WorldWideScience
 
 
1

Differential Diagnosis of Taenia saginata and Taenia solium Infection by PCR  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We have designed species-specific oligonucleotides which permit the differential detection of two species of cestodes, Taenia saginata and Taenia solium. The oligonucleotides contain sequences established for two previously reported, noncoding DNA fragments cloned from a genomic library of T. sagina...

González, Luis Miguel; Montero, Estrella; Harrison, Leslie J. S.; Parkhouse, R. Michael E.; Garate, Teresa

2

Taeniasis and cysticercosis due to Taenia solium in Japan  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Abstract Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the r...

Yanagida Tetsuya; Sako Yasuhito; Nakao Minoru; Nakaya Kazuhiro; Ito Akira

3

Immunoreactive proteins in Taenia solium  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is a neglected zoonotic disease that constitutes a serious public health problem in many low-income countries of Latin America, Africa, and Asia. Although diagnostic antigens are available, it is still necessary to identify new targets to improve the current diagnostic me...

Salazar-Anton, Fernando

4

TSOL18 Vaccine Antigen of Taenia solium: Development of Monoclonal Antibodies and Field Testing of the Vaccine in Cameroon  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Chapter 1 reviews the literature about the immunological aspects of taeniid cestode infections and the existing vaccines against Taenia solium cysticercosis in pigs. One of the most promising vaccines is TSOL18, a protein that has been identified in the oncosphere of Taenia solium and expressed as a...

Assana, E.

5

Vaccination against Taenia solium cysticercosis  

Directory of Open Access Journals (Sweden)

Full Text Available Taenia solium is a parasite that causes human cysticercosis. Its life cycle includes the adult stage, the egg and the larval stage. Human cysticercosis is a disease related to underdevelopment, the main clinical manifestation is neurocysticercosis. Control measures include mass cestocidal treatment aimed to cure possible taeniosis cases. Although useful it has certain disadvantages, such as the generation of symptomatology in occult neurocysticercosis. Alternatively, health education has been shown to be highly effective since people become aware of the importance of human and porcine cysticercosis and the possibility of eliminating it. Nevertheless it has to be implemented by knowledgeable people. On the other hand, the life cycle can be controlled by avoiding swine cysticercosis. This review describes the studies performed to vaccinate pigs against T. solium and indicate that short time perspectives are very encouraging for the production of an optimal vaccine.

Flisser Ana; Lightowlers Marshall W

2001-01-01

6

Vaccination against Taenia solium cysticercosis  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english Taenia solium is a parasite that causes human cysticercosis. Its life cycle includes the adult stage, the egg and the larval stage. Human cysticercosis is a disease related to underdevelopment, the main clinical manifestation is neurocysticercosis. Control measures include mass cestocidal treatment aimed to cure possible taeniosis cases. Although useful it has certain disadvantages, such as the generation of symptomatology in occult neurocysticercosis. Alternatively, heal (more) th education has been shown to be highly effective since people become aware of the importance of human and porcine cysticercosis and the possibility of eliminating it. Nevertheless it has to be implemented by knowledgeable people. On the other hand, the life cycle can be controlled by avoiding swine cysticercosis. This review describes the studies performed to vaccinate pigs against T. solium and indicate that short time perspectives are very encouraging for the production of an optimal vaccine.

Flisser, Ana; Lightowlers, Marshall W

2001-04-01

7

Taeniasis and cysticercosis due to Taenia solium in Japan  

Directory of Open Access Journals (Sweden)

Full Text Available Abstract Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the recent increase in international tourism and immigration is spreading the disease into non-endemic developed countries such as the United States. Although there has been concern that the number of cysticercosis cases is increasing in Japan, the current situation is not clear. This is largely because taeniasis and cysticercosis are not notifiable conditions in Japan and because there have been no comprehensive reviews of T. solium infections in Japan conducted in the last 15 years. Herein, we provide an overview of the status of T. solium infection in Japan over the past 35 years and point out the potential risks to Japanese society.

Yanagida Tetsuya; Sako Yasuhito; Nakao Minoru; Nakaya Kazuhiro; Ito Akira

2012-01-01

8

Taeniasis and cysticercosis due to Taenia solium in Japan.  

UK PubMed Central (United Kingdom)

Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the recent increase in international tourism and immigration is spreading the disease into non-endemic developed countries such as the United States. Although there has been concern that the number of cysticercosis cases is increasing in Japan, the current situation is not clear. This is largely because taeniasis and cysticercosis are not notifiable conditions in Japan and because there have been no comprehensive reviews of T. solium infections in Japan conducted in the last 15 years. Herein, we provide an overview of the status of T. solium infection in Japan over the past 35 years and point out the potential risks to Japanese society.

