal of GSH depletion by Rg3 against NAPQI was observed in Nrf2-deficient cells. Rg3 induced multidrug resistance-associated protein (Mrp 1 and Mrp3 mRNA levels, but not in Nrf2-deficient cells. Taken together, these results demonstrate that Rg3 is efficacious in protecting hepatocytes against NAPQI insult, due to GSH repletion and coordinated gene regulations of GSH synthesis and Mrp family genes by Nrf2.

Inhibition of Autophagy via Activation of PI3K/Akt Pathway Contributes to the Protection of Ginsenoside Rb1 against Neuronal Death Caused by Ischemic Insults

Directory of Open Access Journals (Sweden)

Tianfei Luo

2014-09-01

Full Text Available Lethal autophagy is a pathway leading to neuronal death caused by transient global ischemia. In this study, we examined the effect of Ginsenoside Rb1 (GRb1 on ischemia/reperfusion-induced autophagic neuronal death and investigated the role of PI3K/Akt. Ischemic neuronal death in vitro was induced by using oxygen glucose deprivation (OGD in SH-SY5Y cells, and transient global ischemia was produced by using two vessels occlusion in rats. Cellular viability of SH-SY5Y cells was assessed by MTT assay, and CA1 neuronal death was evaluated by Hematoxylin-eosin staining. Autophagic vacuoles were detected by using both fluorescent microscopy in combination with acridine orange (AO and Monodansylcadaverine (MDC staining and transmission electronic microscopy. Protein levels of LC3II, Beclin1, total Akt and phosphor-Akt at Ser473 were examined by western blotting analysis. GRb1 inhibited both OGD and transient ischemia-induced neuronal death and mitigated OGD-induced autophagic vacuoles in SH-SY5Y cells. By contrast, PI3K inhibitor LY294002 counteracted the protection of GRb1 against neuronal death caused by either OGD or transient ischemia. LY294002 not only mitigated the up-regulated protein level of phosphor Akt at Ser473 caused by GRb1, but also reversed the inhibitory effect of GRb1 on OGD and transient ischemia-induced elevation in protein levels of LC3II and Beclin1.

Effect of ginsenoside Rg3 on tyrosine hydroxylase and related mechanisms in the forced swimming-induced fatigue rats.

Science.gov (United States)

Xu, Yuxia; Zhang, Peng; Wang, Chu; Shan, Ye; Wang, Dandan; Qian, Fenglei; Sun, Mengwei; Zhu, Cuiqing

2013-10-28

Ginsenoside Rg3 has shown multiple pharmacological activities and been considered as one of the most promising approaches for fatigue treatment. However, little is known about the cellular and molecular mechanisms of Rg3 on anti-fatigue and the effect of Rg3 on dopaminergic system has not been reported yet. The major aim of this study is to investigate the effect of Rg3 on TH expression and the related biochemical parameters, such as PKAα, ERK1/2, Akt and α-synuclein in brain of fatigue rats. Weight-loaded forced swimming was performed to establish an animal model of fatigue. Rg3 (10mg/kg, 50mg/kg and 100mg/kg) was intragastrically administrated before swimming. The effect of Rg3 on the expression and phosphorylation of TH and TH-related proteins in fatigue rats or in SH-SY5Y cells was assessed with western blotting. HPLC was used to examine the level of DA and DOPAC in the fatigue rats tissues. TH and phosphorylated TH were decreased in different brain regions of which ventral midbrain were less affected in weight-loaded forced swimming rats. Pretreatment with Rg3 significantly suppressed fatigue-induced decrease expression of TH and TH phosphorylation. Also treatment with Rg3 reversed the decrease expression of PKAα as well as the phosphorylation of ERK1/2 and Akt which were induced by weight-loaded forced swimming. Moreover, weight-loaded swimming could induce the increase expression of α-synuclein in hippocampus and midbrain, while suppressed α-synuclein expression in striatum and prefrontal cortex. Furthermore, Rg3 could induce the increase of TH expression and phosphorylation which was accompanied with elevated expression and phosphorylation of related kinase proteins in vitro, while the inhibitors of kinase proteins could suppress these effects of Rg3. In addition, HPLC results showed that Rg3 could reverse the weight-loaded swimming-induced increase of DOPAC/DA ratio. Our data suggest that fatigue can induce the decrease of DA which might partially

La alquimia y los sacerdotes mineros en el Virreinato del Perú en el siglo XVII

Directory of Open Access Journals (Sweden)

2001-01-01

Full Text Available L’ALCHIMIE ET LES PRÊTRES MINIERS DANS LA VICE-ROYAUTÉ DU PÉROU AU XVIIÈME SIÈCLE À travers l’examen des manuels de minéralogie et de métallurgie de Alonso Barba, curé résidant à Potosí et de Miguel de Monsalve, dominicain résidant à Lima, ce travail se propose d’analyser un ensemble d’idées alchimiques qui circulèrent au Pérou pendant le XVIIème siècle, et les modalités de leur transfert et d’implantation dans le vice-royaume. De manière plus générale, cette étude se veut une contribution à la réflexion sur la construction d’un corpus de savoirs miniers dans le Pérou colonial et sur les mécanismes de leur transmission. A través del examen de los manuales mineralógicos y metalúrgicos de Alonso Barba, sacerdote seglar residente en Potosí y de Miguel de Monsalve, dominico residente en Lima, este trabajo se propone analizar un conjunto de ideas alquímicas que circularon en el Perú en el siglo XVII, estudiar sus modalidades de traslación e implantación en este virreinato. De manera más general este estudio pretende reflexionar sobre la construcción de un corpus de saberes mineros en el Perú colonial y sobre sus mecanismos de transmisión. ALCHEMY AND PRIESTS ENVOLVED IN MINING PROJECTS IN THE VICEROYALTY OF PERU IN THE 17TH CENTURY Through the study of the manuals of mineralogy and metallurgy written by Alonso Barba, a lay priest residing in Potosi, and Miguel de Monsalve, a Dominican residing in Lima, this article sets out to analyse a series of ideas concerning alchemy which circulated in Peru in the 17th century and to study the ways in which they were introduced and developed in the viceroyalty. In more general terms, the study aims at analysing the establishment of a corpus of mining knowledge in colonial Peru and the mechanisms of its transmission.

El léxico de parentesco quechua según Juan Pérez Bocanegra (Cuzco, siglo XVII

Directory of Open Access Journals (Sweden)

Raúl Bendezú-Araujo

2015-01-01

Full Text Available ResumenEn el marco de los estudios andinos coloniales, la figura de Juan Pérez Bocanegra, párroco de Andahuaylillas (Cuzco, goza de gran prestigio y su obra es frecuentemente citada como una fuente muy digna de crédito. El aporte más significativo de este clérigo a nuestro conocimiento del pasado andino lo constituye, muy probablemente, su detallada descripción del sistema de parentesco quechua. Ahora bien, sin intentar desmerecer el valor general de la obra de Pérez Bocanegra, la presente nota busca ofrecer una perspectiva lingüístico-filológica de los datos que esta presenta respectodel léxico de parentesco del quechua de inicios del siglo XVII. En ese sentido, intentaremos fundamentar la hipótesis de que, en relación con este aspecto particular, los datos de Pérez Bocanegra no son del todo fiables, pues obedecen a un proyecto evangelizador particular, que deja rastros en la selección y presentación de los lexemas que componen el campo léxico en cuestión.Palabras clave: filología andina, términos de parentesco, Juan Pérez Bocanegra, quechua colonial AbstractWithin the framework of colonial Andean studies, the image of Juan Perez Bocanegra, parish priest of Andahuaylillas (Cuzco, is highly regarded, and his work is often cited as a very reliable source. The most significant contribution of this cleric to our knowledge of the Andean past lies in its detailed description of the Quechua kinship system. However, without trying dismiss the overall value of the work of Pérez Bocanegra, this article seeks to provide a linguistic-philological perspective of the data he provides regarding the Quechua kinship lexicon from the early seventeenth century. In this respect, I will try to support the hypothesis that, on this particular aspect, this author’s data is not entirely reliable, for it obeys a particular evangelizer project that leaves traces in the selection and presentation of the lexemes that compose the lexical field in

Inhibitory Effects of Cytosolic Ca2+ Concentration by Ginsenoside Ro Are Dependent on Phosphorylation of IP3RI and Dephosphorylation of ERK in Human Platelets

Directory of Open Access Journals (Sweden)

Hyuk-Woo Kwon

2015-01-01

Full Text Available Intracellular Ca2+ ([Ca2+]i is platelet aggregation-inducing molecule and is involved in activation of aggregation associated molecules. This study was carried out to understand the Ca2+-antagonistic effect of ginsenoside Ro (G-Ro, an oleanane-type saponin in Panax ginseng. G-Ro, without affecting leakage of lactate dehydrogenase, dose-dependently inhibited thrombin-induced platelet aggregation, and the half maximal inhibitory concentration was approximately 155 μM. G-Ro inhibited strongly thrombin-elevated [Ca2+]i, which was strongly increased by A-kinase inhibitor Rp-8-Br-cAMPS compared to G-kinase inhibitor Rp-8-Br-cGMPS. G-Ro increased the level of cAMP and subsequently elevated the phosphorylation of inositol 1, 4, 5-triphosphate receptor I (IP3RI (Ser1756 to inhibit [Ca2+]i mobilization in thrombin-induced platelet aggregation. Phosphorylation of IP3RI (Ser1756 by G-Ro was decreased by PKA inhibitor Rp-8-Br-cAMPS. In addition, G-Ro inhibited thrombin-induced phosphorylation of ERK 2 (42 kDa, indicating inhibition of Ca2+ influx across plasma membrane. We demonstrate that G-Ro upregulates cAMP-dependent IP3RI (Ser1756 phosphorylation and downregulates phosphorylation of ERK 2 (42 kDa to decrease thrombin-elevated [Ca2+]i, which contributes to inhibition of ATP and serotonin release, and p-selectin expression. These results indicate that G-Ro in Panax ginseng is a beneficial novel Ca2+-antagonistic compound and may prevent platelet aggregation-mediated thrombotic disease.

ARTICLES

African Journals Online (AJOL)

campbell

Abstract. A study on communal roosts of African White-backed Gyps africanus and. Hooded Vultures Necrosyrtes monachus in Wondo Genet College of Forestry and Natural Resources, southern Ethiopia was conducted from January to. March 2012 to investigate population dynamics of vultures. The population fluctuation ...

Lappet-faced Vulture (Torgos tracheliotos) breeding in Ithala Game ...

African Journals Online (AJOL)

Predator simulation, re-colonization, KwaZulu-Natal. African White-backed Vulture Gyps africanus, Lappet-faced. Vulture Torgos tracheliotos. Authors' addresses: Ian Rushworth & James Wakelin, Ezemvelo KwaZulu-Natal. Wildlife, P.O. Box 13053, Cascades 3202, KwaZulu-Natal,. South Africa; Gary Bawden, Ithala Game ...

Assessment of Mercury in Soils, Crops, Earthworms, and Water when Soil is Treated with Gypsum

Science.gov (United States)

Flue gas desulfurization (FGD) gypsum from fossil fuel combustion has many potential uses in agriculture, but there is concern about the potential environmental effects of its elevated mercury (Hg) concentration. The wet limestone scrubbing process that removes sulfur from flue gas (and produces gyp...

Peregrynant uczony. Rola biblioteki i książki w programie staropolskich podroży edukacyjnych XVII w.

Directory of Open Access Journals (Sweden)

Adam Kucharski

2011-12-01

Full Text Available Głównym celem niniejszego opracowania jest analiza roli i miejsca jakie pełniły księgi i księgozbiory w trakcie polskich podróży edukacyjnych w XVII w. Z natury rzeczy książki były integralnym elementem studiów, zarówno w kraju jak i poza jego granicami. Podręczniki historii, retoryki, filozofii czy matematyki i architektury militarnej odgrywały podstawową rolę w procesie edukacji akademickiej. Także staropolscy studenci podróżujący dla zdobycia wiedzy i umiejętności byli autorami drukowanych rozpraw wieńczących ich studia akademickie. Książka stanowiąca w epoce baroku cenne, a nierzadko główne, źródło wiedzy o świecie była także obiektem zainteresowania w aspekcie jej gromadzenia i przechowywania. Biblioteki stanowiły z pewnością ważny, chociaż nie najistotniejszy, składnik licznych peregrynacji. Chętnie odwiedzano biblioteki kościelne i miejskie, publiczne, a nawet prywatne. Charakterystycznym rysem ich opisów była jednak predylekcja do opisywania wszelakich ciekawych eksponatów tam oglądanych. Tendencja taka wyraźnie zdominowała długość i dokładność opisów księgozbiorów bibliotecznych. Właściwa dla kultury barokowej pasja do zdobywania wiedzy o rzadkich i osobliwych dziełach sztuki, wynalazkach technicznych, zwierzętach czy przedmiotach objawiała się także podczas zwiedzania gmachów bibliotek. Niejednokrotnie przeradzała się ona wyłącznie w chęć oglądania niezwykłych eksponatów stając się de facto rodzajem rozrywki.

Estudio de las fábricas de ladrillo en Valencia: análisis mensiocronológico y técnicas de acabado (s. XVII-XVIII

Directory of Open Access Journals (Sweden)

Cristini, Valentina

2008-12-01

Full Text Available The traditional techniques of brick masonry in Valencia, mainly in the 17th and 18th centuries, are highly interesting to understand the urban distribution of the city. This period is featured by a huge development of the local brick production and the expansion of cheap and simple masonries lacking building specialists. Direct and indirect documentary sources enable to find out really interesting unknown aspects about the mensiochronological evolution of bricks, their joints and finishing techniques typical of the city centre.Las técnicas tradicionales de construcción de fábricas de ladrillo empleadas en Valencia, sobre todo a lo largo de los siglos XVII y XVIII, presentan un gran interés específico para la comprensión del tejido construido de la ciudad. Se trata de una época caracterizada por un gran desarrollo de la producción ladrillera autóctona y la difusión respectiva de fábricas económicas, simples y sin necesidad de obreros especializados. Las fuentes consultadas para este estudio, tanto directas como indirectas, han permitido descubrir interesantes aspectos desconocidos, relacionados con la evolución mensiocronológica de los ladrillos, los tipos de juntas y las técnicas de acabado propias del centro histórico de la ciudad.

Phenology prediction component of GypsES

Science.gov (United States)

Jesse A. Logan; Lukas P. Schaub; F. William Ravlin

1991-01-01

Prediction of phenology is an important component of most pest management programs, and considerable research effort has been expended toward development of predictive tools for gypsy moth phenology. Although phenological prediction is potentially valuable for timing of spray applications (e.g. Bt, or Gypcheck) and other management activities (e.g. placement and...

El premio de la plata y la devaluación del vellón en Guipúzcoa en el siglo XVII

Directory of Open Access Journals (Sweden)

Álvaro Aragón Ruano

2001-01-01

Full Text Available El presente artículo analiza la evolución del premio de la plata durante el siglo xvii en Guipúzcoa, donde aparecen dos modelos de comportamiento, siempre en relación con la abundancia y movimiento de la plata, que es el principal factor que explica las variaciones del premio. Se constata, no obstante, que en cada localidad los premios son diferentes, lo que demuestra la autonomía de las economías locales de Antiguo Régimen. Así mismo, hay que decir que las mayores repercusiones de este fenómeno se dejaron sentir en los mercados y en las transacciones locales, afectando principalmente a los consumidores. De todas formas, se demuestra la necesidad de seguir realizando investigaciones en los diferentes territorios que formaban la Corona, y desterrar definitivamente la generalización de datos como los de Hamilton.The next article analises the evolution of the silver's prize during the XVIIth Century in Guipúzcoa, where there arise two trends of behaviour, always related to the movement and abundance of the silver, which are the main factors that explain the changes of the prize. It is verified, nevertheless, that in each town the prizes are different, which shows the local economies' autonomy in the Ancient Regime. Besides, we should add that the main repercussion of this phenomenon was reflected in the local markets and transactions, mainly affecting the communities. In any case, it is stated the need to continué investigating in the different territories which formed the Crown, and to stamp out definetely the generalization of data, such as Hamilton's one.

Tradução comentada: experiências com textos teatrais espanhóis dos séculos XV e XVII

Directory of Open Access Journals (Sweden)

Leticia Rebollo Couto Rebollo Couto

2015-12-01

Full Text Available A tradução comentada é aqui aplicada ao processo de aprendizagem com tradução de textos do teatro espanhol, “Peribañez y el gobernador de Ocaña” de Lope de Veja (século XVII e “La Celestina” de Fernando de Rojas (século XV. A partir da sua constituição como texto dialogado, comentamos nas propostas de tradução feitas por aprendizes a relação de maior ou menor distanciamento, a partir da análise das formas de tratamento e da fala coloquial. As duas propostas de tradução apresentadas orientam-se por diferentes finalidades, mas têm em comum alguns problemas relacionados à especificidade temporal destes textos, e ao seu gênero, texto dramático para leitura. Trata-se de propostas de tradução para trabalhar a relação texto-texto e não texto-espetáculo, encenação. A tradução comentada é introduzida por uma revisão bibliográfica que assinala o papel do teatro espanhol na formação da dramaturgia brasileira e em particular na tensão oralidade vs escrita, latente na construção do padrão de escrita literário, como projeto do século XIX. Esta tensão entre fala e escrita é particularmente relevante para a tradução do teatro em português do Brasil, e juntamente com as formas de tratamento e as seleções mais ou menos coloquializadoras constitui um elemento chave para a fluência do texto dramático.

MODELO DE FEMINIDAD DEL SIGLO XVII: CENSURA Y SEÑALAMIENTO. EL CASO DE SOR JUANA INÉS DE LA CRUZ

Directory of Open Access Journals (Sweden)

Karen Esmeralda Rivera López

2015-06-01

Full Text Available El siguiente trabajo estudia el modelo de mujer propio del siglo XVII en el contexto del llamado periodo de la Colonia en Hispanoamérica, específi camente en la Nueva España (México. En él se revela así la construcción social de la feminidad durante ese periodo, lo que permite posicionar dentro de la cuestión la obra de una de las mujeres más sobresalientes de dicho periodo, sor Juana Inés de la Cruz. Revisar los modelos y construcciones del deber ser femenino resulta trascendental si queremos entender el contexto social, cultural y político en el que se desenvolvió esta autora, que es una de las literatas y pensadoras de una época en la cual se negaba a las mujeres el derecho a educarse, y también por censurar y silenciarlas cuando transgredían el espacio público, principalmente masculino. AbstractThis paper focuses on the study of the woman model in seventeenth century in the context of the period called colonization time in Latin America, in New Spain (Mexico specifi cally. In this work, the social construction of femininity is revealed during this period, which has the intention to position the work of one of the most prominent woman of this period, sister Juana Ines de la Cruz. Reviewing the models and the constructions of being female is transcendental if we want to understand the social cultural and political context lived by this author; she is considered as a literate and thinkers from this time when the right to educate was denied to women, and to censor and silence them when they transgressed the public space, mainly male.

Cúpulas de crucero en templos de la provincia de Alicante (s.XVII-XIX: construcción y geometría

Directory of Open Access Journals (Sweden)

Pérez-Sánchez, J. C.