Yanagida T; Sako Y; Nakao M; Nakaya K; Ito A

2012-01-01

9

Other cestodes: sparganosis, coenurosis and Taenia crassiceps cysticercosis.  

UK PubMed Central (United Kingdom)

Many cestodes are capable of invading the central nervous system (CNS), and several are highly prevalent in the developing world. Neurocysticercosis due to Taenia solium and echinococcosis due to Echinoccocus granulosus are two of the most common parasitic infections affecting humans, but other less well-known parasites can also infect the nervous system. Coenurosis, caused by Taenia spp. such as T. multiceps, T. serialis, or T. brauni; sparganosis, caused by Spirometra spp., and neurocysticercosis caused by T. crassiceps are three less frequent zoonotic conditions that should be considered in the differential diagnosis of patients presenting with CNS infection - especially if they have lived in or traveled through areas where these infections are endemic. Diagnosis of these infections is typically made through a combination of serological testing, histopathology, and neuroimaging.

Lescano AG; Zunt J

2013-01-01

10

Other cestodes: sparganosis, coenurosis and Taenia crassiceps cysticercosis.  

Science.gov (United States)

Many cestodes are capable of invading the central nervous system (CNS), and several are highly prevalent in the developing world. Neurocysticercosis due to Taenia solium and echinococcosis due to Echinoccocus granulosus are two of the most common parasitic infections affecting humans, but other less well-known parasites can also infect the nervous system. Coenurosis, caused by Taenia spp. such as T. multiceps, T. serialis, or T. brauni; sparganosis, caused by Spirometra spp., and neurocysticercosis caused by T. crassiceps are three less frequent zoonotic conditions that should be considered in the differential diagnosis of patients presenting with CNS infection - especially if they have lived in or traveled through areas where these infections are endemic. Diagnosis of these infections is typically made through a combination of serological testing, histopathology, and neuroimaging. PMID:23829923

Lescano, Andres G; Zunt, Joseph

2013-01-01

11

Detailed transcriptome description of the neglected cestode Taenia multiceps.  

UK PubMed Central (United Kingdom)

BACKGROUND: The larval stage of Taenia multiceps, a global cestode, encysts in the central nervous system (CNS) of sheep and other livestock. This frequently leads to their death and huge socioeconomic losses, especially in developing countries. This parasite can also cause zoonotic infections in humans, but has been largely neglected due to a lack of diagnostic techniques and studies. Recent developments in next-generation sequencing provide an opportunity to explore the transcriptome of T. multiceps. METHODOLOGY/PRINCIPAL FINDINGS: We obtained a total of 31,282 unigenes (mean length 920 bp) using Illumina paired-end sequencing technology and a new Trinity de novo assembler without a referenced genome. Individual transcription molecules were determined by sequence-based annotations and/or domain-based annotations against public databases (Nr, UniprotKB/Swiss-Prot, COG, KEGG, UniProtKB/TrEMBL, InterPro and Pfam). We identified 26,110 (83.47%) unigenes and inferred 20,896 (66.8%) coding sequences (CDS). Further comparative transcripts analysis with other cestodes (Taenia pisiformis, Taenia solium, Echincoccus granulosus and Echincoccus multilocularis) and intestinal parasites (Trichinella spiralis, Ancylostoma caninum and Ascaris suum) showed that 5,100 common genes were shared among three Taenia tapeworms, 261 conserved genes were detected among five Taeniidae cestodes, and 109 common genes were found in four zoonotic intestinal parasites. Some of the common genes were genes required for parasite survival, involved in parasite-host interactions. In addition, we amplified two full-length CDS of unigenes from the common genes using RT-PCR. CONCLUSIONS/SIGNIFICANCE: This study provides an extensive transcriptome of the adult stage of T. multiceps, and demonstrates that comparative transcriptomic investigations deserve to be further studied. This transcriptome dataset forms a substantial public information platform to achieve a fundamental understanding of the biology of T. multiceps, and helps in the identification of drug targets and parasite-host interaction studies.

Wu X; Fu Y; Yang D; Zhang R; Zheng W; Nie H; Xie Y; Yan N; Hao G; Gu X; Wang S; Peng X; Yang G

2012-01-01

12

Antibody responses to the host-protective Taenia solium oncosphere protein TSOL18 in pigs are directed against conformational epitopes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

TSOL18 is a recombinant protein that has been shown in repeated experimental trials to be capable of protecting pigs against challenge infection with the cestode parasite Taenia solium. Antibodies raised by the vaccine are capable of killing the parasite in an in vitroculture and it is believed that...

ASSANA, E; GAUCI, C G; KYNGDON, C T; ZOLI, A P; DORNY, P; GEERTS, S; LIGHTOWLERS, M W

13

Occurrence of Taenia solium and Cysticercosis in Man in Egypt  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis is emerging as a serious public health and agricultural problem. In Egypt Taenia solium/ human cysticercosis is rare. Therefore, this study aims to survey the occurrence of T. solium and cysticercosis in human in Assiut and Sohage Governorates. Stool samples were collected from 425 pa...

Basem; R. N. Abdo; Amal S.M. Sayed; Asmaa A.A. Hussein,Mohsen; I. Arafa

14

Nested PCR for Specific Diagnosis of Taenia solium Taeniasis?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taeniasis due to Taenia solium is a disease with important public health consequences, since the larval stage is not exclusive to the animal intermediate, the pig, but also infects humans, causing neurocysticercosis. Early diagnosis and treatment of T. solium tapeworm carriers is important to preven...

Mayta, Holger; Gilman, Robert H.; Prendergast, Emily; Castillo, Janeth P.; Tinoco, Yeny O.; Garcia, Hector H.; Gonzalez, Armando E.

15

State of the Art of Taenia solium as Compared to Taenia asiatica  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Three species of tapeworms infect humans in their adult stage (Taenia solium, Taenia saginata and Taenia asiatica). The 3 are flat, opaque white or yellowish, and exceptional long segmented parasites, measuring 1 to 12 m in their adult stage. In this review, the development of the knowledge regardin...

Flisser, Ana

16

Prevalence of antibodies to unique Taenia solium oncosphere antigens in taeniasis and human and porcine cysticercosis.  

Science.gov (United States)

The presence of two oncosphere antigens (OAs) of 22.5 and 31.3 kD in whole and excretory/secretory (ES) OA preparations of both Taenia solium and T. saginata or in antigen preparations from T. solium metacestodes or immature tapeworms was assessed. This included an evaluation of whether antibodies to other cestodes cross-reacted to these OAs. The OAs were present in whole oncosphere extract and E/S antigens of T. solium, but were not present in other stages (immature tapeworm or metacestode) or in OAs of T. saginata. The majority (95%) of T. solium tapeworm carriers had antibodies to these OAs, while only 20% of active neurocysticercosis cases were positive. No antibodies to the OAs were found in healthy controls, subjects infected with Hymenolepis nana, patients with hydatid disease, T. saginata tapeworm carriers, hamsters infected with immature T. solium tapeworms, or dogs infected with Echinococcus granulosus. The OAs are stage and species specific to T. solium and antibodies to OAs are usually present in tapeworm carriers. PMID:14640505

Verastegui, Manuela; Gilman, Robert H; Garcia, Hector H; Gonzalez, Armando E; Arana, Yanina; Jeri, Cesar; Tuero, Iskra; Gavidia, Cesar M; Levine, Min; Tsang, Victor C W

2003-10-01

17

Proteomic analysis of Taenia solium metacestode excretion-secretion proteins.  

UK PubMed Central (United Kingdom)

The metacestode larval stage of Taenia solium is the causal agent of a zoonotic disease called cysticercosis. The disease has an important impact on pork trade (due to porcine cysticercosis) and public health (due to human neurocysticercosis). In order to improve the current diagnostic tools and to get a better understanding of the interaction between T. solium metacestodes and their host, there is a need for more information about the proteins that are released by the parasite. In this study, we used protein sequences from different helminths, 1DE, reversed-phase LC, and MS/MS to analyze the excretion-secretion proteins produced by T. solium metacestodes from infected pigs. This is the first report of the T. solium metacestode excretion-secretion proteome. We report 76 proteins including 27 already described T. solium proteins, 17 host proteins and 32 proteins likely to be of T. solium origin, but identified using sequences from other helminths.

Victor B; Kanobana K; Gabriël S; Polman K; Deckers N; Dorny P; Deelder AM; Palmblad M

2012-06-01

18

The Disease Burden of Taenia solium Cysticercosis in Cameroon  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is a zoonotic disease occurring in many developing countries. A relatively high prevalence in humans and pigs has been reported in several parts of the world, but insufficient data are available on the disease burden. Disease impact assessment needs detailed information o...