2015-06-01

Full Text Available The main objective is to determine constructive, geometric and material properties in the construction of original brick domes of temples in the province of Alicante from the late seventeenth to the early nineteenth century. 38 crossing domes in 35 churches and cathedrals in Alicante municipalities were studied by collecting original drawings, draw up plans, 3D construction , thermography and sampling, followed by a comparative analysis of variables. Constructively, the 88.57 % of the analyzed simple domes are from a sheet of solid bricks. Geometrically, 97.37 % present circular floor and 92.1 % have a camber shape. The blue glazed finish on decks is characteristic in the province (68.42 %, adorned with white easels. This research is essential to establish use and conservation criteria, facilitating future rehabilitation interventions in such kind of religious buildings.El objetivo es determinar las características constructivas, geométricas y materiales en la construcción de cúpulas originales de ladrillo en templos de la provincia de Alicante desde finales del siglo XVII hasta principios del siglo XIX. Se estudian 38 cruceros de iglesias y catedrales en 35 localidades alicantinas mediante recopilación de dibujos originales, levantamiento de planos, construcción en 3D, termografías y toma de muestras, todo ello seguido de un análisis comparativo de variables. Constructivamente, el 88,57 % de las cúpulas simples analizadas son de una hoja de ladrillo macizo (colocado a rosca. Geométricamente, el 97,37 % presentan planta circular y el 92,1 % peralte. El acabado azul vidriado en cubierta es el característico de la provincia (68,42 %, adornado con limatesas en color blanco.

High occurrence of extra-pair partnerships and homosexuality in a ...

African Journals Online (AJOL)

The Cape Vulture Gyps coprotheres is an Endangered colonial cliff-nesting species that is typically cited as monogamous. Observations of wild Cape Vulture colonies note extra-pair breeding activities but homosexual activity has never been confirmed. Observations of breeding behaviours within a captive colony were ...

Observations on the population and breeding status of the African ...

African Journals Online (AJOL)

The breeding success of the nests of 60 African White-backed Vultures Gyps africanus, nine Black-chested Snake Eagles Circaetus pectoralis and 12 Secretarybirds Sagittarius serpentarius was monitored for three years, during a seven-year population dynamics study on raptors in the Kgalagadi Transfrontier Park (KTP).

High-Performance Liquid Chromatography with Diode Array Detector and Electrospray Ionization Ion Trap Time-of-Flight Tandem Mass Spectrometry to Evaluate Ginseng Roots and Rhizomes from Different Regions.

Science.gov (United States)

Wang, Hong-Ping; Zhang, You-Bo; Yang, Xiu-Wei; Yang, Xin-Bao; Xu, Wei; Xu, Feng; Cai, Shao-Qing; Wang, Ying-Ping; Xu, Yong-Hua; Zhang, Lian-Xue

2016-05-09

Ginseng, Panax ginseng C. A. Meyer, is an industrial crop in China and Korea. The functional components in ginseng roots and rhizomes are characteristic ginsenosides. This work developed a new high-performance liquid chromatography coupled with electrospray ionization ion trap time-of-flight multistage mass spectrometry (LC-ESI-IT-TOF-MS(n)) method to identify the triterpenoids. Sixty compounds (1-60) including 58 triterpenoids were identified from the ginseng cultivated in China. Substances 1, 2, 7, 15-20, 35, 39, 45-47, 49, 55-57, 59, and 60 were identified for the first time. To evaluate the quality of ginseng cultivated in Northeast China, this paper developed a practical liquid chromatography-diode array detection (LC-DAD) method to simultaneously quantify 14 interesting ginsenosides in ginseng collected from 66 different producing areas for the first time. The results showed the quality of ginseng roots and rhizomes from different sources was different due to growing environment, cultivation technology, and so on. The developed LC-ESI-IT-TOF-MS(n) method can be used to identify many more ginsenosides and the LC-DAD method can be used not only to assess the quality of ginseng, but also to optimize the cultivation conditions for the production of ginsenosides.

Observation of a population of Egyptian Vultures Neophron ...

African Journals Online (AJOL)

Campbell Murn

Observational study of behavior: sampling methods. Behaviour 49:227- 267. Baral, N., R. Gautam & B. Tamang .2005. Population status and breeding ecology of White-rumped Vulture Gyps bengalensis in Rampur Valley,. Nepal. Forktail 21: 87-91. Brandl, R., Utschick, H & Schmidtke, K. 1985. Raptors and land-use systems.

Selected mineral and heavy metal concentrations in blood and ...

African Journals Online (AJOL)

Concentrations of eight essential elements (Ca, Co, Cr, Cu, Fe, Mn, Ni and Zn) and three toxic metals (Al, Pb and Sr) were measured in various tissue samples from African whitebacked (Pseudogyps africanus), Cape griffon (Gyps coprotheres) and Lappetfaced (Torgos tracheliotos) vultures in different regions of South ...

Author Details

African Journals Online (AJOL)

Chansocheat, Song. Vol 55 (2006) - Articles Olfaction in Accipitrid vultures. Abstract PDF · Vol 55 (2006) - Articles First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

Status of birds of prey in Guinea-Bissau: first assessment based on ...

African Journals Online (AJOL)

... cover (based on the normalised difference vegetation index). Apart from Hooded Vultures and White-backed Vultures Gyps africanus, all other raptors in the IUCN Red List were found to be scarce, including other vultures and several medium-to-large eagles. Keywords: birds, Guinea-Bissau, raptors, transects, West Africa ...

De sillas y almohadones o de la naturaleza ritual del poder en la nueva España de los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Cañeque, Alejandro

2004-12-01

Full Text Available This article examines the relationship between public ritual and colonial authority in sixteenth and seventeenth-century New Spain. In colonial society, the establishment of authority depended more on such things as prestige, reputation and/or public appearance than on the use of force. This helps explain the great transcendence attributed by contemporaries to all kinds of public rituals. Their effects were far from negligible: they were much more than a disguise with which to make the rulers’ power more palatable. Royal officials constituted their power and identities through public ceremony, and therefore placed crucial importance on maintaining an authoritative public image.

El artículo estudia la interrelación entre ritual público y autoridad colonial en la Nueva España de los siglos XVI y XVII. En la sociedad colonial, el afianzamiento de la autoridad dependía más de cuestiones tales como prestigio, reputación y/o apariencia pública que del uso de la fuerza. Eso permite explicar la trascendencia tan grande que los contemporáneos dieron a todo tipo de rituales públicos pues sus efectos estaban lejos de ser algo insignificante y eran mucho más que simples disfraces para hacer más digerible el poder de los gobernantes. Los oficiales reales consituían su poder y su identidad a través del ceremonial público y, por tanto, daban una importancia crucial al mantenimiento de una imagen pública llena de autoridad.

La visión directa de José de Ribera a través de los "Voyages en Italie" de los franceses en los siglos XVII y XVIII

Directory of Open Access Journals (Sweden)

Amaya Alzaga Ruiz

2004-01-01

Full Text Available En la Francia del Grand Goût de los siglos XVII y XVIII empezó a fraguarse el mito romántico del pintor español José de Ribera, cuya leyenda de artista violento se consolidó en el siglo XIX. Frente a los escritos de Félibien y Dezallier D’Argenville, los viajeros franceses del siglo XVIII opusieron su mirada personal ante la contemplación directa de sus obras conservadas en Nápoles. Sus comentarios escritos, que en muchas ocasiones permanecieron inéditos, suponen una crítica más moderna que la condena uniforme de la Academia.In France, during the 17th and 18th Century, where the Grand Goût was uniform, begann the romantic mith of the spanish painter José de Ribera, which legendary violence got in the 19th century consolidated. In front of the writtings of Félibien and Dezallier D’Argenville, the french travellers of the 18th century opposed their personal look of the direct contemplation of his works in Naples. Their texts, which in several ocasions remained unpublished, mean a more modern critic than the uniform condemn of the Academy.

[Effect of Acupuncture on the Expression of Transcription Factor T-bet/GATA-3 in Plasma of Rats with Chronic Fatigue Syndrome].

Science.gov (United States)

Wang, Xiang-Yi; Liu, Chang-Zheng; Lei, Bo

2017-06-25

To observe the effect of acupuncture on the expression of T-box expressed in T cell (T-bet)/GATA binding factor-3 (GATA-3) in plasma of rats with chronic fatigue syndrome (CFS) and explore the mechanism of acupuncture treatment for CFS. Forty-eight healthy male SD rats were randomly divided into blank control group, CFS model group, acupuncture group, and ginsenoside group (12 rats in each group). CFS rat model was established by combining restriction and cold water swimming. Acupuncture was applied to "Baihui"(GV 20), "Guanyuan" (CV 4) and "Zusanli" (ST 36, bilate-ral) acupoints, once a day for two weeks. The ginsenoside group was gavage administrated with ginsenoside, once a day for two weeks. After 14 days, behavioural changes were observed, and the expression levels of T-bet/GATA-3 genes in plasma were detected by RT-PCR. Compared with the blank control group, the time for immobility of forced suspensory test was signi-ficantly longer ( P <0.05) and the time for exhaustive swimming was significantly shortened ( P <0.05) in the CFS model group. Compared with the model group, the two indexes above-mentioned were reversed ( P <0.05) both in the acupuncture group and the ginsenoside group, and the effects in the acupuncture group were more significant than those in the ginsenoside group ( P <0.05). Compared with the blank control group, the expression level of T-cell transcription factor T-bet gene in plasma was higher in the CFS model group ( P <0.05), companied with lower GATA-3 gene expression ( P <0.05). The ratio of T-bet/GATA-3 was higher in the model group than in the blank control group( P <0.05). Compared with the CFS model group, all the indexes above-mentioned were reversed ( P <0.05) in the two treatment groups. Acupuncture group showed a better effect on reducing T-bet gene expression than the ginsenoside group ( P <0.05). Acupuncture can decrease the expression level of T-bet gene while increase the expression of GATA-3 gene, which may be associated

Cabildo, negociación y vino de cocos: el caso de la villa de Colima en el siglo XVII

Directory of Open Access Journals (Sweden)

Machuca Chávez, Claudia Paulina

2009-06-01

Full Text Available After a huge production of cocoa plantings during the Sixteenth century, the town of Colima in the New Spain lost this culturing because of climate difficulties and because of the preference that the Crown made on cocoa plantings in South America. For the benefit of its settlers, the arrival of “indios chinos”, an Asian community at the town of Colima permitted the development of a small industry based on a coconut drink —“vino de cocos”—, which became the most important economic activity during the Seventeenth century. Even when it was considered a “native drink” at first —and therefore forbidden— the town council of Colima was a fundamental institution in the negotiation with viceroys and the Real Audiencia of Mexico in order to get licenses that permitted not only its elaboration but also its distribution alongside a regional market.

Después de una intensa producción de cacao durante el siglo XVI, la villa de Colima de la Nueva España sufrió la pérdida de este cultivo por causas climáticas y por el apoyo preferente de la Corona a los sembradíos de cacao en Sudamérica. Para el beneficio de sus habitantes, la llegada de “indios chinos” o asiáticos a la villa de Colima propició el desarrollo de una pequeña industria, la del vino de cocos, que a la postre se convertiría en la principal actividad económica de la villa durante todo el siglo XVII. Aunque en un principio se consideró como una “bebida de la tierra” —y por consiguiente, prohibida—, el Cabildo colimense fue una institución clave en la negociación con los virreyes y la Real Audiencia de México para conseguir licencias que permitieran no sólo su fabricación, sino su eventual distribución en el mercado regional novohispano.

PREFACE: XVII Congress of Bioengineering and VI Clinical Engineering Conference

Science.gov (United States)

Rocha, Darío

2011-09-01

SABI 2009 was the XVII Biennial Congress of the Argentinean Bioengineering Society (SABI - www.sabi.org.ar), celebrated along with the VI Clinical Engineering Conference. It took place in Rosario, the second city of Argentina, located on the west bank of the Paraná, one of the world's most important rivers. This city, with its 150 year history and one million inhabitants, is characterized by a strong enterprising spirit. It is the agroindustrial leader of Argentina, with cereal ports recognized to be among the most active in the world, and its cereal stock exchange competes with Chicago's in international cereal pricing. Demographically Rosario presents a European profile, and there are seven national and private higher level universities in the area. SABI 2009 was the first time the Congress was celebrated in Rosario. Usually the Congress is organized by the Bioengineering Society in cooperation with a university with an undergraduate program, which Rosario lacks. To meet the needs of this exceptional case, a young local institution was asked to coordinate the Congress, the Rosario Technological Center (www.polotecnologico.net). This organization gathers together around 100 companies that produce technology, with a large number focused on IT, but those focused on biotechnology also stand out. The Center is also integrated with relevant public and government bodies. Traditionally, bioengineering has been related to human health applications, with less emphasis on applications significant to agrotechnology, an area in which Rosario is growing as an economic force. In order to address this oversight, the Congress formulated its main goals for integrating and synergizing bioengineering and biotechnology, particularly bioengineering and agrotechnology. This initiative has produced promising results. The importance of the Congress was reflected in the high number of participants - including researchers, professionals and students - from abroad, with participants from

Inhibitory Effect of Triterpenoids from Panax ginseng on Coagulation Factor X

Directory of Open Access Journals (Sweden)

Lingxin Xiong

2017-04-01

Full Text Available Enzymes involved in the coagulation process have received great attention as potential targets for the development of oral anti-coagulants. Among these enzymes, coagulation factor Xa (FXa has remained the center of attention in the last decade. In this study, 16 ginsenosides and two sapogenins were isolated, identified and quantified. To determine the inhibitory potential on FXa, the chromogenic substrates method was used. The assay suggested that compounds 5, 13 and 18 were mainly responsible for the anti-coagulant effect. Furthermore, these three compounds also possessed high thrombin selectivity in the thrombin inhibition assay. Furthermore, Glide XP from Schrödinger was employed for molecular docking to clarify the interaction between the bioactive compounds and FXa. Therefore, the chemical and biological results indicate that compounds 5 (ginsenoside Rg2, 13 (ginsenoside Rg3 and 18 (protopanaxtriol, PPT are potential natural inhibitors against FXa.

Qualitative and quantitative analysis of the saponins in Panax notoginseng leaves using ultra-performance liquid chromatography coupled with time-of-flight tandem mass spectrometry and high performance liquid chromatography coupled with UV detector

Directory of Open Access Journals (Sweden)

Fang Liu

2018-04-01

Full Text Available Background: Panax notoginseng leaves (PNL exhibit extensive activities, but few analytical methods have been established to exclusively determine the dammarane triterpene saponins in PNL. Methods: Ultra-performance liquid chromatography coupled with time-of-flight mass spectrometry (UPLC/Q-TOF MS and HPLC-UV methods were developed for the qualitative and quantitative analysis of ginsenosides in PNL, respectively. Results: Extraction conditions, including solvents and extraction methods, were optimized, which showed that ginsenosides Rc and Rb3, the main components of PNL, are transformed to notoginsenosides Fe and Fd, respectively, in the presence of water, by removing a glucose residue from position C-3 via possible enzymatic hydrolysis. A total of 57 saponins were identified in the methanolic extract of PNL by UPLC/Q-TOF MS. Among them, 19 components were unambiguously characterized by their reference substances. Additionally, seven saponins of PNL—ginsenosides Rb1, Rc, Rb2, and Rb3, and notoginsenosides Fc, Fe, and Fd—were quantified using the HPLC-UV method after extraction with methanol. The separation of analytes, particularly the separation of notoginsenoside Fc and ginsenoside Rc, was achieved on a Zorbax ODS C8 column at a temperature of 35°C. This developed HPLC-UV method provides an adequate linearity (r2>0.999, repeatability (relative standard deviation, RSD < 2.98%, and inter- and intraday variations (RSD < 4.40% with recovery (98.7–106.1% of seven saponins concerned. This validated method was also conducted to determine seven components in 10 batches of PNL. Conclusion: These findings are beneficial to the quality control of PNL and its relevant products. Keywords: ginsenoside transformation, notoginsenoside Fd, notoginsenoside Fe, Panax notoginseng leaves, UPLC/Q-TOF MS

Hooded Vulture Necrosyrtes monachus and African White-backed ...

African Journals Online (AJOL)

Basic ecological information is still lacking for many species of African vultures. The Hooded Vulture Necrosyrtes monachus is known as a rare breeding resident in north-eastern South Africa. This study set out to monitor the nests of Hooded Vultures and, secondarily, White-backed Vultures Gyps africanus in the Olifants ...

Qualitative and quantitative analysis of the saponins in Panax notoginseng leaves using ultra-performance liquid chromatography coupled with time-of-flight tandem mass spectrometry and high performance liquid chromatography coupled with UV detector.

Science.gov (United States)

Liu, Fang; Ma, Ni; He, Chengwei; Hu, Yuanjia; Li, Peng; Chen, Meiwan; Su, Huanxing; Wan, Jian-Bo

2018-04-01

Panax notoginseng leaves (PNL) exhibit extensive activities, but few analytical methods have been established to exclusively determine the dammarane triterpene saponins in PNL. Ultra-performance liquid chromatography coupled with time-of-flight mass spectrometry (UPLC/Q-TOF MS) and HPLC-UV methods were developed for the qualitative and quantitative analysis of ginsenosides in PNL, respectively. Extraction conditions, including solvents and extraction methods, were optimized, which showed that ginsenosides Rc and Rb3, the main components of PNL, are transformed to notoginsenosides Fe and Fd, respectively, in the presence of water, by removing a glucose residue from position C-3 via possible enzymatic hydrolysis. A total of 57 saponins were identified in the methanolic extract of PNL by UPLC/Q-TOF MS. Among them, 19 components were unambiguously characterized by their reference substances. Additionally, seven saponins of PNL-ginsenosides Rb1, Rc, Rb2, and Rb3, and notoginsenosides Fc, Fe, and Fd-were quantified using the HPLC-UV method after extraction with methanol. The separation of analytes, particularly the separation of notoginsenoside Fc and ginsenoside Rc, was achieved on a Zorbax ODS C8 column at a temperature of 35°C. This developed HPLC-UV method provides an adequate linearity ( r 2  > 0.999), repeatability (relative standard deviation, RSD PNL. These findings are beneficial to the quality control of PNL and its relevant products.

The Humansdorp Cape Griffon Site

African Journals Online (AJOL)

ZeldaH

Figure 1. The cliff north-west of the town of Humansdorp, Eastern Cape, South Africa, where a small group of Cape Griffons Gyps coprotheres roosted, and reportedly bred, until the end of the. 19 th century. The trees seen in the picture are all alien, invasive, black wattles Acacia mearnsii. (Photo: A Boshoff).

Author Details

African Journals Online (AJOL)

van Stuyvenberg, Karen. Vol 66 (2014) - Articles Monitoring White-backed Vultures Gyps africanus in the North West Province (Stellaland), South Africa Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

Ideas on Moral and Civil Upbringing of Personality in Italian and Ukrainian Pedagogy during the Renaissance

Science.gov (United States)

Petruk, Natalia

2015-01-01

Important aspects of moral and civic upbringing of personality based on studying the experience of humanist pedagogy establishment in the Italian Renaissance in XIV-XV centuries and the Ukrainian Renaissance in XVI-XVII centuries have been reviewed in the article. It has been found out that under the influence of Renaissance in XVI-XVII centuries…

A economia política da população: poder e demografia no pensamento econômico britânico do século XVII The political economy of demographic management: power and population in XVII century British economic thought

Directory of Open Access Journals (Sweden)

Carlos E. Suprinyak

2008-12-01

Full Text Available Em seus escritos sobre a "governamentalidade", Foucault argumenta que a filosofia política, durante o início do período moderno, perpetrou uma mudança gradual no objeto de exercício do poder, deixando de lado o território para concentrar-se sobre a população. Neste artigo, buscamos associar essa idéia com o pensamento econômico britânico do século XVII, em que noções de gerência populacional estão sempre presentes - primeiramente com autores do início do século como Mun e Misselden, evoluindo então ao longo das décadas seguintes em estreita relação com doutrinas como a "aritmética política" vislumbrada por Petty e culminando no uso extensivo por parte de Davenant das estatísticas demográficas de Gregory King. Além disso, tentamos expor a ligação entre temas populacionais e alguns conceitos-chave então utilizados, mostrando que esses temas não possuíam motivação meramente militar, mas sim derivavam de uma percepção do trabalho como força criativa, à qual podemos associar os rudimentos de uma teoria do valor-trabalho.In his lectures on governmentality, Foucault argued that Early Modern Period's political theorizing was characterized by a gradual change in the object of political power, from territories to populations. We try to link this idea to the development of seventeenth-century British economic thought, in which notions of population management are constantly present - beginning with early pamphleteers like Mun and Misselden, developing along the subsequent decades in a close relationship with doctrines such as the "political arithmetic" envisaged by Petty, and culminating in the extensive use made by Davenant of the demographic statistics compiled by Gregory King. Moreover, we try to expose the connection between demographic themes and some key concepts then adopted, in an effort to show that they were not mere subsidiaries to military concerns, but instead were a direct corollary to a widespread notion

Introduction.Treasury and Economy in 17th century Castile Presentación. hacienda y economía en la castilla del siglo XVII

Directory of Open Access Journals (Sweden)

José Ignacio ANDRÉS UCENDO

2011-07-01

Full Text Available Tax system has been held accountable for the Castilian economic crisis in the seventeenth century. The tax burden probably was not greater than in other countries, but other factors like new taxes, the use and abuse of extraordinary receipts, and the changes in the ways of collections did not give incentives for commercial and urban activities, that was the base for the development of the markets. The articles included in this Dossier analyze some interesting questions about the consequences of the tax system upon the rural and urban economies, the donation of 1629, the public debt and the spend of local communities in infrastructures, that explain us how economy was upset by the Royal fiscal policy.La fiscalidad ha sido la gran culpable de la suerte que siguió la economía castellana en el siglo XVII. La presión fiscal no fue probablemente más acusada que en otros países, pero junto con la aparición de nuevas figuras fiscales, el uso y abuso de expedientes y los cambios en las formas de recaudación crearon poderosos desincentivos económicos que incidieron negativamente sobre las actividades comerciales y urbanas, de las que dependía el desarrollo de los mercados. Los trabajos incluidos en este Informe analizan algunas cuestiones de gran interés acerca de las repercusiones de la fiscalidad sobre las economías rurales y urbanas, el donativo de 1629, la deuda pública y el gasto en infraestructuras de las haciendas locales, que nos dan una idea de cómo la economía pudo verse afectada por la política fiscal de la Monarquía.

Identidad, imagen y (descortesía en Cartagena de Indias (siglo XVII. Diálogos surgidos desde el enfrentamiento étnico

Directory of Open Access Journals (Sweden)

Micaela Carrera De la Red

2015-12-01

Full Text Available Este trabajo se inserta en el marco teórico de la pragmática interpersonal histórica. Los datos analizados pertenecen a ritos de interacción tanto en habla referida como en diálogos contenidos en un juicio celebrado en la ciudad de Cartagena de Indias, fechado a finales del siglo XVII, y relacionado con la rebelión de los palenques.  El objetivo principal es mostrar que la actividad de la imagen es un elemento clave para el estudio de la interacción en un contexto de conflicto social e interétnico. La perspectiva sociológica adoptada es la del equilibrio entre el yo y la sociedad. En la sociedad estudiada, los individuos se encuentran integrados en figuraciones sociales, con la raza como factor de conformación de estos grupos y, a la vez, factor condicionante de la identidad del grupo social de los “negros” como estigmatizados y outsiders. El desorden social provoca la anomia de los participantes y la desorganización personal así como la perturbación de la integración de las acciones de los participantes (Goffman, 1961, citado por Smith 2006, pp. 33-54. En el análisis de la relación interpersonal sobresale el carácter dinámico del concepto de imagen y de actividad de imagen, ya que el proceso de comunicación es fruto de la co-construcción en la interacción cara a cara basada en el influjo ejercido por los turnos e intervenciones precedentes y consecuentes de los que interactúan (Arundale, 1999, pp. 119-153. Destaca también el hecho de que a través del análisis de las tensiones dialógicas se muestra cómo las estrategias de ‘(descortesía’ se interconectan con la ‘imagen social’ y esta se vincula, a su vez, con la ‘identidad social’.

Sobre os céus e as marés do Pacífico: as observações astronômicas do jesuíta Nicolás Mascardi (Chile, século XVII

Directory of Open Access Journals (Sweden)

Eliane Cristina Deckmann Fleck

2014-12-01

Full Text Available A atuação da Companhia de Jesus na América espanhola e portuguesa constitui-se em tema de várias investigações e obras, nas quais merece destaque a dedicação de seus religiosos ao ensino e à catequese. Alguns membros da Ordem, no entanto, se dedicaram, também, a observações de fenômenos naturais, da fauna e da flora nativas e, ainda, a aspectos da geografia dos territórios em que atuaram, legando-nos uma série de estudos informados através de cartas, relatórios ou obras. Nosso propósito neste artigo é o de apresentar e analisar os registros que o padre jesuíta italiano Nicolás Mascardi fez de suas observações astronômicas e, em especial, do estudo que realizou sobre as marés do arquipélago de Chiloé durante os anos em que atuou na então Vice-Província Jesuítica do Chile, no século XVII.

[Correlation of gene expression related to amount of ginseng saponin in 15 tissues and 6 kinds of ginseng saponin biosynthesis].

Science.gov (United States)

Wang, Kang-yu; Zhang, Mei-ping; Li, Chuang; Jiang, Shi-cui; Yin, Rui; Sun, Chun-yu; Wang, Yi

2015-08-01

Fifteen tissues of 4-year-old fruit repining stage Jilin ginseng were chosen as materials, six kinds of monomer saponins (ginsenosides Rg1, Re, Rb1, Rc, Rb2 and Rd) content in 15 tissues was measured by HPLC and vanillin-sulfuric acid method. The relative expression of FPS, SQS, SQE, OSC, β-AS and P450 genes in 15 tissues was analyzed by real-time PCR. The correlations between ginseng saponin content in 15 tissues of Jilin ginseng and biosynthetic pathway -related genes were obtained. The results showed that was a synergistic increase and decrease trend of positive linear correlation among six kinds of monomer saponin content, and there was a significantly (P saponin content and total saponins content. Monomer saponin content and 6 kinds of enzyme gene correlation were different. Biosynthesis of ginseng total saponins and monomer saponin were regulated by six kinds of participation ginsenoside biosynthesis enzyme genes, the expression of these six kinds of genes in different tissues of ginseng showed collaborative increase and decrease trend, and regulated biosynthesis of ginseng ginsenoside by group coordinative manner.

Ginseng and obesity: observations and understanding in cultured cells, animals and humans.

Science.gov (United States)

Zhang, Longyun; Virgous, Carlos; Si, Hongwei

2017-06-01

Ginseng, a traditional medical herb, has been reported having beneficial effects in fatigue, heart diseases, diabetes, immune function and erectile dysfunction. In recent years, increasing investigations have been conducted on ginseng in preventing and treating of obesity, one of the major worldwide escalating public health concerns. However, the effect and the relevant mechanisms behind how ginseng works as an antiobesity treatment are still controversial. In this review, we briefly discussed the chemical structures, metabolism and pharmacokinetics of ginseng and its major bioactive components ginsenosides. The major focus is on the antiobesity effects and the physiological, cellular and molecular mechanisms of ginseng and its ginsenosides in cultured cells, animal models and humans. We particularly compared the ginsenosides profiles, the antiobesity effects and the mechanisms between Asian ginseng (Panax ginseng) and American ginseng (Panax quinquefolius), the two major ginseng species having opposite medical effects in traditional Chinese medicine. Our unpublished data on the ginseng antiobesity in cultured cells and mice were also included. We further addressed the current problems and future directions of the ginseng antiobesity research. Copyright © 2016 Elsevier Inc. All rights reserved.

Ninjin'yoeito and ginseng extract prevent oxaliplatin-induced neurodegeneration in PC12 cells.

Science.gov (United States)

Suzuki, Toshiaki; Yamamoto, Ayano; Ohsawa, Masahiro; Motoo, Yoshiharu; Mizukami, Hajime; Makino, Toshiaki

2015-10-01

Ninjin'yoeito (NYT) is a formula of Japanese traditional kampo medicine composed of 12 crude drugs, and is designed to improve the decline in constitution after recovery from disease, fatigue, anemia, anorexia, perspiration during sleep, cold limbs, slight fever, chills, persistent cough, malaise, mental disequilibrium, insomnia, and constipation. Oxaliplatin (L-OHP) is a platinum-based anticancer drug used to treat colorectal, pancreatic, and stomach cancers. However, it often causes acute and chronic peripheral neuropathies including cold allodynia and mechanical hyperalgesia. In this study, we investigated the preventive effects of NYT on neuronal degeneration caused by L-OHP using PC12 cells, which are derived from the rat adrenal medulla and differentiate into nerve-like cells after exposure to nerve growth factor. L-OHP treatment decreased the elongation of neurite-like projection outgrowths in differentiated PC12 cells. When PC12 cells were treated with NYT hot water extract, neurodegeneration caused by L-OHP was significantly prevented in a concentration-dependent manner. Among the 12 crude drugs composing NYT, the extract of Ginseng (the root of Panax ginseng) exhibited the strongest preventive effects on neurodegeneration in differentiated PC12 cells. By activity-guided fractionation, we found that the fraction containing ginsenosides displayed preventive activity and, among several ginsenosides, ginsenoside F2 exhibited significant preventive effects on L-OHP-induced decreases in neurite-like outgrowths in differentiated PC12 cells. These results suggest that NYT and ginseng are promising agents for preventing L-OHP-induced neuropathies and present ginsenoside F2 as one of the active ingredients in ginseng.

Ginsenoside Rb1 protects against 6-hydroxydopamine-induced oxidative stress by increasing heme oxygenase-1 expression through an estrogen receptor-related PI3K/Akt/Nrf2-dependent pathway in human dopaminergic cells

International Nuclear Information System (INIS)

Hwang, Yong Pil; Jeong, Hye Gwang

2010-01-01

Phytoestrogens are polyphenolic non-steroidal plant compounds with estrogen-like biological activity. Ginseng, the root of Panax ginseng C.A. Meyer (Araliaceae), is a popular traditional herbal medicine. Ginsenoside Rb1 (Rb1), an active component commonly found in ginseng root, is a phytoestrogen that exerts estrogen-like activity. In this study, we demonstrate that the phytoestrogen Rb1 inhibits 6-hydroxydopamine (6-OHDA)-induced oxidative injury via an ER-dependent Gβ1/PI3K/Akt and heme oxygenase-1 (HO-1) pathway. Pretreatment of SH-SY5Y cells with Rb1 significantly reduced 6-OHDA-induced caspase-3 activation and subsequent cell death. Rb1 also up-regulated HO-1 expression, which conferred cytoprotection against 6-OHDA-induced oxidative injury. Moreover, Rb1 induced both Nrf2 nuclear translocation, which is upstream of HO-1 expression and PI3K activation, a pathway that is involved in induced Nrf2 nuclear translocation, HO-1 expression and cytoprotection. Also, Rb1-mediated increases in PI3K activation and HO-1 induction were reversed by co-treatment with ICI 182,780 and pertussis toxin. Taken together, these results suggest that Rb1 augments the cellular antioxidant defenses through ER-dependent HO-1 induction via the Gβ1/PI3K/Akt-Nrf2 signaling pathway, thereby protecting cells from oxidative stress. Thus our study indicates that Rb1 has a partial cytoprotective role in dopaminergic cell culture systems.

Confirmed organophosphorus and carbamate pesticide poisonings in South African wildlife (2009–2014

Directory of Open Access Journals (Sweden)

Christo J. Botha

2015-12-01

Full Text Available During a six-year period (from January 2009 to December 2014, specimens collected from 344 cases of suspected organophosphorus and carbamate pesticide poisonings in wildlife, including birds, were submitted to the Toxicology Laboratory (ARC-OVI for analysis. A positive diagnosis was made in 135 (39% of these cases. The majority of cases were from birds, which included Cape vultures (Gyps coprotheres and African white-backed vultures (Gyps africanus and bateleur eagles (Terathopius ecaudatus. In one incident 49 vultures were killed when a farmer intentionally laced carcasses with carbofuran in an attempt to control jackal predation. There were 22 incidents of poisoning in helmeted guineafowl (Numida meleagris. On nine different occasions blue cranes (Anthropoides paradiseus were poisoned, in one incident 14 birds were reported to have been killed. Over the period of investigation, there were 20 cases of poisoning involving mammalian species, the majority being vervet monkeys (Chlorocebus pygerythrus. The carbamate pesticides were responsible for 57 incidents of poisoning. Aldicarb, carbofuran and methomyl were detected in 26, 18 and 12 cases respectively. The majority of organophosphorus pesticide poisonings were caused by diazinon (n = 19, monocrotophos (n = 13 and methamidophos (n = 10.

Las múltiples dimensiones de un concreto: Prácticas, actores, redes y contratos. Notas sobre el abordaje del crédito en los márgenes hispanoamericanos de Antiguo Régimen [Buenos Aires, siglo XVII

Directory of Open Access Journals (Sweden)

Martín Leandro Ezequiel Wasserman

2010-11-01

Full Text Available Proponemos mediante el presente artículo recorrer algunas de las dimensiones que, interrelacionadas, contribuyeron a la constitución del fenómeno crediticio en Buenos Aires durante el siglo XVII. La incidencia de una estructura social estatutaria, la morfología adquirida por el conjunto de vínculos crediticios interpersonales, el enlace de ese conjunto relacional con las redes de relaciones establecidas, la función de la institución notarial y de los dispositivos contractuales por ésta provistos, así como las constricciones legales que signaron la economía rioplatense del seiscientos, conformaron algunos de los elementos que asignaron al crédito formalizado una función económica y social singular. Una publicación académica orientada al estudio de sociedades precapitalistas ofrece por ello un espacio propicio para plantear algunos de los ejes problemáticos vinculados a nuestro objeto de investigación. Con esta presentación se espera un diálogo crítico que enriquezca las perspectivas que ofrecemos, ancladas en las fuentes pero mantenidas aún en el nivel de las hipótesis de nuestro trabajo

Demonstration of Antimicrobial Corrosion-Resisting Interior Coating Systems for Military Facilities in Warm, Humid Locations

Science.gov (United States)

2017-06-01

solutions in civil and military engineering, geospatial sciences, water resources, and environmental sciences for the Army, the Department of Defense...was unexpectedly upgraded soon after the demonstration coatings were applied, apparently due to a scheduling change or miscommunication re- lated...oils and grease, so no cleaning solution was needed. Sherwin Williams ProMar 200 acrylic primer was used to prime all gyp- sum surfaces that were

Mayor gloria de Dios es que lo sea una mujer... Sor María de Jesús de Ágreda y Sor Francisca Josefa de la Concepción del Castillo (sobre la escritura conventual en los siglos XVI y XVII

Directory of Open Access Journals (Sweden)

Ferrús Antón, Beatriz

2008-06-01

Full Text Available During the 16th and 17th centuries the convents were the best space for women’s writing. A Spanish nun, Sor María de Jesús de Ágreda, and a Latin-American nun, Sor Francisca Josefa de la Concepción del Castillo, are two of the most important writers of that time, and they serve like a example to comment the feminine writing in the convent. The autobiography, as a space for self analysis, receives a special attention.Durante los siglos XVI y XVII, los conventos se convirtieron en el espacio privilegiado para la escritura femenina. Una monja española, Sor María de Jesús de Ágreda, y otra latinoamericana Sor Francisca Josefa de la Concepción del Castillo, autoras de textos de referencia para las letras de su tiempo, nos sirven de ejemplo para analizar las claves de la escritura femenina (conventual durante estos siglos. La narración autobiográfica, como espacio de expresividad y autoanálisis femenino recibe aquí una especial atención.

Active compounds in Chinese herbs and medicinal animal products which promote blood circulation via inhibition of Na+, K+-ATPase.

Science.gov (United States)

Tzen, Jason Tc; Chen, Ronald Jy; Chung, Tse-Yu; Chen, Yi-Ching; Lin, Nan-Hei

2010-01-01

The therapeutic effect of cardiac glycosides for congestive heart failure lies in their reversible inhibition on Na+, K+-ATPase located in human myocardium. Several steroid-like compounds containing a core structure similar to cardiac glycosides have been found in many Chinese herbs and medicinal animal products conventionally used to promote blood circulation. They are putatively responsible for the therapeutic effect of those medicinal products via the same mechanism of inhibiting Na+, K+-ATPase. Inhibitory potency on Na+, K+-ATPase by ginsenosides, one of the identified steroid-like compounds, is significantly affected by sugar attachment that might cause steric hindrance of their binding to Na+, K+-ATPase. Ginsenosides with sugar moieties attached only to the C-3 position of the steroid-like structure, equivalent to the sugar position in cardiac glycosides, substantially inhibit Na+, K+-ATPase. However, their inhibitory potency is abolished when sugar moieties are linked to the C-6 or C-20 position of the steroid-like structure. In contrast, no appreciable contents of steroid-like compounds are found in danshen, a well-known Chinese herb traditionally regarded as an effective medicine promoting blood circulation. Instead, magnesium lithospermate B (MLB), the major soluble ingredient in danshen, is assumed to be responsible for the therapeutic effect by inhibiting Na+, K+-ATPase in a manner comparable to cardiac glycosides. Neuroprotective effects of cardiac glycosides, ginsenosides and MLB against ischemic stroke were accordingly observed in a cortical brain slice-based assay model. Whether the neuroprotection is also triggered by inhibition of Na+, K+-ATPase remains to be investigated. Molecular modeling suggests that cardiac glycosides, ginsenosides and MLB presumably bind to the same extracellular pocket of the Na+, K+-ATPase alpha subunit.

Effects of Temperature variations on the Super Fine Powderization of Korean Cultivated Wild Ginseng

Directory of Open Access Journals (Sweden)

Jin Ho Kim

2006-12-01

Full Text Available Objectives : The aim of this study was to find optimal conditions for producing red ginseng from cultivated wild ginseng using the Turbo Mill. Methods : Characteristics of powdered cultivated wild ginseng based on various temperature settings of the Turbo Mill were observed, and changes in the content was measured by HPLC for various ginsenosides. Results : 1. The diameter of cultivated wild ginseng powder ground by the Turbo Mill was around 10㎛. 2. As the temperature rose, presusre, Specific Mechanical Energy(SME, and density decreased, whileas Water Solubility Index(WSI increased. 3. As the temperature rose, super fine powder showed tendency to turn into dark brown. 4. Measuring content changes by HPLC, there was no detection of ginsenoside Rg3 and ginsenosideRg1, Rb1, and Rh2 concentrations decreased with increase in temperature. Conclusions : Super fine powder of cultivated wild ginseng produced by the Turbo Mill promotes easy absorption of effective ingredients by breaking the cell walls. Using this mechanism to produce red ginseng from cultivated wild ginseng, it yielded less than satisfactory results under the current experiment setup. Furtherresearches are needed to verify more suitable condition for the production of red ginseng.

"Teorías de la percepción visual y aristotelismo entre los siglos XV y XVII: una aproximación" [A preliminary approach on theories of visual perception and aristotelianism in the fifteenth to seventeenth centuries

Directory of Open Access Journals (Sweden)

José Javier Benéitez Prudencio

2011-01-01

Full Text Available RESUMEN:Entre los siglos XV y principios del XVII la explicación aristotélica todavía garantizaba una idea de percepción visual exacta y digna de confianza, en especial la que se refiere a aquellas facultades humanas pertenecientes a la conocida como ‘alma sensitiva’. Considerando los términos generales en que dicha teoría se planteaba, reputada por otro lado por la literatura médica, psicológica y moral del momento, lo que en este ensayo pretendo poner de relieve son las influencias de dicha teoría aristotélica en el panorama intelectual europeo antes de Descartes.ABSTRACT:Visual perception and cognition deemed to be accurate and reliable were secured between the fifteenth and the very beginning seventeenth centuries largely by the Aristotelian theory, especially those human faculties belonging to what was called the ‘sensible soul’. In terms of this theory, recounted throughout the medical, psychological and moral literature of early Modern Age, I wish to emphasize in this paper the Aristotelian theoretical influences in the intellectual culture of pre-Cartesian Europe.

Nursing leadership: a concise encyclopedia

National Research Council Canada - National Science Library

Feldman, Harriet R

2008-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xiii Contributors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xvii Foreword . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xxv...

Cape Vulture Gyps coprotheres caught in gin trap

African Journals Online (AJOL)

campbell

its right foot fly into its nest situated on a cliff face and containing a large chick. The chain used to tether the trap to the ground could be clearly seen dangling below the flying bird. We have no way of knowing whether the deployment of this trap was accidental or intentional relative to its having caught a Cape Vulture.

La expedición del padre Nicolás Mascardi a la Patagonia: una experiencia sobre las posibilidades y los límites del conocimiento en el siglo XVII

Directory of Open Access Journals (Sweden)

Constanza Acuña Fariña

2015-03-01

Full Text Available En 1670 el jesuita Nicolás Mascardi (Sarzana 1624, Río Deseado 1674 dirigió la refundación de la misión de Nahuel Huapi. Siguiendo los pasos de su antecesor Diego de Rosales quiso establecer una reducción indígena para puelches, poyas y tehuelches, punto de partida de misiones “volantes” hasta el estrecho de Magallanes. A partir del estudio de las cartas que Mascardi envió a su maestro Athanasius Kircher desde el sur de Chile, el presente trabajo pretende analizar cómo confluyen en el proyecto del jesuita italiano la imaginación barroca, la mentalidad y las prácticas del siglo XVII, para tratar de entender por qué su plan se precipitó bajo los acontecimientos históricos que marcaron la deriva de su proyecto misionero y su temprana muerte a manos de los tehuelches. El encuentro de concepciones culturales, las estrategias de dominio geográfico y la defensa de mundos simbólicos, son los hilos conductores que guían las principales preguntas y supuestos de este trabajo. La misión de Mascardi constituiría un ejemplo para comprender bajo qué principios y contradicciones se impuso el concepto de civilización en el proceso de colonización americana.

Impact of miR-208 and its Target Gene Nemo-Like Kinase on the Protective Effect of Ginsenoside Rb1 in Hypoxia/Ischemia Injuried Cardiomyocytes

Directory of Open Access Journals (Sweden)

Xu Yan

2016-09-01

Full Text Available Background/Aims: Ginsenoside Rb1 (GS-Rb1 is one of the most important active pharmacological extracts of the Traditional Chinese Medicine ginseng, with extensive evidence of its cardioprotective properties. Mir-208 has been shown to act as a biomarker of acute myocardial infarction in vivo studies including man. However the impact of miR-208 on the protective effect of GS-Rb1 in hypoxia/ischemia injured cardiomyocytes remains unclear. The current study aims to investigate the target gene of miR-208 and the impact on the protective effect of GS-Rb1 in hypoxia/ischemia (H/I injuried cardiomyocytes. Materials and Methods: Primary cultures of neonatal rat cardiomyocytes (NRCMs was subjected to the H/I conditions with or without GS-Rb1. Cell viability was calculated by MTT assay and confirmed by flow cytometry analysis. Mir-208 was then detected by qRT-PCR. Luciferase reporter assay was carried out to detect the target gene of Mir-208. Then the NRCMs were transfected with miR-208 mimics and inhibitors to evaluate the impact on cardioprotective properties of Rb1. Results: The miR-208 expression level was clearly upregulated in the H/I treated NRCMs accompanied by the percentage of the apoptotic cells which could be reversed by GS-Rb1 pretreatment. The nemo-like kinase (NLK mRNA and protein expression levels were decreased in H/I group measured by RT-PCR and western blotting. Luciferase activity assay was then carried out to identify that NLK may be a direct target of mir-208. MTT assay showed that miR-208 inhibitor slightly decreased the protective effect of Rb1 on the H/I impaired NRCMs. However, results showed no statistical difference. Conclusions: These findings proved that NLK was a direct target of mir-208 and miR-208 act indirectly during Rb1 protecting H/I impaired NRCMs and further researches were needed to explore the relationship that microRNAs and other signal pathways in the protective effect of GS-Rb1 on the hypoxia/ischemia injuries in

Protective effects of panax notoginseng saponins on cardiovascular diseases: a comprehensive overview of experimental studies.

Science.gov (United States)

Yang, Xiaochen; Xiong, Xingjiang; Wang, Heran; Wang, Jie

2014-01-01

Panax notoginseng saponins (PNS) are one of the most important compounds derived from roots of the herb Panax notoginseng which are traditionally used as a hemostatic medicine to control internal and external bleeding in China for thousands of years. To date, at least twenty saponins were identified and some of them including notoginsenoside R1, ginsenoside Rb1, and ginsenoside Rg1 were researched frequently in the area of cardiovascular protection. However, the protective effects of PNS on cardiovascular diseases based on experimental studies and its underlying mechanisms have not been reviewed systematically. This paper reviewed the pharmacology of PNS and its monomers Rb1, Rg1, and R1 in the treatment for cardiovascular diseases.

Protective Effects of Panax Notoginseng Saponins on Cardiovascular Diseases: A Comprehensive Overview of Experimental Studies

Directory of Open Access Journals (Sweden)

Xiaochen Yang

2014-01-01

Full Text Available Panax notoginseng saponins (PNS are one of the most important compounds derived from roots of the herb Panax notoginseng which are traditionally used as a hemostatic medicine to control internal and external bleeding in China for thousands of years. To date, at least twenty saponins were identified and some of them including notoginsenoside R1, ginsenoside Rb1, and ginsenoside Rg1 were researched frequently in the area of cardiovascular protection. However, the protective effects of PNS on cardiovascular diseases based on experimental studies and its underlying mechanisms have not been reviewed systematically. This paper reviewed the pharmacology of PNS and its monomers Rb1, Rg1, and R1 in the treatment for cardiovascular diseases.

Un manual español de administración y contabilidad señorial de principios de siglo XVII: el compendio en materia de acrecentar Estado y hazienda, tocante al oficio de contador, de Gabriel Pérez del Barrio Angulo. (A Spanish guide book on administration and accounting of the early 17th Century: the compendium for the increase of the state and treasury, with regards to the post of accountant, by Gabriel Pérez del Barrio Angulo)

OpenAIRE

González Ferrando, José Mª

2013-01-01

Frente a lo ocurrido en Inglaterra, donde cuentan con manuscritos sobre administración y contabilidad señorial desde el siglo XIII, en España sólo se conocen hasta ahora cuatro textos de los siglos XV al XVII en que sus autores se ocupan con mayor o menor detalle de este asunto, pero de los que sólo uno, publicado inicialmente en 1613, puede equipararse en cierto modo a los ingleses: el ‘Compendio en razón de acrecentar Estado y Hacienda y Oficio de Contador’ de Gabriel Pérez del Barrio. (Aga...

Application of gamma irradiation in ginseng for both photodegradation of pesticide pentachloronitrobenzene and microbial decontamination

Energy Technology Data Exchange (ETDEWEB)

Wen, Hsiao-Wei [Department of Food Science and Biotechnology, National Chung Hsing University, 250, Kuo Kuang Road, Taichung 402, Taiwan (China); Hsieh, Ming-Fa [Department of Biomedical Engineering, Chung Yuan Christian University, 200, Chung Pei Road, Chungli 320, Taiwan (China); Wang, Ya-Ting; Chung, Hsiao-Ping [Nuclear Science and Technology Development Center, National Tsing Hua University, 101 Section 2, Kuang Fu Road, Hsinchu 300, Taiwan (China); Hsieh, Po-Chow; Lin, I-Hsin [Committee on Chinese Medicine and Pharmacy, Department of Health, Executive Yuan, Taipei 104, Taiwan (China); Chou, Fong-In, E-mail: fichou@mx.nthu.edu.tw [Nuclear Science and Technology Development Center, National Tsing Hua University, 101 Section 2, Kuang Fu Road, Hsinchu 300, Taiwan (China); Institute of Nuclear Engineering and Science, National Tsing Hua University, 101 Section 2, Kuang Fu Road, Hsinchu 300, Taiwan (China)

2010-04-15

This study investigates the feasibility of using gamma irradiation for photodegradation of a common residual fungicide, pentachloronitrobenzene (PCNB), in ginseng, and for microbial decontamination. American ginseng, Panax quinquefolius, was subjected to gamma irradiation. PCNB residues were analyzed by gas chromatography with electron capture detection and mass spectrometry. Eighty percent of PCNB (100 ppm) in a methanol aqueous solution was degraded by 5 kGy irradiation, and the primary degradation product was pentachloroaniline. Furthermore, contaminated PCNB (3.7 ppm) in ginseng were reduced to 0.2 ppm after 20 kGy irradiation. The IC{sub 50} for treatment of Sclerotium rolfsii with 20 kGy irradiated PCNB was about 2.7 times higher than that for treatment with unirradiated PCNB. The survival rate of mouse fibroblast L929 cells treated with 20 kGy irradiated PCNB was about 12.9% higher than that of L929 cells treated with unirradiated PCNB. Additionally, after 20 kGy irradiation, less than 5% reduction of contents of ginsenoside Rb1 and Re were observed, and amounts of ginsenosides Rc, Rd, and Rg1 were not reduced significantly. The minimal gamma dose for microbial decontamination was 10 kGy. Therefore, gamma irradiation can be used for both PCNB photodegradation and microbial decontamination of ginseng without obvious loses of ginsenoside contents.

Screening SIRT1 Activators from Medicinal Plants as Bioactive Compounds against Oxidative Damage in Mitochondrial Function

Directory of Open Access Journals (Sweden)

Yi Wang

2016-01-01

Full Text Available Sirtuin type 1 (SIRT1 belongs to the family of NAD+ dependent histone deacetylases and plays a critical role in cellular metabolism and response to oxidative stress. Traditional Chinese medicines (TCMs, as an important part of natural products, have been reported to exert protective effect against oxidative stress in mitochondria. In this study, we screened SIRT1 activators from TCMs and investigated their activities against mitochondrial damage. 19 activators were found in total by in vitro SIRT1 activity assay. Among those active compounds, four compounds, ginsenoside Rb2, ginsenoside F1, ginsenoside Rc, and schisandrin A, were further studied to validate the SIRT1-activation effects by liquid chromatography-mass spectrometry and confirm their activities against oxidative damage in H9c2 cardiomyocytes exposed to tert-butyl hydroperoxide (t-BHP. The results showed that those compounds enhanced the deacetylated activity of SIRT1, increased ATP content, and inhibited intracellular ROS formation as well as regulating the activity of Mn-SOD. These SIRT1 activators also showed moderate protective effects on mitochondrial function in t-BHP cells by recovering oxygen consumption and increasing mitochondrial DNA content. Our results suggested that those compounds from TCMs attenuated oxidative stress-induced mitochondrial damage in cardiomyocytes through activation of SIRT1.

TIEMPO Y RITUAL. UNA APROXIMACIÓN AL ANÁLISIS DE LAS REPRESENTACIONES DEL ORDEN EN LA SOCIEDAD COLONIAL(GOBERNACIÓN DEL TUCUMÁN, SIGLOS XVII Y XVIII / Time and ritual. An approach to the analysis of the order representation in colonial Tucumán´s society.

Directory of Open Access Journals (Sweden)

Silvina Smietniansky

2010-12-01

Full Text Available Este trabajo de carácter exploratorio constituye una primera aproximación al análisis de las experiencias y los sentidos del tiempo implicados en las representaciones del orden social, según lo han vivido y significado los vecinos y los funcionarios de gobierno en Indias durante el período colonial. Nos proponemos desarrollar un estudio comparativo de las  instituciones del cabildo y los juicios de residencia, basado en el examen de un conjunto de documentos  de gobierno y justicia relativos a la gobernación del Tucumán durante los siglos XVII y XVIII y organizado a partir de dos interrogantes centrales. Por un lado, interesa abordar cómo se configuraban  y articulaban dos experiencias del tiempo diversas -un tiempo local y cotidiano y, otro tiempo que denominamos regio y ritual-; y por otro lado, exploramos de qué manera el carácter tradicional y formalizado de las prácticas que los cabildantes y los participantes del juicio de residencia desarrollaban en los contextos institucionales, contribuía a construir una representación del orden social figurado de gran estabilidad y anclado en un tiempo de larga duración.Palabras clave: tiempo; ritual; cabildos; juicio de residencia; Tucumán colonialAbstractThis exploratory work constitutes an approach to the analysis of time experiences y meanings that were implies in social order representation according to the lives and perspectives of  the vecinos and government functionaries in Indias during the colonial period. We intend to develop a comparative study of the cabildo and juicio de residencia institutions, based on the exam of a set of government and justice documents relative to the Tucumán province during XVII and XVIII centuries, and organized upon to tow central questions. On one side, we are interested on how two different time experience –a local and ordinary time, and another time that we called regal and ritual- were configured and articulated; and on the other side, we

Las otras mitas. Aproximaciones al estudio de la mita de plaza en la jurisdicción de Jujuy, gobernación de Tucumán, siglo XVII

Directory of Open Access Journals (Sweden)

Sica, Gabriela

2014-06-01

Full Text Available The objective of this paper is to analyze the conformation mita system of place in the jurisdiction of San Salvador de Jujuy in the governorate of Tucumán during the seventeenth century. The mita was one of economic institutions on which rested the colonial system in the Andes, and helped to ensure the supply of Indian labor is poured to public works or different economic activities such as mining, agriculture, livestock, dairy services, etc. For indigenous communities was a load of a percentage of tax that they leave their own activities and often travel a considerable distance, while for other sectors such as mining, without encomiendas neighbors and authorities was an important contribution of labor, therefore became a field of dispute and tension between different sectors throughout the seventeenth century.El objetivo de este artículo es analizar la conformación de la mita de plaza en la jurisdicción de San Salvador de Jujuy en la gobernación de Tucumán durante el siglo XVII. La mita era una de las instituciones económicas sobre las que reposaba el sistema colonial en los Andes, y permitió garantizar el aporte de trabajo indígena que se volcaba a las obras públicas o diferentes actividades económicas como la minería, agricultura, ganadería, servicios de tambos, etc. Para las comunidades constituía una carga de un porcentaje de sus tributarios que debían abandonar sus propias actividades y en muchos casos trasladarse a considerable distancia, mientras que para distintos sectores como mineros, vecinos sin encomiendas y autoridades era una importante contribución de mano de obra, por esta razón se convirtió en un campo de disputa y tensiones entre los distintos sectores.

Database on wind characteristics - Structure and philosophy

Energy Technology Data Exchange (ETDEWEB)

Larsen, G.C.; Hansen, K.S.

2001-11-01

The main objective of IEA R and D Wind Annex XVII - Database on Wind Characteristics - is to provide wind energy planners and designers, as well as the international wind engineering community in general, with easy access to quality controlled measured wind field time series observed in a wide range of environments. The project partners are Sweden, Norway, U.S.A., The Netherlands, Japan and Denmark, with Denmark as the Operating Agent. The reporting of IEA R and D Annex XVII falls in three separate parts. Part one deals with the overall structure and philosophy behind the database, part two accounts in details for the available data in the established database bank and part three is the Users Manual describing the various ways to access and analyse the data. The present report constitutes the first part of the Annex XVII reporting, and it contains a detailed description of the database structure, the data quality control procedures, the selected indexing of the data and the hardware system. (au)

[Induction of hairy roots of Panax ginseng and studies on suitable culture condition of ginseng hairy roots].

Science.gov (United States)

Zhao, Shou-Jing; Li, Chang-Yu; Qian, Yan-Chun; Luo, Xiao-Pei; Zhang, Xin; Wang, Xue-Song; Kang, Bo-Yu

2004-03-01

Ginseng is a valuable medicinal plant with ginsenosides as its mian effective components. Because ginseng is a perennial plant and has a very strict demand for soil conditions, the way of cultivating ginseng by cutting woods is still used in China at present and thus forest resources has been extremely destroyed. Increasing attention has been paid to the hairy roots induced by the infection of Agrobacterium rhizogenes in the production of plant secondary metabolic products for the hairy roots are characterized by rapid growth and stable hereditary and biochemical traits. That has opened a new way for the industrial production of ginseosides. However, there is little report for such studies from China. In this paper, hairy roots of ginseng were induced from the root explants of two-year-old ginseng by Agrobacterium rhizogenes A4 with directly inoculating. The transformed hairy roots could grow rapidly on MS medium and 1/2 MS medium without hormones. The cultured clones of the hairy roots were established on a solid 1/2 MS medium. After 4 - 5 subcultures the hairy roots still maintained a vigorous growth. A pair of primers were designed and synthesized according to the analytical results of RiA4TL-DNA sequence by Slightom et al . 0.8kb rolC was obtained by PCR using the genome DNA of hairy root of ginseng. Transformation was confirmed by PCR amplification of rolC genes from the hairy roots of P. ginseng. Growth rate of hairy roots on liquid medium increased by 2 times then that of the solid medium. The growth of the hairy roots can be divided into three stages: high speed in the first two weeks, middle speed in the 3 - 4 weeks and low speed hereafter. Changing the culture solution at 2 weeks regular intervals is conductive to maintaining the rapid growth of the hairy roots. By means of determination for specific growth rate and ginsenosides content, the high-yield hairy root clone R9923 was selected. The content of monomer gisenoside of Rg1, Re, Rf, Rbl, Rc, Rb2 and

Participants in a medical applications meeting hosted by CERN Head of Medical Applications S. Myers with J. E. Celis, Chairman of the Policy Committee, European Cancer Organisation, President, European Association for Cancer Research and Prof. JM. Gago, President of Laboratório de Instrumentação e Física Experimental de Partículas (LIP) and Former Minister for Science, Technology and Higher Education of Portugal of the XVII Governo. Were also participating: CERN Life Science Adviser M. Dosanjh with U. Ringborg R. Lewensohn, A. Brahme, R. Moeckli, O. Jäkel and S. Pieck.

CERN Multimedia

Anna Pantelia

2013-01-01

Participants in a medical applications meeting hosted by CERN Head of Medical Applications S. Myers with J. E. Celis, Chairman of the Policy Committee, European Cancer Organisation, President, European Association for Cancer Research and Prof. JM. Gago, President of Laboratório de Instrumentação e Física Experimental de Partículas (LIP) and Former Minister for Science, Technology and Higher Education of Portugal of the XVII Governo. Were also participating: CERN Life Science Adviser M. Dosanjh with U. Ringborg R. Lewensohn, A. Brahme, R. Moeckli, O. Jäkel and S. Pieck.

Aircraft propulsion and gas turbine engines

National Research Council Canada - National Science Library

El-Sayed, Ahmed F

2008-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . xvii xxxi xxxiii xxxv Part I Aero Engines and Gas Turbines . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . C...

СИМВОЛІКА В МИСТЕЦЬКІЙ СПАДЩИНІ ГЕРБУРТІВ У ГАЛИЧИНІ XІV – ХХІ СТОЛІТТЯХ

OpenAIRE

Олег Цебенко

2015-01-01

Are considered the role of symbols in formation and establishment of monumental art in the early XVII –XXI centuries of Galicia. An important sign-symbol is coat of arms, emblem-symbolic system of which had developed and established in Ukraine in XIV–XV centuries. The attention is paid to the art activities of Jan Szczasny Herburt. Thanks to his fixing points its content were materialized in the creation of pictures in the early XVII century in Dobromyl castle of Herburts. In the article are ...

[Research on quality changes in ginseng stems and leaves before and after frost].

Science.gov (United States)

Zhao, Yan; Ma, Shuang; Cai, En-Bo; Liu, Shuang-Li; Yang, He; Zhang, Lian-Xue; Wang, Shi-Jie

2014-08-01

The present study is to investigate the quality changes of ginseng stems and leaves before and after frost. The contents changes of ginsenoside, free amino acid, and total phenolic compounds, as well as DPPH radical scavenging effect before and after frost were measured. The content of 9 ginsenoside monomer in ginseng stems was decreased except for Rg, and Re after frost, but in ginseng leaves was all decreased. The total content of amino acids was decreased in ginseng stems after frost, while increased in ginseng leaves. The content of phenolic compounds in ginseng stems and leaves were both decreased after frost while the ability of DPPH radical scavenging was improved. The factor of frost has great impact on the quality of ginseng stems and leaves.

Entre la doble vara y el privilegio. La administración de la justicia frente al fenómeno de la sodomía masculina en el Virreinato del Perú (Siglos XVI-XVII

Directory of Open Access Journals (Sweden)

Molina, Fernanda

2014-08-01

Full Text Available This paper investigates the both the civil and Episcopal legal actions taken on issues on issues related to the crime of sodomy in the Viceroyalty of Peru during the 16th and 17th centuries. The extent to which family, social and ethnic background, as well as the relationship of the accused with powerful networks or groups influenced the actions taken by the magistrates and the fulmination of the causes is a particular focus point of the study. Additionally, within the scope of these trials for sodomy, how the granting of privileges and corporate logic also served as possible effective mechanisms used to manipulate and avoid legal provisions is also examined.Este artículo indaga en la actuación de la justicia tanto civil como episcopal en asuntos relativos al delito de sodomía en el Virreinato del Perú entre los siglos XVI y XVII. Particularmente, analiza en qué medida los orígenes familiares, sociales y étnicos de los acusados así como su pertenencia a redes o grupos de poder pudieron influir en la actuación de los magistrados y en la fulminación de las causas. Asimismo, en el marco de los procesos seguidos por sodomía, examina cómo los fueros y la lógica corporativa también pudieron constituir mecanismos eficaces a fin de manipular y eludir las disposiciones judiciales.

Богородичні дива в літературному дискурсі Димитрія Туптала та Іоана Максимовича

OpenAIRE

Matushek, Оlena

2016-01-01

Relevance of the topic is to explore ways to preserve confessional identity in the texts of the ecclesiastical figures of the XVII-th century. This is important not only for investigation of Baroque culture, but also for understanding the contemporary church politics.The purpose of this work to study the function of sacred images in the literary discourse of the second half of the XVII- th century.In this article this icon is considered as a literary image  in the   books   «Runo  oroshennoye...

Effect of Ginseng (Panax ginseng Berry EtOAc Fraction on Cognitive Impairment in C57BL/6 Mice under High-Fat Diet Inducement

Directory of Open Access Journals (Sweden)

Chang Hyeon Park

2015-01-01

Full Text Available High-fat diet-induced obesity leads to type 2 diabetes. Recently, there has been growing apprehension about diabetes-associated cognitive impairment (DACM. The effect of ginseng (Panax ginseng berry ethyl acetate fraction (GBEF on mice with high-fat diet-induced cognitive impairment was investigated to confirm its physiological function. C57BL/6 mice were fed a high-fat diet for 5 weeks and then a high-fat diet with GBEF (20 and 50 mg/kg of body weight for 4 weeks. After three in vivo behavioral tests (Y-maze, passive avoidance, and Morris water maze tests, blood samples were collected from the postcaval vein for biochemical analysis, and whole brains were prepared for an ex vivo test. A method based on ultra-performance liquid chromatography (UPLC accurate-mass quadrupole time-of-flight mass spectrometry (Q-TOF/MS was used to determine major ginsenosides. GBEF decreased the fasting blood glucose levels of high-fat diet-induced diabetes mellitus (DM mice and improved hyperglycemia. Cognitive behavior tests were examined after setting up the DM mice. The in vivo experiments showed that mice treated with GBEF exhibited more improved cognitive behavior than DM mice. In addition, GBEF effectively inhibited the acetylcholinesterase (AChE activity and malondialdehyde (MDA levels of DM mice brain tissues. Q-TOF UPLC/MS analyses of GBEF showed that ginsenoside Re was the major ginsenoside.

Ultra-high performance liquid chromatography coupled with photo-diode array and quadrupole/time-of-flight mass spectrometry based chemical profiling approach to evaluate the influence of preparation methods on the holistic quality of Qiong-Yu-Gao, a traditional complex herbal medicine.

Science.gov (United States)

Xu, Jin-Di; Mao, Qian; Shen, Hong; Zhu, Ling-Ying; Li, Song-Lin; Yan, Ru

2013-08-23

Qiong-Yu-Gao (QYG), consisting of Rehmanniae Radix (RR), Poriae (PO) and Ginseng Radix (GR), is a commonly used tonic traditional complex herbal medicine (CHM). So far, three different methods have been documented for preparation of QYG, i.e. method 1 (M1): mixing powders of GR and PO with decoction of RR; method 2 (M2): combining the decoction of RR and PO with the decoction of GR; method 3 (M3): decocting the mixture of RR, GR and PO. In present study, an ultra-high performance liquid chromatography coupled with photo-diode array and quadrupole/time-of-flight mass spectrometry (UHPLC-PDA-QTOF-MS/MS) based chemical profiling approach was developed to investigate the influence of the three preparation methods on the holistic quality of QYG. All detected peaks were unambiguously identified by comparing UV spectra, accurate mass data/characteristic mass fragments and retention times with those of reference compounds, and/or tentatively assigned by matching empirical molecular formula with that of known compounds, and/or elucidating quasi-molecular ions and fragment ions referring to information available in literature. A total of 103 components, mainly belonging to ginsenosides, phenethylalcohol glycosides, iridoid glycosides and triterpenoid acids, were identified, of which 5 degraded ginsenosides were putatively determined to be newly generated during preparation procedures of QYG samples. Triterpenoid acids and malonyl-ginsenosides were detected only in M1 samples, while degraded ginsenosides were merely detectable in M2/M3 samples. The possible reasons for the difference among chemical profiles of QYG samples prepared with three methods were also discussed. It could be concluded that preparation method do significantly affect the holistic quality of QYG. The influence of the altered chemical profiles on the bioactivity of QYG needs further investigation. The present study demonstrated that UHPLC-PDA-QTOF-MS/MS based chemical profiling approach is efficient and

In vitro evidence for endocrine-disrupting chemical (EDC)'s ...

African Journals Online (AJOL)

docrine-disrupting chemical (EDC)'s inhibition of drug metabolism. Materials .... serotonin (5-HT) and 4-methylumbelliferone (4-MU) as the probe substrates ... Hu CM, et al. Structure-. 16. inhibition relationship of ginsenosides towards UDP-.

Vulture populations in Pakistan and the Gyps Vulture Restoration ...

African Journals Online (AJOL)

near 50%, suggesting that extinction, at least across most of the range for these. March 2008 ... (approximately 90 km north-west of. Multan), were extinct by the 2003/2004 breeding season. .... Worldwide: Proceedings of the VI World Conference on Birds of Prey and Owls,. Budapest, Hungary, 18-23 May 2003. Chancellor ...

Cape Vulture Gyps coprotheres breeding status in southern Africa ...

African Journals Online (AJOL)

While our data suggests multiple colonies are stable or increasing, the extinction of peripheral colonies and contraction of the species' range is alarming and gives evidence for unsustainable population declines. Monitoring efforts chronicled the extinction of the previously large core colony at Roberts' Farm, which was ...

Mass culture of mountain Ginseng roots using rare earth elements in bioreactor cultures

Energy Technology Data Exchange (ETDEWEB)

Hwang, Sung Jin; Kim, Chang Hyun; Kim, Ha Lim [Chonnam National University, Gwangju (Korea, Republic of)

2010-01-15

An adventitious roots of mountain ginseng (Panax ginseng C. A. Meyer) was used in this experiments. Various concentration of lanthanide were tested to find out optimal conditions for biomass and ginsenoside contents in mountain ginseng roots. The MS basal medium with 100 {mu}g/L lanthanide created the most optimum condition for growth of adventitious roots of mountain ginseng. Batch culture with 100 {mu}g/L lanthanide and 0.5 g (F.W) inoculation volume produced maximum final biomass of 1.89 g(F.W/flask) within 4 weeks. However, lanthanide was not effect the ginsenoside contents in adventitious roots of mountain ginseng. In bioreactors, 3.23 g F.W./L of biomass were obtained when 100 {mu}g/L lanthanide were added to the MS basal medium at 26 .deg. C

Database on wind characteristics. Users manual

Energy Technology Data Exchange (ETDEWEB)

Larsen, G.C.; Hansen, K.S.

2001-11-01

The main objective of IEA R and D Wind Annex XVII - Database on Wind Characteristics - is to provide wind energy planners and designers, as well as the international wind engineering community in general, with easy access to quality controlled measured wind field time series observed in a wide range of environments. The project partners are Sweden, Norway, U.S.A., The Netherlands, Japan and Denmark, with Denmark as the Operating Agent. The reporting of IEA R and D Annex XVII falls in three separate parts. Part one deals with the overall structure and philosophy behind the database (including the applied data quality control procedures), part two accounts in details for the available data in the established database bank and part three is the Users Manual describing the various ways to access and analyse the data. The present report constitutes part three of the Annex XVII reporting and contains a trough description of the available online facilities for identifying, selecting, downloading and handling measured wind field time series and resource data from 'Database on Wind Characteristics'. (au)

Griffon vulture mortality at wind farms in southern Spain: Distribution of fatalities and active mitigation measures

OpenAIRE

Lucas, Manuela de; Ferrer, Miguel; Bechard, Mark J.; Muñoz, Antonio R.

2012-01-01

Wind is increasingly being used as a renewable energy source around the world. Avian mortality is one of the negative impacts of wind energy and a new technique that reduces avian collision rates is necessary. Using the most frequently-killed species, the griffon vulture (Gyps fulvus), we studied its mortality at 13 wind farms in Tarifa, Cadiz, Spain, before (2006-2007) and after (2008-2009) when selective turbine stopping programs were implemented as a mitigation measure. Ten wind farms (tot...

Proteomic variation in Korean ginseng (Panax ginseng C.A. Meyer ...

African Journals Online (AJOL)

Ulysses Akporoba

2016-08-10

Aug 10, 2016 ... number of ginsenoside types contained in Korean ginseng (38 ... License 4.0 International License .... AnchorChip TM 600/384 MALDI plate (Bruker Daltonik), and ... The peptide mass fingerprint search included a few.

Los dominicos y los sermones cuaresmales en el cabildo municipal de Córdoba durante el siglo XVII (The Dominicans and the Lenten sermons in the municipal council of Cordoba during the XVIIth century

Directory of Open Access Journals (Sweden)

Juan Aranda Doncel

2016-01-01

Full Text Available Resumen: El trabajo tiene como objetivo el estudio del importante papel jugado en Córdoba por los dominicos y el conjunto de las órdenes religiosas en los sermones instituidos por el concejo en su sala de sesiones durante los jueves de cuaresma. A lo largo del siglo XVII todos los hijos espirituales de santo Domingo de Guzmán invitados pertenecen al influyente y prestigioso convento de San Pablo el Real. Un caso excepcional es el del beato fray Francisco de Posadas, miembro de la comunidad de Scala Coeli, quien goza de un gran ascendiente en la sociedad cordobesa de su tiempo por la encomiable labor pastoral y testimonio de vida. La valiosa información contenida en las actas capitulares del municipio constituye la principal fuente documental utilizada.Abstract: This work has as a target the study of the significant role of the Dominicans in Cordoba and the rest of the religious orders in the sermons established by the council in the meeting room during the Thursdays of Lent. Throughout 17th century, all the spiritual children of Saint Domingo of Guzman invited belong to the influential and prestigious convent of Saint Paul the Royal. One exceptional case is the blessed friar Francis of Posadas, member of the Scala Coeli comunity, who has a great ancestor in the Cordobesian society of his time due to his commendable pastoral work and his life witness. The valuable information contained in the records chapters of the council constitutes the main documentary source used.

Connective tissue activation. XVII

International Nuclear Information System (INIS)

Weiss, J.J.; Donakowski, C.; Anderson, B.; Meyers, S.; Castor, C.W.

1980-01-01

The platelet-derived connective tissue activating peptide (CTAP-III) has been shown to be an important factor stimulating the metabolism and proliferation of human connective tissue cell strains, including synovial tissue cells. The quantities of CTAP-III affecting the cellular changes and the amounts in various biologic fluids and tissues are small. The objectives of this study were to develop a radioimmunoassay (RIA) for CTAP-III and to ascertain the specificities of the anti-CTAP-III sera reagents. The antisera were shown not to cross-react with a number of polypeptide hormones. However, two other platelet proteins β-thromboglobulin and low affinity platelet factor-4, competed equally as well as CTAP-III for anti-CTAP-III antibodies in the RIA system. Thus, the three platelet proteins are similar or identical with respect to those portions of the molecules constituting the reactive antigenic determinants. The levels of material in normal human platelet-free plasma that inhibited anti-CTAP-III- 125 I-CTAP-III complex formation were determined to be 34+-13 (S.D.) ng/ml. (Auth.)

FACSS XVII final program

International Nuclear Information System (INIS)

Anon.

1990-01-01

The Seventeenth Annual Meeting of the Federation of Analytical Chemistry and Spectroscopy Societies in October 1990 had a strong representative component concerned with quantitative chemical analysis of sample relevant to energy production. Much of the work presented was concerned with analysis of metals or fuel related hydrocarbon in environmental matrices. Sample preparation by various chromatographic or extraction techniques was the prominent approach, while detection and quantification was accomplished by optical spectroscopy or mass spectrometry

La práctica sacramental en tiempos de la confesionalización : Cantabria, siglos XVII y XVIII

Directory of Open Access Journals (Sweden)

Josué Fonseca Montes

2008-01-01

Full Text Available Los sacramentos han sido desde la Edad Media la declaración más visible del culto y la de fe católicos. Su estudio en la región española de Cantabria en el período comprendido entre los siglos XVI y XIX presenta numerosos aspectos de interés. El bautismo fue altamente valorado y practicado, tanto por los laicos como por las altas jerarquías eclesiásticas. Fue administrado con celeridad creciente tras el nacimiento, y bajo la forma de «urgencia» en numerosas ocasiones. Los sacerdotes lo administraban con gran libertad y con frecuencia eran también elegidos como padrinos. Esta realidad, junto con otras, muestran que el mencionado sacramento no constituyó un refugio de antiguas formas de sociabilidad contra el impulso de la confesionalización. La comunión era recibida principalmente en Pascua, pero la «decencia» de la celebración y el respeto y reverencia de los fieles fueron deficientes al respecto. La confesión cumplía su función anual normativa de forma mecánica, aunque un nuevo modelo, más interiorizado, fue desarrollado por parte de algunas órdenes religiosas a partir del siglo XVII. La celebración de la confirmación, el menos valorado sociológicamente de todos los sacramentos, fue esporádica y rara (con intervalos de hasta 40 años en algunos lugares. El matrimonio católico tuvo que luchar contra la antigua práctica de los «esponsales» y padeció numerosas formas de disciplinamiento social, como la «cencerrada». En general, la práctica sacramental muestra con claridad los límites de la confesionalización en la España Atlántica, incluso durante el siglo XVIII.The sacraments have been from the Middle Ages the most visible declaration of the Christian worship and faith. The study of these in the Spanish region of Cantabria in the period that goes from the 16th to the 19th Centuries shows numerous aspects of interest. Baptism was highly valued and practised, both by the laymen and by the high ecclesiastic

El laberinto, motivo sacramental en Tirso y Calderón

OpenAIRE

Escudero-Baztán, J.M. (Juan Manuel); Oteiza, B. (Blanca)

2013-01-01

Este trabajo estudia el motivo del laberinto en dos autos sacramentales del siglo XVII: “El laberinto de Creta” de Tirso de Molina y “El laberinto del mundo” de Calderón de la Barca. Se enmarca dentro de un estudio más ambicioso que pretende abarcar la utilización del concepto de laberinto en el teatro del siglo XVII. La lectura de ambos textos muestra profundas transformaciones en el diseño, la estructura, la métrica y la utilización de la alegoría. El estudio comparado arroja una mayor dest...

Ignacio García de Escucha, arquitecto, escultor y ensamblador asturiano-bogotano (1580-1629): aproximación a su vida y obra

OpenAIRE

Gila Medina, Lázaro; Herrera García, Francisco Javier

2011-01-01

Este trabajo tiene como fin sacar a la luz a uno de los personajes más importantes de la vida artística en el Reino de la Nueva Granada (Colombia), durante parte del primer tercio del siglo XVII. Nacido en 1580 en Porceyo, Gijón, tras un primer aprendizaje en el entorno familiar, a comienzos del siglo xvii arribó a Toledo completando su formación en el taller de Alonso Sánchez Cotán. Habiendo emparentado con su maestro al casar con su hermana María, desavenencias conyugales le llevaron, hacia...

A prebiotic fiber increases the formation and subsequent absorption of compound K following oral administration of ginseng in rats

Directory of Open Access Journals (Sweden)

Kyung-Ah Kim

2015-04-01

Conclusion: These results show that prebiotic diets, such as NUTRIOSE, may promote the metabolic conversion of ginsenosides to CK and the subsequent absorption of CK in the gastrointestinal tract and may potentiate the pharmacological effects of ginseng.

Propaganda e crítica social nas cronologias dos almanaques astrológicos durante a Guerra Civil inglesa no século XVII Propaganda and social criticism in the chronologies of the astrological almanacs during the English Civil War in 17 th century

Directory of Open Access Journals (Sweden)

Juliana Mesquita Hidalgo Ferreira

2007-12-01

Full Text Available Este artigo é parte de uma ampla investigação sobre a utilização dos almanaques astrológicos durante a Guerra Civil inglesa no século XVII como veículo de propaganda e crítica social. Durante esse conflito, havia astrólogos partidários das forças parlamentaristas, como John Booker, e outros partidários das forças realistas, como George Wharton. O presente trabalho analisa algumas dessas publicações, mostrando como o envolvimento político dos autores se manifestava de forma explícita (e, algumas vezes, não tão direta nos referidos almanaques.This article is part of an extensive investigation carried out concerning the use of astrological almanacs during the English Civil War in the 17th century as a medium for propaganda and social criticism. During that conflict there were astrologers who were partisans of the Parliament, such as John Booker, and other who supported the King, such as George Wharton. This work analyses some of those publications, showing that the political commitment of the authors was noticeable in an explicit form (and sometimes in an indirect way in those almanacs.

American ginseng significantly reduced the progression of high-fat-diet-enhanced colon carcinogenesis in ApcMin/+mice

Directory of Open Access Journals (Sweden)

Chunhao Yu

2015-07-01

Conclusion: Further studies are needed to link our observed effects to the actions of the gut microbiome in converting the parent ginsenosides to bioactive ginseng metabolites. Our data suggest that American ginseng may have potential value in CRC chemoprevention.

Bioconversion of red ginseng saponins in the gastro-intestinal tract in vitro model studied by high-performance liquid chromatography-high resolution Fourier transform ion cyclotron resonance mass spectrometry

NARCIS (Netherlands)

Kong, H.; Wang, M.; Venema, K.; Maathuis, A.; Heijden, R. van der; Greef, J. van der; Xu, G.; Hankemeier, T.

2009-01-01

A high-performance liquid chromatography-high resolution Fourier transform ion cyclotron resonance mass spectrometry (HPLC-FTICR-MS) method was developed to investigate the metabolism of ginsenosides in in vitro models of the gastro-intestinal tract. The metabolites were identified by

[Cardiology was born with the modern medical science].

Science.gov (United States)

de Micheli, Alfredo

2015-01-01

Modern medical science was born in the post-Renaissance age and began to consolidate towards the middle of the XVII century thanks to physicists, physiologists and biologists, most of whom were direct or indirect pupils of Galileo. The discovery of blood circulation by Harvey is now considered the only progress in physiology at the beginning of the XVII century, comparable to the current advances seen in physical sciences. The history of this exploit could be written from view point of the progressive advance in knowledge. In his experiments, Harvey referred to the authentic not imaginary experiments, and put forward irrefutable quantitative arguments. We can therefore claim that his discovery of blood circulation was the first proper explanation of an organic process and the starting point leading to experimental physiology. So it seems justified to assert that modern medical science did not all rise suddenly, but was gradually structured starting from the middle of the XVII century following the path traced by William Harvey in light of Galileo's thought. Copyright © 2014 Instituto Nacional de Cardiología Ignacio Chávez. Published by Masson Doyma México S.A. All rights reserved.

自然発症高血圧ラットにおける釣藤散の抗高血圧作用 : 釣藤鈎及び石膏の役割について

OpenAIRE

趙, ??; 渡辺, 裕司; 村上, 孝寿; 東田, 道久; 松本, 欣三; Zhao, QI; Hiroshi, WATANABE; Yukihisa, MURAKAMI; Michihisa, TOHDA; Kinzo, MATSUMOTO; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門

2002-01-01

To clarify a role of Chotoko (Uncaria sp.) and gypsum in the anti-hypertensive effect of a Kampo prescription Choto-san (Diao-Teng-San), we investigated effects of Choto-san except Chotoko or gypsum, Chotoko alone and gyp-sum alone on the blood pressure and the heart rate in spontaneously hypertensive rats (SHR). Choto-san (0.5, 1.0 and 2.0 g/kg, p.o.) produced a dose-dependent hypotensive effect, but did not affect the heart rate in SHR. It affected neither blood pressure nor heart rate in n...

Updated vegetation information in high resolution WRF simulations

DEFF Research Database (Denmark)

Nielsen, Joakim Refslund; Dellwik, Ebba; Hahmann, Andrea N.

2013-01-01

modify the energy distribution at the land surface. In weather and climate models it is important to represent the vegetation variability accurately to obtain reliable results. The weather research and forecasting (WRF) model uses green vegetation fraction (GVF) time series to represent vegetation...... seasonality. The GVF of each grid cell is additionally used to scale other parameters such as LAI, roughness, emissivity and albedo within predefined intervals. However, the default GYP used by WRF does not reflect recent climatic changes or change in management practices since it was derived more than 20...

[Identification of saponins from Panax notoginseng in metabolites of rats].

Science.gov (United States)

Shen, Wen-Wen; Zhang, Yin; Qiu, Shou-Bei; Zhu, Fen-Xia; Jia, Xiao-Bin; Tang, Dao-Quan; Chen, Bin

2017-10-01

UPLC-QTOF-MS/MS was used to identify metabolites in rat blood, urine and feces after the administration of n-butanol extract derived from steamed notoginseng. The metabolic process of saponins came from steamed notoginseng was analyzed. The metabolites were processed by PeakView software, and identified according to the structural characteristics of prototype compounds and the accurate qualitative and quantitative changes of common metabolic pathways. Four saponins metabolites were identified based on MS/MS information of metabolites, namely ginsenoside Rh₄, Rk₃, Rk₁, Rg₅,and their 15 metabolites were verified. The metabolic pathways of the four ginsenosides in n-butanol extract included glucuronidation, desugar, sulfation, dehydromethylation, and branch loss. The metabolites of main active saponin components derived from steamed Panax notoginseng were analyzed from the perspective of qualitative analysis. And the material basis for the efficacy of steamed notoginseng was further clarified. Copyright© by the Chinese Pharmaceutical Association.

Attenuation of Aβ25–35-induced parallel autophagic and apoptotic cell death by gypenoside XVII through the estrogen receptor-dependent activation of Nrf2/ARE pathways

International Nuclear Information System (INIS)

Meng, Xiangbao; Wang, Min; Sun, Guibo; Ye, Jingxue; Zhou, Yanhui; Dong, Xi; Wang, Tingting; Lu, Shan; Sun, Xiaobo

2014-01-01

Amyloid-beta (Aβ) has a pivotal function in the pathogenesis of Alzheimer's disease. To investigate Aβ neurotoxicity, we used an in vitro model that involves Aβ 25–35 -induced cell death in the nerve growth factor-induced differentiation of PC12 cells. Aβ 25–35 (20 μM) treatment for 24 h caused apoptotic cell death, as evidenced by significant cell viability reduction, LDH release, phosphatidylserine externalization, mitochondrial membrane potential disruption, cytochrome c release, caspase-3 activation, PARP cleavage, and DNA fragmentation in PC12 cells. Aβ 25–35 treatment led to autophagic cell death, as evidenced by augmented GFP-LC3 puncta, conversion of LC3-I to LC3-II, and increased LC3-II/LC3-I ratio. Aβ 25–35 treatment induced oxidative stress, as evidenced by intracellular ROS accumulation and increased production of mitochondrial superoxide, malondialdehyde, protein carbonyl, and 8-OHdG. Phytoestrogens have been proved to be protective against Aβ-induced neurotoxicity and regarded as relatively safe targets for AD drug development. Gypenoside XVII (GP-17) is a novel phytoestrogen isolated from Gynostemma pentaphyllum or Panax notoginseng. Pretreatment with GP-17 (10 μM) for 12 h increased estrogen response element reporter activity, activated PI3K/Akt pathways, inhibited GSK-3β, induced Nrf2 nuclear translocation, augmented antioxidant responsive element enhancer activity, upregulated heme oxygenase 1 (HO-1) expression and activity, and provided protective effects against Aβ 25–35 -induced neurotoxicity, including oxidative stress, apoptosis, and autophagic cell death. In conclusion, GP-17 conferred protection against Aβ 25–35 -induced neurotoxicity through estrogen receptor-dependent activation of PI3K/Akt pathways, inactivation of GSK-3β and activation of Nrf2/ARE/HO-1 pathways. This finding might provide novel insights into understanding the mechanism for neuroprotective effects of phytoestrogens or gypenosides

A survey of White-rumped Vultures Gyps bengalensis in Gujarat ...

African Journals Online (AJOL)

2007-09-02

Sep 2, 2007 ... During the field survey, 73.1% of the vultures were found soaring, 13.7% were perching on trees and/or the ground, while 13.2% were observed feeding on ..... A Pictorial Guide to the Birds of the Indian subcontinent. Bombay ...

Observations on the breeding of Indian long-billed vultures Gyps ...

African Journals Online (AJOL)

Campbell Murn

observed to be abandoned by the birds after 29 days of incubation during December. We also observed mating attempts (n=5) in adult birds during nestling period. Out of 16 chicks, one died at the hatching stage and one died during the fledgling stage, thus only 14 chicks fledged successfully with a success rate of. 82.35%.

Blood lead levels in White-Backed Vultures (Gyps africanus) from ...

African Journals Online (AJOL)

Campbell Murn

Currently vulture populations in sub-. Saharan Africa are dramatically declining due to direct and indirect poisoning with pesticides (Ogada. 2014, Virani 2011). During a tagging and radio telemetry study from 2012 thru 2015 involving several species of vultures in. Botswana, the Denver Zoological. Foundation in ...

Monitoring White-backed Vultures Gyps africanus in the North West ...

African Journals Online (AJOL)

Campbell Murn

Stellaland), South Africa. Dirk, Karen and Stefan van Stuyvenberg. Stellaland Raptor Project. e-mail: stuyvies@telkomsa.net. Introduction. We became involved with the ringing of birds in 2002 and started to ring raptors actively since 2003.

Ambientes desencantados: o século XVIII e o reino das racionalidades

OpenAIRE

Calloni, Humberto

2006-01-01

A fim de que possamos compreender a complexidade do século XVIII, também denominado século das luzes, não há como nos esquivarmos de uma apreciação pontual, ainda que nem de longe esgotada, da produção científica e filosófica ao longo do século XVII europeu. O século XVIII filosófico é caudatário da crise do aristotelismo no século XVI e do advento, no século XVII, de um Novum organum, de um método de investigação da realidade a partir de uma dupla entrada: a entrada do empirismo, representad...

31 CFR 500.204 - Importation of and dealings in certain merchandise.

Science.gov (United States)

2010-07-01

...; (xiv) Steaming; (xv) Cooking; (xvi) Curing; (xvii) Combining of fur skins into plates; (xviii) Blending...; (xxv) Dyeing; (xxvi) Bleaching; (xxvii) Tanning; (xxviii) Packing; (xxix) Canning; (xxx) Labeling...

7 CFR 1735.10 - General.

Science.gov (United States)

2010-01-01

... chapter XVII. RUS provides borrowers specialized and technical accounting, engineering, and other managerial assistance in the construction and operation of their facilities when necessary to aid the...

38 CFR 3.815 - Monetary allowance under 38 U.S.C. chapter 18 for an individual with disability from covered...

Science.gov (United States)

2010-07-01

...) Osteogenesis imperfecta; (xiv) Pectus excavatum; (xv) Phenylketonuria; (xvi) Sickle cell disease; (xvii) Tay...) Stamina; (iv) Speech; (v) Hearing; (vi) Vision (other than correctable refraction errors); (vii) Memory...

Ginseng in Dermatology: A Review.

Science.gov (United States)

Sabouri-Rad, Sarvenaz; Sabouri-Rad, Sara; Sahebkar, Amirhossein; Tayarani-Najaran, Zahra

2017-01-01

Ginseng has gained fame as one of the most popular herbs originating from Eastern countries. Among different species which are known as ginseng, Panax ginseng C. A. Mey. (Korean or Asian ginseng) is the most frequently used one. Ginsenosides have been proposed to account for most of the biological activities of ginseng. The widely appreciated health-promoting effect of ginseng pertains to the beneficial effects of this plant against immune, cardiovascular and sexual diseases and cancer. In addition, there are some new aspects of the pharmacological activity of this plant which justify its use in dermatologic diseases. In dermatology, ginseng has been investigated mechanistically for its therapeutic effects in photoaging, wound and injury, skin cancer, dermatitis, hair loss, alopecia and cold hypersensitivity. Here, we reviewed experimental and clinical studies exploring the therapeutic efficacy of ginseng and ginsenosides in the field of dermatology. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

A well-refined in vitro model derived from human embryonic stem cell for screening phytochemicals with midbrain dopaminergic differentiation-boosting potential for improving Parkinson's disease.

Science.gov (United States)

Hsieh, Wen-Ting; Chiang, Been-Huang

2014-07-09

Stimulation of endogenous neurogenesis is a potential approach to compensate for loss of dopaminergic neurons of substantia nigra compacta nigra (SNpc) in patients with Parkinson's disease (PD). This objective was to establish an in vitro model by differentiating pluripotent human embryonic stem cells (hESCs) into midbrain dopaminergic (mDA) neurons for screening phytochemicals with mDA neurogenesis-boosting potentials. Consequently, a five-stage differentiation process was developed. The derived cells expressed many mDA markers including tyrosine hydroxylase (TH), β-III tubulin, and dopamine transporter (DAT). The voltage-gated ion channels and dopamine release were also examined for verifying neuron function, and the dopamine receptor agonists bromocriptine and 7-hydroxy-2-(dipropylamino)tetralin (7-OH-DPAT) were used to validate our model. Then, several potential phytochemicals including green tea catechins and ginsenosides were tested using the model. Finally, ginsenoside Rb1 was identified as the most potent phytochemical which is capable of upregulating neurotrophin expression and inducing mDA differentiation.

Pharmacokinetics study of bio-adhesive tablet of Panax notoginseng saponins

Directory of Open Access Journals (Sweden)

Feng Hanzhou

2011-06-01

Full Text Available Abstract Panax notoginseng saponin (PNS is the main active gradient of Chinese traditional medicine Panax notoginseng. Although its prominent therapeutic efficacy has been demonstrated by various researchers, the broader application is restricted by the low bioavailability of PNS. This article aims to discuss PNS's plasma pharmacokinetics after oral administration of bio-adhesive tablet of PNS to beagle dogs and improve its bioavailability in comparison with normal tablet. The bio-adhesive tablet was prepared according to our previous patent, using chitosan as main excipient. A simple and sensitive LC-MS/MS combined with solid-phase extraction (SPE method for the analysis of PNS in dog's plasma was developed in our previous study, and was validated to apply in the pharmacokinetics study in this work. Three ingredients: Notoginsenoside R1 (R1, Ginsenoside Rg1 (Rg1 and Ginsenoside Rb1 (Rb1 (Figure 1, were chosen as indicators of PNS to analyze it in vivo. Statistically significant increase (P

Attenuation of Aβ{sub 25–35}-induced parallel autophagic and apoptotic cell death by gypenoside XVII through the estrogen receptor-dependent activation of Nrf2/ARE pathways

Energy Technology Data Exchange (ETDEWEB)

Meng, Xiangbao; Wang, Min [Key Laboratory of Bioactive Substances and Resources Utilization of Chinese Herbal Medicine, Ministry of Education, Institute of Medicinal Plant Development, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100193 (China); Sun, Guibo, E-mail: sunguibo@126.com [Key Laboratory of Bioactive Substances and Resources Utilization of Chinese Herbal Medicine, Ministry of Education, Institute of Medicinal Plant Development, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100193 (China); Ye, Jingxue [Jilin Agricultural University, Changchun, Jilin 130021 (China); Zhou, Yanhui [Center of Cardiology, People' s Hospital of Jilin Province, Changchun, 130021, Jilin (China); Dong, Xi [Wenzhou Medical University, Wenzhou, Zhejiang 325035 (China); Wang, Tingting; Lu, Shan [Key Laboratory of Bioactive Substances and Resources Utilization of Chinese Herbal Medicine, Ministry of Education, Institute of Medicinal Plant Development, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100193 (China); Sun, Xiaobo, E-mail: sun_xiaobo163@163.com [Key Laboratory of Bioactive Substances and Resources Utilization of Chinese Herbal Medicine, Ministry of Education, Institute of Medicinal Plant Development, Chinese Academy of Medical Sciences and Peking Union Medical College, Beijing 100193 (China)

2014-08-15

Amyloid-beta (Aβ) has a pivotal function in the pathogenesis of Alzheimer's disease. To investigate Aβ neurotoxicity, we used an in vitro model that involves Aβ{sub 25–35}-induced cell death in the nerve growth factor-induced differentiation of PC12 cells. Aβ{sub 25–35} (20 μM) treatment for 24 h caused apoptotic cell death, as evidenced by significant cell viability reduction, LDH release, phosphatidylserine externalization, mitochondrial membrane potential disruption, cytochrome c release, caspase-3 activation, PARP cleavage, and DNA fragmentation in PC12 cells. Aβ{sub 25–35} treatment led to autophagic cell death, as evidenced by augmented GFP-LC3 puncta, conversion of LC3-I to LC3-II, and increased LC3-II/LC3-I ratio. Aβ{sub 25–35} treatment induced oxidative stress, as evidenced by intracellular ROS accumulation and increased production of mitochondrial superoxide, malondialdehyde, protein carbonyl, and 8-OHdG. Phytoestrogens have been proved to be protective against Aβ-induced neurotoxicity and regarded as relatively safe targets for AD drug development. Gypenoside XVII (GP-17) is a novel phytoestrogen isolated from Gynostemma pentaphyllum or Panax notoginseng. Pretreatment with GP-17 (10 μM) for 12 h increased estrogen response element reporter activity, activated PI3K/Akt pathways, inhibited GSK-3β, induced Nrf2 nuclear translocation, augmented antioxidant responsive element enhancer activity, upregulated heme oxygenase 1 (HO-1) expression and activity, and provided protective effects against Aβ{sub 25–35}-induced neurotoxicity, including oxidative stress, apoptosis, and autophagic cell death. In conclusion, GP-17 conferred protection against Aβ{sub 25–35}-induced neurotoxicity through estrogen receptor-dependent activation of PI3K/Akt pathways, inactivation of GSK-3β and activation of Nrf2/ARE/HO-1 pathways. This finding might provide novel insights into understanding the mechanism for neuroprotective effects of phytoestrogens

Author template for journal articles

African Journals Online (AJOL)

雨林木风

performance liquid chromatography (HPLC), and strain GH9 was found to transform major ginsenoside to minor ... 86.1%. Strain GH9 was identified as a Penicillium dipodomyicola species based on the internal transcribed .... Fermentation conditions for strain GH9 (pH value, temperature, and ..... intrasporangium sp. GS603 ...

Caracterización, diseño y producción recombinante de bacteriocinas y otros péptidos antimicrobianos, secuenciación genómica y efecto en la microbiota de péptidos bioactivos producidos por enterococos

OpenAIRE

Arbulu Ruiz, Sara

2016-01-01

El trabajo desarrollado en esta tesis doctoral ha empleado técnicas de microbiología y bioquímica clásicas, así como técnicas recientes de ingeniería genética, genómica y proteómica y describe en capítulos diferenciados, los siguientes objetivos: En el capítulo III, se describe la identificación y caracterización de bacterias lácticas (BAL) aísladas de heces de buitres leonados (Gyps fulvus subesp. fulvus) por su actividad antimicrobiana, genes que codifican bacteriocinas, factores potenciale...

[The anatomy Lesson of Dr. Nicolaes Tulp: The beginning of a medical utopia].

Science.gov (United States)

Rosler, Roberto; Young, Pablo

2011-04-01

The Anatomy Lesson of Dr. Nicolaes Tulp was painted by Rembrandt Harmen-szoon van Rijn at the early age of 26 years. In the XVII century these paintings were very popular in the Netherlands, and in this country the cities flourished as cultural centers searching the anatomy knowledge. Nicolaes Tulp was one of the persons in the center of Amsterdam's scene during XVII century. In 1632 Tulp was 39 years old, and he was an anatomist and a surgeon. Rembrandt masterly shows an autopsy performed by Dr. Tulp. This picture is the description of the beginning of a medical intellectual utopia: the absolute visibility of the disease. Unfortunately this utopia is blind to the complete visibility of the psycho-socio-cultural dimensions of the ill.

Neon-like Iron Ion Lines Measured in NIFS/Large Helical Device (LHD) and Hinode/EUV Imaging Spectrometer (EIS)

Science.gov (United States)

Watanabe, Tetsuya; Hara, Hirohisa; Murakami, Izumi; Kato, Daiji; Sakaue, Hiroyuki A.; Morita, Shigeru; Suzuki, Chihiro; Tamura, Naoki; Yamamoto, Norimasa; Nakamura, Nobuyuki

2017-06-01

Line intensities emerging from the Ne-sequence iron ion (Fe XVII) are measured in the laboratory, by the Large Helical Device at the National Institute for Fusion Science, and in the solar corona by the EUV Imaging Spectrometer (EIS) on board the Hinode mission. The intensity ratios of Fe XVII λ 204.6/λ 254.8 are derived in the laboratory by unblending the contributions of the Fe XIII and XII line intensities. They are consistent with theoretical predictions and solar observations, the latter of which endorses the in-flight radiometric calibrations of the EIS instrument. The still remaining temperature-dependent behavior of the line ratio suggests the contamination of lower-temperature iron lines that are blended with the λ 204.6 line.

Neon-like Iron Ion Lines Measured in NIFS/Large Helical Device (LHD) and Hinode /EUV Imaging Spectrometer (EIS)

Energy Technology Data Exchange (ETDEWEB)

Watanabe, Tetsuya; Hara, Hirohisa [National Astronomical Observatory, National Institutes of Natural Sciences 2-21-1 Osawa Mitaka Tokyo, 181-8588 (Japan); Murakami, Izumi; Kato, Daiji; Morita, Shigeru [SOKENDAI (Graduate University for Advanced Studies) Hayama, Miura-gun, Kanagawa, 240-0193 (Japan); Sakaue, Hiroyuki A.; Suzuki, Chihiro; Tamura, Naoki [National Institute for Fusion Science, National Institutes of Natural Sciences 322-6 Oroshi-cho, Toki Gifu, 509-5292 (Japan); Yamamoto, Norimasa [Chubu University 1200 Matsumoto-cho, Kasugai Aichi, 487-0027 (Japan); Nakamura, Nobuyuki, E-mail: watanabe@uvlab.mtk.nao.ac.jp [The University of Electro-Communications 1-5-1 Chofugaoka, Chofu Tokyo, 182-8585 (Japan)

2017-06-10

Line intensities emerging from the Ne-sequence iron ion (Fe xvii) are measured in the laboratory, by the Large Helical Device at the National Institute for Fusion Science, and in the solar corona by the EUV Imaging Spectrometer (EIS) on board the Hinode mission. The intensity ratios of Fe xvii λ 204.6/ λ 254.8 are derived in the laboratory by unblending the contributions of the Fe xiii and xii line intensities. They are consistent with theoretical predictions and solar observations, the latter of which endorses the in-flight radiometric calibrations of the EIS instrument. The still remaining temperature-dependent behavior of the line ratio suggests the contamination of lower-temperature iron lines that are blended with the λ 204.6 line.

Isolation and characterization of β-glucosidase producing bacteria ...

African Journals Online (AJOL)

glucosidase activity. This activity was tested by growth in medium supplemented with esculin and ferric ammonium citrate. The esculin positive strains from both the sources were characterized biochemically and checked for their ability to transform ginsenoside Rb1. The growth medium and the pH for maximum growth were ...

Regulation of tissue differentiation by plant growth regulators on tTCLs of Panax ginseng adventitious roots

Czech Academy of Sciences Publication Activity Database

Langhansová, Lenka; Maršík, Petr; Vaněk, Tomáš

2012-01-01

Roč. 35, č. 1 (2012), s. 154-159 ISSN 0926-6690 R&D Projects: GA AV ČR KJB400550705; GA MŠk ME08070 Institutional research plan: CEZ:AV0Z50380511 Keywords : Adventitious roots * Panax ginseng * Ginsenosides Subject RIV: CE - Biochemistry Impact factor: 2.468, year: 2012

Small Business Administration Semiannual Regulatory Agenda

Science.gov (United States)

2010-12-20

... small business concerns owned and controlled by women, and to women wishing to start a small business... Business Administration Semiannual Regulatory Agenda] Part XVII Small Business Administration Semiannual Regulatory Agenda [[Page 79864

State policy and monetary circulation in the Seventeenth Century Crown of Aragon: The depreciation of silver currency Política estatal y circulación monetaria en la Corona de Aragón durante el siglo XVII: la depreciación de la moneda de plata

Directory of Open Access Journals (Sweden)

José Antonio Mateos Royo

2012-03-01

Full Text Available This paper looks at the state policy applied to silver in the Spanish territories of the Crown of Aragon in the seventeenth century, where increasing demand for silver coins with a lower intrinsic than market value opened up debate on the depreciation of the domestic silver coinage. The monarchy was weaker in the Crown of Aragon than in Castile, and it was therefore obliged to negotiate these measures with the elites and institutionsof each kingdom. The paper examines the fiscal and monetary reasons forreforms, as well as the extent of political support achieved in each kingdom.Este artículo estudia la política estatal aplicada a la plata en los territorios hispánicos de la Corona de Aragón en el siglo XVII. La creciente demanda de moneda con menor valor intrínseco por el mercado abrió un debate sobre la depreciación de las monedas domésticas en la Corona. Debido a su menor poder que en Castilla, la monarquía hispánica tuvo que negociar esta medida con elites e instituciones de cada reino. El artículo analiza las razones fiscales o monetarias de estas reformas, así como el grado de apoyo político alcanzado en cada territorio.

Everything-as-it-should-be-Blackstone?

Directory of Open Access Journals (Sweden)

Kent D. Lerch

2010-01-01

Full Text Available Rezensiertes Werk: Wilfrid R. Prest, William Blackstone. Law and Letters in the Eighteenth Century, Oxford [u. a.]: Oxford University Press 2008, XVII, 355 S., ISBN 978-0-19-955029-6

La Gazeta de Madrid y la Guerra de Sucesión

Directory of Open Access Journals (Sweden)

María Rosa CAL MARTÍNEZ

2009-11-01

Full Text Available RESUMEN: El artículo estudia el papel que desempeñó la Gazeta de Madrid durante la Guerra de Sucesión en España, tema inédito. Desde el siglo XVII las Cortes europeas disponían de publicaciones periódicas que amparaban o subvencionaban a cambio de controlar los contenidos y de que en ellas apareciesen todas las noticias que favoreciesen a las diversas Coronas. En España la primera Gazeta a favor de la monarquía surgió también en el siglo XVII fue una concesión del rey Felipe IV a su hijo bastardo Juan José de Austria. Es esta misma Gazeta (tras pasar por diferentes vicisitudes, la que recoge los acontecimientos de 1701 a 1714. Como vamos a comprobar, la publicación silencia las derrotas y los desastres, y magnifica las victorias y los éxitos de las tropas reales; y deja muy claro quiénes eran los amigos del monarca.ABSTRACT: This article studies the role that la Gazeta de Madrid had during the Spanish Succession War, a subject that has not been investigated before. Since the XVII century, European Courts had periodical publications that were supported or funded to control the information. Therefore, these publications only printed news approved by the Spanish Royalty and that favoured the different Crowns. In Spain, this first royalist Gazette in favour of monarchy also began in the XVII century and was a concession of Felipe IV to his bastard son, Juan José de Austria. This is also the Gazette, after different problems were overcome, that published information about the 1701-14 events. As we can see, the gazette remains silent about the defeats and magnifies the triumphs and successes of the royal troops, and gives a clear idea of who were the monarch’s friends.

30. III avati rahvusraamatukogu VI korruse trepigaleriis...

Index Scriptorium Estoniae

2004-01-01

Näitus "Euroopa XVII sajandi sügavtrükigraafika Eesti Rahvusraamatukogus". Avamisele eelnes kuraator Jüri Haini loeng. Kunstnike hulgas on prantslased Jacques Callot, Claude Vignon, itaallased Salvatore Rosa, Stefano della Bella jt.

Louvre'i täiendus kunstiajaloole / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2000-01-01

Pariisis Louvre'is XVII saj. Bologna maalikunstniku Francesco Albani loomingu ülevaatenäitus. Väljas on ka F. Albani portree Joseph Chinard'ilt. Näituse koostas Pierre Rosenberg, kataloogi Stéphane Loire

Mitochondrial DNA analysis on remains of a putative son of Louis XVI, King of France and Marie-Antoinette.

Science.gov (United States)

Jehaes, E; Decorte, R; Peneau, A; Petrie, J H; Boiry, P A; Gilissen, A; Moisan, J P; Van den Berghe, H; Pascal, O; Cassiman, J J

1998-01-01

Carl Wilhelm Naundorff was buried in 1845 in Delft as Louis Charles, Duc de Normandie, 'Louis XVII'. However, the son of Louis XVI and Marie-Antoinette-Louis XVII--officially died in the Temple of Paris in 1795. In order to resolve the identity of Naundorff, mitochondrial DNA (mtDNA) D-loop sequences of his remains were compared with the sequences obtained from the hairs of two sisters of Marie-Antoinette, Marie-Antoinette herself, and with the sequences obtained from DNA samples of two living maternal relatives. The mtDNA sequence of a bone sample from Naundorff showed two nucleotide differences from the sequences of the three sisters and four differences from the sequences of living maternal relatives. Based on this evidence it becomes very unlikely that Naundroff is the son of Marie-Antoinette.

Los parlamentos hispano-mapuches bajo el reinado de Felipe III: la labor del padre Luis de Valdivia (1605-1617 = Os parlamentos hispânico-mapuches durante o reinado de Felipe III: a função do padre Luis de Valdivia (1605-1617 = The hispano-mapuche parlamentos under the reign of Philip III of Spain: the work of father Luis de Valdivia (1605-1617

Directory of Open Access Journals (Sweden)

Cepeda, José Manuel Zavala

2014-01-01

Full Text Available Durante o reinado de Felipe III são detectados elos intermediários entre as origens quinhentistas das instituições parlamentarias hispânico mapuches e sua etapa de plenitude, inaugurada em meados do século XVII. O grande impulsionador dos planos de pacificação no início do século XVII, foi o jesuíta Luís de Valdivia, que graças as sua aptidões diplomáticas, linguísticas e etnográficas consegue consolidar uma tradição de negociação fronteiriça hispânico-indígena marcada pela importância do diálogo, dos rituais, e da mediação linguística

Screening of new British thraustochytrids isolates for docosahexaenoic acid (DHA) production.

Science.gov (United States)

Marchan, Loris Fossier; Lee Chang, Kim J; Nichols, Peter D; Polglase, Jane L; Mitchell, Wilfrid J; Gutierrez, Tony

2017-01-01

Thraustochytrids isolated from hot tropical and sub-tropical waters have been well studied for DHA and biodiesel production in the last decades. However, little research has been performed on the oils of cold water thraustochytrids, in particular from the North Sea region. In this study, thraustochytrid strains from British waters showed high relative levels of omega-3 long-chain (≥C 20 ) polyunsaturated fatty acids (LC-PUFA), including docosahexaenoic acid (DHA, 22:6ω3). The relative levels of DHA (as % of total fatty acids, TFA) in the different British strains are hitherto amongst the highest recorded from any thraustochytrid screening study, with strain TL18 reaching up to 67% DHA in modified Glucose-Yeast Extract-Peptone (GYP) medium. At this screening stage, low final biomass and fatty acid yield were observed in modified GYP and MarChiquita-Brain Heart Broth (MCBHB), while PUFA profiles (as % of PUFA) remained unaltered regardless of the culture medium used. Hence, optimizing the medium and culture conditions to improve growth and lipid content, without impacting the relative percentage of DHA, has the potential to increase the final DHA concentration. With this in mind, three strains were identified as promising organisms for the production of DHA. In the context of possible future industrial exploitation involving a winterization step, we investigated the recycling of the residual oil for biodiesel use. To do this, a mathematical model was used to assess the intrinsic properties of the by-product oil. The results showed the feasibility of producing primary DHA-rich oil, assuming optimized conditions, while using the by-product oil for biodiesel use.

[Effects of culture conditions on biomass and active components of adventitious roots culture in Panax ginseng].

Science.gov (United States)

Huang, Tao; Gao, Wenyuan; Wang, Juan; Cao, Yu

2010-01-01

To optimize the culture condition of adventitious roots of Panax ginseng. The adventitious roots were obtained through tissue culture by manipulation of inoculum, various sucrose concentrations and salt strength. The contents of ginsenosides Re, Rb1 and Rg1 were determined by HPLC while the contents of polysaccharides were determined by ultraviolet spectrophotometry. The multiplication of adventitious roots reached the peak when the inoculum was 20 g x L(-1). The effects of sucrose concentration and salt strength on adventitious roots were observed. The contents of polysaccharides were higher when the medium contained more sucrose. 40 g x L(-1) sucrose was favorable for roots growth and biosynthesis of Re, while 30 g x L(-1) was favorable for the biosynthesis of Rb1 and Rg1. 3/4MS medium was benefit for the growth of adventitious roots and the biosynthesis of ginsenosides. The contents of polysaccharides were decreased with the increase of salt strength. The results showed that inoculum, various sucrose concentrations and salt strength have significant influences on adventitious roots growth, secondary metabolite and polysaccharide synthesis in P. ginseng.

Quantitative determination of the saponin content and GC-MS study of the medicinal plant Cassytha filiformis (linn.) leaves

Institute of Scientific and Technical Information of China (English)

Theresa Ibibia Edewor; Stephen Olugbemiga Owa; Adeola Opeyemi Ologan; FranklinAkinfemi

2016-01-01

Objective: To determine the phytochemicals, total saponin content and types of saponin present in leaf extracts of Cassytha filiformis. Methods: The leaves were extracted with n-hexane and methanol. The methanol extract was fractionated. The total saponin content of the butanol fraction was determined by colorimetry via a UV spectrophotometer and ginsenoside was used as the standard. Measurements were carried out at 550 nm. The butanol fraction was subjected to gas chromatography-mass spectrometer analysis. Results: All screened phytochemicals were absent in the n-hexane extract while saponins, steroids, tannins and glycosides were present in the methanol extract. Flavonoids and alkaloids were absent. The total saponin content of the methanol extract is 73.47 μg ginsenoside Rb1 equivalent/g extract. The chromatography-mass spectrometer analysis gave eicosanoic acid, methyl ester as the most abundant compound and the steroidal saponin, cholestan-7-one and cyclic 1,2-ethanedienyl acetal as the most abundant saponin in the butanol fraction. Conclusions: The leaves of Cassytha filiformis are rich in steroidal saponins.

Eesti Akadeemilise Raamatukogu näitused / Sirje Lauring Vaska ; Sirje Lauring

Index Scriptorium Estoniae

Lauring Vaska, Sirje

1997-01-01

"Teadusajaloo ja Teadusfilosoofia Eesti Ühendus 30" ja "Tallinna trükkal Johann Köhler 335"; "Sihtasutis Fenno-ugria 70" ja "Baltische Historische Komission 50"; "Teaduse arengust Eestis XVII-XVIII sajandil" ja "Kunstistiilid II. Art Noveau"

Libahundi kujutelmade teoloogilis-demonoloogilised tõlgendused / Tiina Vähi

Index Scriptorium Estoniae

Vähi, Tiina

2006-01-01

Libahundikujutelmade lähtekohtadest. Libahundipildist vana- ja keskaja teoloogias ja demonoloogias. Lükantroopiast kui doktriinist varauusaegsetes teoloogilis-demonloogilistes traktaatides. XVII sajandi Liivi- ja Kuramaa vaimulike Herman von Samsoni ja Paul Einhorni lükantroopiakäsitlustest

Database on wind characteristics - contents of database bank

Energy Technology Data Exchange (ETDEWEB)

Larsen, G.C.; Hansen, K.S.

2004-06-01

The main objective of IEA R and D Wind Annex XVII - Database on Wind Characteristics - has been to provide wind energy planners, designers and researchers, as well as the international wind engineering community in general, with a source of actual wind field data (time series and resource data) observed in a wide range of different wind climates and terrain types. Connected to an extension of the initial Annex period, the scope for the continuation was widened to include also support to the international wind turbine standardisation efforts.. The project partners are Sweden, Norway, U.S.A., The Netherlands and Denmark, with Denmark as the Operating Agent. The reporting of the continuation of Annex XVII falls in two separate parts. Part one accounts in details for the available data in the established database bank, and part two describes various data analyses performed with the overall purpose of improving the design load cases with relevance for to wind turbine structures. The present report constitutes the second part of the Annex XVII reporting. Both fatigue and extreme load aspects are dealt with, however, with the main emphasis on the latter. The work has been supported by The Ministry of Environment and Energy, Danish Energy Agency, The Netherlands Agency for Energy and the Environment (NOVEM), The Norwegian Water Resources and Energy Administration (NVE), The Swedish National Energy Administration (STEM) and The Government of the United States of America. (au)

Database on wind characteristics - Analyses of wind turbine design loads

Energy Technology Data Exchange (ETDEWEB)

Larsen, G.C.; Hansen, K.S.

2004-06-01

The main objective of IEA R and D Wind Annex XVII - Database on Wind Characteristics - has been to provide wind energy planners, designers and researchers, as well as the international wind engineering community in general, with a source of actual wind field data (time series and resource data) observed in a wide range of different wind climates and terrain types. Connected to an extension of the initial Annex period, the scope for the continuation was widened to include also support to the international wind turbine standardisation efforts.. The project partners are Sweden, Norway, U.S.A., The Netherlands and Denmark, with Denmark as the Operating Agent. The reporting of the continuation of Annex XVII falls in two separate parts. Part one accounts in details for the available data in the established database bank, and part two describes various data analyses performed with the overall purpose of improving the design load cases with relevance for to wind turbine structures. The present report constitutes the second part of the Annex XVII reporting. Both fatigue and extreme load aspects are dealt with, however, with the main emphasis on the latter. The work has been supported by The Ministry of Environment and Energy, Danish Energy Agency, The Netherlands Agency for Energy and the Environment (NOVEM), The Norwegian Water Resources and Energy Administration (NVE), The Swedish National Energy Administration (STEM) and The Government of the United States of America. (au)

Uudised : Hortus Musicus Moskvas. TPÜ naiskoor koorikonkursil. RAM samal laval Mark Knopfleriga. "Tuuleveskid. Kerkokell" / Joosep Sang

Index Scriptorium Estoniae

Sang, Joosep

2000-01-01

Hortus Musicus esines 23. ja 24. nov. Moskvas. TPÜnaiskoor võitis II preemia XVII rahvusvahelisel F.Schuberti nim. koorikonkursil Austrias. RAM esineb 8. dets. Helsingis Hartwall Areenas heategevuskontserdil. RAM esineb 6. dets. Estonia kontserdisaalis kavaga "Tuuleveskid. Kerkokell"

Ultrafast THz saturable absorption in doped semiconductors at room temperature

DEFF Research Database (Denmark)

Turchinovich, Dmitry; Hoffmann, M. V.

2011-01-01

Ultrafast Phenomena XVII presents the latest advances in ultrafast science, including both ultrafast optical technology and the study of ultrafast phenomena. It covers picosecond, femtosecond and attosecond processes relevant to applications in physics, chemistry, biology, and engineering. Ultraf...

Australian Alps: Kosciuszko, Alpine and Namadgi National Parks (Second Edition

Directory of Open Access Journals (Sweden)

Nicole Porter

2017-02-01

Full Text Available Reviewed: Australian Alps: Kosciuszko, Alpine and Namadgi National Parks (Second Edition By Deidre Slattery. Clayton South, Australia: CSIRO Publishing, 2015. xvii + 302 pp. AU$ 45.00, US$ 35.95. ISBN 978-1-486-30171-3.

Koolis möödunud festival eelistas lapsi / Merit Kask, Liisi Poll

Index Scriptorium Estoniae

Kask, Merit

2003-01-01

Lõppenud Pärnu XVII dokumentaal- ja antropoloogiafilmide festivalist. Lisaks avaldavad oma arvamust rahvusvahelise žürii esimees John Russel Taylor, žürii liige Tiina Lokk ja eesti dokumentaalfilmide žürii esimees Tõnis Kask. Lisatud auhinnasaajate nimekiri

Inner-shell X-ray line spectra of highly ionized titanium, chromium, iron and nickel and their application to laboratory plasmas

International Nuclear Information System (INIS)

Lemen, J.R.; Phillips, K.J.H.; Doschek, G.A.; Cowan, R.D.

1986-06-01

The intensities of X-ray lines due to inner-shell 1s-2p transitions in 0 I-, N I-, and C I-like ions of Ti XV-XVII, Cr XVII-XIX, Fe XIX-XXI, and Ni XXI-XXIII, seen in tokamak plasmas are calculated. The lines are assumed to be formed by dielectronic recombination and inner-shell excitation. The dielectronic rates were calculated using a suite of computer programs developed by one of the authors. The inner-shell contribution was estimated by van Regemorter's formula. The present calculations were applied to the problem of radial ion diffusion in tokamaks. Spectra were calculated by integrating along various lines-of-sight to simulate what might be observed by an actual spectrometer viewing a tokamak plasma. A method for determining the diffusion coefficient from tokamak observations is discussed. (author)

Algunas calas en el uso de los nombres de color en El Quijote

Directory of Open Access Journals (Sweden)

Gerardo Fernández San Emeterio

2006-12-01

Full Text Available Colour terms had during XIV and XVII centuries a simbolic meaning which restrict their use in a certain way. In this article, the author exemplizes this use with some passages of Don Quijote and Novelas ejemplares.

Personnel Attrition Rates in Historical Land Combat Operations: A Catalog of Attrition and Casualty Data Bases on Diskettes Usable with Personal Computers

Science.gov (United States)

1993-09-01

Contemporary Electoral Processes; Political Partcipation; Public Opinion on Political Matters; Political Parties). XV. Orgaizaional Bhavio. (United...Pelaez (ed) Public Law and Comparative Politics. Trabajos en Homenaje a Ferran Vallis i Taberner, Vol XVII, Barcelona, Spain; Facultad de Derecho de

Review: Iwanaga, Kazuki (ed. (2008, Women’s Political Participation and Representation in Asia. Obstacles and Challenges

Directory of Open Access Journals (Sweden)

Dagmar Hellmann-Rajanayagam

2010-04-01

Full Text Available Review of the edited volume: Iwanaga, Kazuki (ed. (2008, Women’s Political Participation and Representation in Asia. Obstacles and Challenges, Copenhagen: NIAS Press, = Women and Politics in Asia No. 2, ISBN 9788776940164, XVII and 314 pages.

PREFACE: Sensors and Their Applications XVII

Science.gov (United States)

Bilas, V.; McConnell, G.; Kyriacou, P.

2013-06-01

This volume records the Proceedings of the seventeenth conference in the biennial Sensors and Their Applications series that took place at Rixos Libertas, Dubrovnik, Croatia from 16-18 September 2013. The conference is organised by the Instrument Science and Technology Group of the Institute of Physics. The conference was the first organised by the Institute of Physics to be held outside of the UK and Ireland, thus continuing the collaborative and adventurous nature of the meeting. The conference proceedings record the continuing health, diversity and activity of the sensors community worldwide, bringing together contributions from academics and industrial researchers to provide excellent networking opportunities. It is interesting to note some continuing themes such as Optical Sensors and Electromagnetic Sensors, as well as trends in Environmental Sensing and Glacial Monitoring that reflect our changing world, and Sensors in Biology and Medicine that have a growing importance with an ageing population. The conference also accounts for research specialisms and unique strengths from the local community in Croatia, including demining and metal detector sensing. We should like to thank all of our colleagues and friends in the sensor community who have supported this event by contributing manuscripts. Our thanks go also to members of the Technical Programme Committee for their support, and in particular for refereeing the submitted manuscripts. We are also pleased to express our thanks to the Conference Department of the Institute of Physics for their invaluable support in organising this event. We are especially grateful to Dawn Stewart for her responsive and day-to-day handling of this conference, as well as Claire Garland for help in planning and managing this international event. We hope that the conference authors, participants and a wider audience will find these proceedings to be of interest and to serve as a useful reference text. V Bilas, G McConnell and P Kyriacou Organising Committee Conference Organising Committee V Bilas, conference chair, University of Zagreb, Croatia G McConnell, conference chair, University of Strathclyde, UK P Kyriacou, conference chair, City University London, UK D Stewart, conference co-ordinator, Institute of Physics, UK Technical Programme Committee L Benini, University of Bologna, Italy M Butta, Czech Technical University in Prague, Czech Republic M Cifrek, University of Zagreb, Croatia G Collier, Kingston University London, UK J Deur, University of Zagreb, Croatia H Dzapo, University of Zagreb, Croatia M Gasulla, Universitat Politenica de Catalunya, BarcelonaTech, Spain S Hadjiloucas, University of Reading, UK P Kyriacou, City University of London, UK I Lackovic, University of Zagreb, Croatia R Magjarevic, University of Zagreb, Croatia G McConnell, University of Strathclyde, UK A O'Riordan, Tyndall National Institute, UK K Ozanyan, University of Manchester, UK A Peyton, University of Manchester, UK S Reilly, National Physical Laboratory, UK T Sun, City University London, UK A Tickle, Coventry University, UK D Vasic, University of Zagreb, Croatia S Welch, ESPKTN, UK Y Yan, University of Kent, UK H Zangl, Technical University of Graz, Austria

Uma análise crítica da literatura sobre a oferta e a circulação de moeda metálica no Brasil nos séculos XVI e XVII

Directory of Open Access Journals (Sweden)

Fernando Carlos G. de Cerqueira Lima

2005-03-01

Full Text Available Este artigo examina os principais fatores determinantes da oferta e da circulação de moeda metálica no Brasil nos séculos XVI e XVII. O objetivo é contribuir para o debate, até hoje pouco explorado, sobre a escassez de moeda no Brasil colonial. O trabalho é dividido em seis seções, além da introdução e considerações finais. A primeira apresenta as principais características do sistema bimetálico então vigente em Portugal e de sua política de desvalorização da unidade de conta. A análise da oferta de moeda no Brasil é desenvolvida nas quatro seções seguintes, destacando o início do processo de monetização, os fluxos de entrada e saída de metais, os impactos da política de cunhagem metropolitana e os episódios de remarcação e cunhagem de moeda no Brasil. Os determinantes do entesouramento são discutidos a seguir. Uma última seção resume os argumentos apresentados ao longo do trabalho.This paper examines the main factors that determined the supply and circulation of metallic coins in Brazil in the sixteenth and seventeenth centuries. The objective is to contribute to the debate, often neglected, on the scarcity of money in colonial Brazil. The paper is divided into six parts, on top of the introduction and the concluding remarks. The first presents the main features of the then prevalent Portuguese monetary system, as well as its policy of debasement. The next four parts deal with the supply of metallic currency in Brazil analysing respectively the early stages of the process of monetization, the inflows and outflows of precious metals, the impacts of the policy of coinage adopted by the Portuguese Crown, and some episodes of marking and minting of coins in Brazil. This is followed by an analysis of hoarding. It concludes with a summary of the main arguments developed along the paper.

Climate Change Impacts on High-Altitude Ecosystems

OpenAIRE

Harald Pauli

2016-01-01

Reviewed: Climate Change Impacts on High-Altitude Ecosystems By Münir Öztürk, Khalid Rehman Hakeem, I. Faridah-Hanum and Efe. Recep, Cham, Switzerland: Springer International Publishing, 2015. xvii + 696 pp. US$ 239.00. ISBN 978-3-319-12858-0.

40 CFR 70.2 - Definitions.

Science.gov (United States)

2010-07-01

... process); (xvi) Primary lead smelters; (xvii) Fuel conversion plants; (xviii) Sintering plants; (xix) Secondary metal production plants; (xx) Chemical process plants—The term chemical processing plant shall not... other requirement under section 112 of the Act, including any requirement concerning accident prevention...

Agricultural Technology, Health and Nutrition Linkages: Some ...

African Journals Online (AJOL)

... in technology-adopting households. Policymakers, however, need to be guided by more inter-disciplinary research to promote a greater understanding of how the links between agricultural technology and nutritional outcomes can be strengthened. Eastern Africa Social Science Research Review (EASSRR) Vol. XVII No.

Fe L-shell Excitation Cross Section Measurements on EBIT-I

Science.gov (United States)

Chen, Hui; Beiersdorfer, P.; Brown, G.; Boyce, K.; Kelley, R.; Kilbourne, C.; Porter, F.; Gu, M. F.; Kahn, S.

2006-09-01

We report the measurement of electron impact excitation cross sections for the strong iron L-shell 3-2 lines of Fe XVII to Fe XXIV at the LLNL EBIT-I electron beam ion trap using a crystal spectrometer and NASA-Goddard Space Flight Center's 6x6 pixel array microcalorimeter. The cross sections were determined by direct normalization to the well-established cross sections for radiative electron capture. Our results include the excitation cross section for over 50 lines at multiple electron energies. Although we have found that for 3C line in Fe XVII the measured cross sections differ significantly from theory, in most cases the measurements and theory agree within 20%. This work was performed under the auspices of the U.S. DOE by LLNL under contract No. W-7405-Eng-48 and supported by NASA APRA grants to LLNL, GSFC, and Stanford University.

A SOLAR SPECTROSCOPIC ABSOLUTE ABUNDANCE OF ARGON FROM RESIK

International Nuclear Information System (INIS)

Sylwester, J.; Sylwester, B.; Phillips, K. J. H.; Kuznetsov, V. D.

2010-01-01

Observations of He-like and H-like Ar (Ar XVII and Ar XVIII) lines at 3.949 A and 3.733 A, respectively, with the RESIK X-ray spectrometer on the CORONAS-F spacecraft, together with temperatures and emission measures from the two channels of GOES, have been analyzed to obtain the abundance of Ar in flare plasmas in the solar corona. The line fluxes per unit emission measure show a temperature dependence like that predicted from theory and lead to spectroscopically determined values for the absolute Ar abundance, A(Ar) = 6.44 ± 0.07 (Ar XVII) and 6.49 ± 0.16 (Ar XVIII), which are in agreement to within uncertainties. The weighted mean is 6.45 ± 0.06, which is between two recent compilations of the solar Ar abundance and suggests that the photospheric and coronal abundances of Ar are very similar.

PHYTOCHEMICAL ANALYSIS OF HYDROETHANOLIC EXTRACTS FROM POWDERED ROOTS OF Panax ginseng C. A. Meyer AND Heteropterys tomentosa A. Juss AND EVALUATION OF THEIR EFFECTS ON ASTROCYTE CELL DEATH

Directory of Open Access Journals (Sweden)

Andréia Gomes Bezerra

2016-06-01

Full Text Available The medicinal plants Panax ginseng C. A. Meyer (Araliaceae and Heteropterys tomentosa A. Juss (Malpighiaceae are widely and separately used by the Brazilian population as phytotherapeutics for the same medicinal purposes as tonics and to improve cognition. A chemical analysis was carried out on hydroethanolic extracts of powdered roots from P. ginseng and H. tomentosa using HPLC-DAD-ESI-MS/MS (High Performance Liquid Chromatography coupled to Diode-Array Detector and Electrospray Ionization - Mass Spectrum/Mass Spectrum. The ginsenosides Rg1, Rf, mRg and mRf were the main constituents in a hydroethanolic extract from P. ginseng, while in the hydroethanolic extract from H. tomentosa, caffeoylquinic acid derivatives and astilbin isomers were the main constituents. Concentration-time-effect curves were generated in cultures of astrocytes that were incubated with hydroethanolic extracts of these species to elucidate their toxicities. The P. ginseng extract was nontoxic at all of the tested times and concentrations. The hydroethanolic extract from H. tomentosa demonstrated toxicity at a concentration of 1000 µg/mL. P. ginseng extract had no protective effect against staurosporine. Many studies have demonstrated the neuroprotective effect of ginsenosides, caffeoylquinic derivatives and flavonoids.

PECULIARITIES OF SECONDARY METABOLITES BIOSYNTHESIS IN PLANT CELL CULTURES

Directory of Open Access Journals (Sweden)

A.M. NOSOV

2014-06-01

Full Text Available metabolites formation in plant cell cultures of Panax spp., (ginsenosides; Dioscorea deltoidea (steroid glycosides; Ajuga reptans, Serratula coronata, Rhaponticum carthamoides (ecdisteroids; Polyscias spp., (triterpene glycosides, Taxus spp. (taxoids, Stevia rebaudiana (diterpene steviol-glycosides, Stephania glabra (alkaloids. They are some regular trends of secondary metabolites synthesis in the plant cell culture:It can be noted the stable synthesis of the compound promoting cell proliferation. Indeed, cell cultures of Dioscorea deltoidea were demonstrated to accumulate only furostanol glycosides, which promoted cell division. Furostanol glycoside content of Dioscorea strain DM-0.5 was up to 6 - 12% by dry biomass.Panax ginseng and P. japonicus plant cell cultures synthesize as minimum seven triterpene glycosides (ginsenosides, the productivity of these compounds was up to 6.0 - 8.0% on dry biomass.By contrast, the detectable synthesis of diterpene steviol-glycosides in cultivated cells of Stevia rebaudiana initiated in the mixotrophic cultures during chloroplast formation only.Despite these differences, or mainly due to them, plant cell cultures have become an attractive source of phytochemicals in alternative to collecting wild plants. It provides a guideline to bioreactor-based production of isoprenoids using undifferentiated plant cell cultures. 

El estrecho de Magallanes como antesala del Pacífico: evolución cartográfica y toponimia entre los siglos XVI y comienzos del XVIII

Directory of Open Access Journals (Sweden)

Moreno Jeria, Rodrigo

2013-12-01

Full Text Available The Strait of Magellan was one of the geographical areas which generated more attention in the cartographers during the XVI and XVII centuries. In fact, for the Chilean case, together with Chiloe and Valdivia, the Magellanic region is the most represented. The reasons are both navigational and strategic purposes. That means that the surviving examples on public and private archives of several countries are comparatively abundant. The present study shows a new piece, which forms part of a navigational chart or «Derrotero» that is conserved in the Historical Archive of the Peruvian Navy, whose dating is roughly the early XVII century, although showing geographical representations from the previous century.El estrecho de Magallanes fue uno de los territorios que mayor atención despertó en los cartógrafos de los siglos XVI y XVIII. De hecho, para el caso chileno, junto a Chiloé y Valdivia, el territorio magallánico es el más importante en cuanto a representación geográfica, siendo razones de navegación así como estratégicas las que explican la gran cantidad de fuentes cartográficas existentes en archivos públicos y privados nacionales como extranjeros. El presente estudio da a conocer una nueva pieza que forma parte de un derrotero que se conserva en el Archivo de la Marina de Guerra del Perú, cuya datación aproximada es de comienzos del siglo XVII, aunque con representaciones geográficas del siglo anterior.

The DISAM Journal of International Security Assistance Management. Volume 24, Number 1, Fall 2001

Science.gov (United States)

2001-01-01

recipient. Often, but not always, purchases are indirect by nature. Indirect purchases are similar in definition to countertrade while direct purchases...Reviews Fighter Offset Bids. Countertrade & Offset, Vol XVII, No. 22,22 November 1999. Of the 41 new agreements, 21 were concluded with Europe, half

Climate Change Impacts on High-Altitude Ecosystems

Directory of Open Access Journals (Sweden)

Harald Pauli

2016-02-01

Full Text Available Reviewed: Climate Change Impacts on High-Altitude Ecosystems By Münir Öztürk, Khalid Rehman Hakeem, I. Faridah-Hanum and Efe. Recep, Cham, Switzerland: Springer International Publishing, 2015. xvii + 696 pp. US$ 239.00. ISBN 978-3-319-12858-0.

De las TIG a las TAG en la formación docente

OpenAIRE

López Fernández, José Antonio

2016-01-01

Aportación a la mesa redonda: “LA FORMACIÓN EN TIG EN LOS NUEVOS PLANES DE GRADOS Y MÁSTERES”, desarrollada en el marco del XVII Congreso Nacional de TIG. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech.

La educación geográfica empleando las TIG: una innovación necesaria

OpenAIRE

De Lázaro y Torres, María Luisa

2016-01-01

Aportación a la mesa redonda: “LA FORMACIÓN EN TIG EN LOS NUEVOS PLANES DE GRADOS Y MÁSTERES”, desarrollada en el marco del XVII Congreso Nacional de TIG. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech.

7 CFR 1767.16 - Electric plant instructions.

Science.gov (United States)

2010-01-01

... listed and defined hereunder: (1) Contract work includes amounts paid for work performed under contract... amortization and in Account 252, Customer Advances for Construction, shall be charged to such accounts and... satisfaction of state tax; (xvi) Filing satisfaction of mortgage; (xvii) Documentary stamps; (xviii...

40 CFR 71.2 - Definitions.

Science.gov (United States)

2010-07-01

...; (xv) Carbon black plants (furnace process); (xvi) Primary lead smelters; (xvii) Fuel conversion plants; (xviii) Sintering plants; (xix) Secondary metal production plants; (xx) Chemical process plants—The term... requirement concerning accident prevention under section 112(r)(7) of the Act; (5) Any standard or other...

Experimental and epidemiological evidence on non-organ specific cancer preventive effect of Korean ginseng and identification of active compounds

Energy Technology Data Exchange (ETDEWEB)

Yun, T.-K

2003-03-01

Panax ginseng C.A. Meyer has been the most highly recognized medicinal herb in the Orient. The prolonged administration of red ginseng extract significantly inhibits the incidence of hepatoma and also proliferation of pulmonary tumors induced by aflatoxin B{sub 1} and urethane. Statistically significant anticarcinogenic effects were in aged or heat treated extracts of ginseng and red ginseng made by steaming in a 9 weeks medium-term anticarcinogenicity test using benzo[a]pyrene. In case-control studies, odds ratios (OR) of the cancer of lip, oral cavity and pharynx, larynx, lung, esophagus, stomach, liver, pancreas, ovary, and colorectum were significantly reduced. As to the type of ginseng, the ORs for cancer were reduced in user of fresh ginseng extract intakers, white ginseng extract, white ginseng powder, and red ginseng. In a cohort study with 5 years follow-up conducted in a ginseng cultivation area, ginseng users had a decreased relative risk (RR) compared with non-users. The relative risks (RRs) of ginseng users were decreased in gastric cancer and lung cancer. These findings strongly suggest that Panax ginseng C.A. Meyer cultivated in Korea has non-organ specific cancer preventive effects against various cancers. To investigate the active components for cancer prevention, several fractions of fresh and red ginseng and four semi-synthetic ginsenoside Rh{sub 1}, Rh{sub 2}, Rg{sub 3} and Rg{sub 5}, the major saponin components in red ginseng, were prepared among the ginsenosides. By using Yun's model, Rg{sub 3} and Rg{sub 5} showed statistically significant reduction of lung tumor incidence and Rh{sub 2} had a tendency to decrease the incidence. In conclusion, these results strongly suggested that Panax ginseng C.A. Meyer cultivated in Korea is a non-organ specific cancer preventive against human cancers and also indicated that the anticarcinogenicity or human cancer preventive effect of Panax ginseng is due to ginsenoside Rg{sub 3}, Rg{sub 5} and Rh

Analysis of the Effect of Historical Cultural Changes Relative to the Development of Affordability Excursions to Existing Parametric Cost Models

Science.gov (United States)

1988-09-30

the investigations. The output over the entire period of the test moved generally upward and exceeded the wildest estimates of the Stesters. Absenteeism ...Downside of Telecommuting ." Behavioral Sciences Newsletter XVII (March 14, 1988): 3-4. "The Make-or-Break Power of Corporate Culture." Behavioral

Proyectos barrocos para la Seu d'Urgell

Directory of Open Access Journals (Sweden)

Juan Bassegoda Nonell

1990-01-01

Full Text Available De un tiempo a esta parte parece como si se hubiera iniciado un movimiento en defensa de la arquitectura barroca y, especialmente de la que, en los siglos XVII y XVIII, se superpuso a los muros y bóvedas de las iglesias medievales.

The Challenges of the Civil Service Reform in Ethiopia: Initial ...

African Journals Online (AJOL)

The paper concludes by arguing that the reform measures must be contextualised and executed incrementally by identifying priority areas, while taking into consideration capacity to implement the measures proposed. Eastern Africa Social Science Research Review (EASSRR) Vol. XVII No. 1 January 2001, pp. 79-102 ...

20 CFR 10.303 - Should the employer use a Form CA-16 to authorize medical testing when an employee is exposed to...

Science.gov (United States)

2010-04-01

...' COMPENSATION ACT CLAIMS FOR COMPENSATION UNDER THE FEDERAL EMPLOYEES' COMPENSATION ACT, AS AMENDED Medical and... testing for an employee who has merely been exposed to a workplace hazard, unless the employee has... Occupational Safety and Health Administration at 29 CFR chapter XVII require employers to provide their...

Summary of Research. 1996-1997

Science.gov (United States)

1997-10-01

female history--whether of the family, economy, religion , participation are delineated. witchcraft, popular culture, or political culture--is the The...de Amescua en candelero. Actas del Congreso Internacional sobre Mira de Amescua y el teatro español del siglo XVII, Granada, 27-30 de octubre de

8 de marzo "Día internacional de la mujer"

OpenAIRE

Gutiérrez González, Acela Elena

1985-01-01

Este año se cumple, setenta y cinco años de conmemoración del Día Internacional de la Mujer 8 de marzo, constituido desde 1910 para unificar las luchas que se gestaron a partir del siglo XVII por el derecho al voto.