Praet, Nicolas; Speybroeck, Niko; Manzanedo, Rafael; Berkvens, Dirk; Nsame Nforninwe, Denis; Zoli, André; Quet, Fabrice

19

The Disease Burden of Taenia solium Cysticercosis in Cameroon  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Background: Taenia solium cysticercosis is an important zoonosis in many developing countries. Human neurocysticercosis is recognised as an important cause of epilepsy in regions where the parasite occurs. However, it is largely underreported and there is a lack of data about the disease burden. Bec...

Praet, Nicolas; Speybroeck, Niko; Manzanedo, Rafael; Berkvens, Dirk; Nforninwe, Denis Nsame; Zoli, Andre; Quet, Fabrice

20

Intraventricular Taenia solium neurocysticercosis: a report of three cases  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Neurocysticercosis (NCC), caused by the pork tapeworm Taenia solium, is reported to be a common condition in Nepal. So far imaging diagnosis was mainstay of the diagnosis. In this paper, we report three patients presenting with neurological symptoms due to intraventricular NCC. We have diagnosed the...

Pant, B.; Devleesschauwer, B.; Shrestha, P.; Shrestha, I.; Praet, N.; Dorny, P.

 
 
 
 
21

The disease burden of Taenia solium cysticercosis in Cameroon  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is an important zoonosis in many developing countries. Human neurocysticercosis is recognised as an important cause of epilepsy in regions where the parasite occurs. However, it is largely underreported and there is a lack of data about the disease burden. Beca...

Praet, N.; Speybroeck, N.; Manzanedo, R.; Berkvens, D.; Nforninwe, D. N.; Zoli, A.; Quet, F.; Preux, P. M.; Carabin, H.

22

Morphologic and genetic identification of Taenia tapeworms in Tanzania and DNA genotyping of Taenia solium.  

Science.gov (United States)

Species identification of Taenia tapeworms was performed using morphologic observations and multiplex PCR and DNA sequencing of the mitochondrial cox1 gene. In 2008 and 2009, a total of 1,057 fecal samples were collected from residents of Kongwa district of Dodoma region, Tanzania, and examined microscopically for helminth eggs and proglottids. Of these, 4 Taenia egg positive cases were identified, and the eggs were subjected to DNA analysis. Several proglottids of Taenia solium were recovered from 1 of the 4 cases. This established that the species were T. solium (n = 1) and T. saginata (n = 3). One further T. solium specimen was found among 128 fecal samples collected from Mbulu district in Arusha, and this had an intact strobila with the scolex. Phylegenetic analysis of the mtDNA cox1 gene sequences of these 5 isolates showed that T. saginata was basal to the T. solium clade. The mitochondrial cox1 gene sequences of 3 of these Tanzanian isolates showed 99% similarity to T. saginata, and the other 2 isolates showed 100% similarity to T. solium. The present study has shown that Taenia tapeworms are endemic in Kongwa district of Tanzania, as well as in a previously identified Mbulu district. Both T. solium isolates were found to have an "African/Latin American" genotype (cox1). PMID:22355207

Eom, Keeseon S; Chai, Jong-Yil; Yong, Tai-Soon; Min, Duk-Young; Rim, Han-Jong; Kihamia, Charles; Jeon, Hyeong-Kyu

2011-12-16

23

Morphologic and genetic identification of Taenia tapeworms in Tanzania and DNA genotyping of Taenia solium.  

UK PubMed Central (United Kingdom)

Species identification of Taenia tapeworms was performed using morphologic observations and multiplex PCR and DNA sequencing of the mitochondrial cox1 gene. In 2008 and 2009, a total of 1,057 fecal samples were collected from residents of Kongwa district of Dodoma region, Tanzania, and examined microscopically for helminth eggs and proglottids. Of these, 4 Taenia egg positive cases were identified, and the eggs were subjected to DNA analysis. Several proglottids of Taenia solium were recovered from 1 of the 4 cases. This established that the species were T. solium (n = 1) and T. saginata (n = 3). One further T. solium specimen was found among 128 fecal samples collected from Mbulu district in Arusha, and this had an intact strobila with the scolex. Phylegenetic analysis of the mtDNA cox1 gene sequences of these 5 isolates showed that T. saginata was basal to the T. solium clade. The mitochondrial cox1 gene sequences of 3 of these Tanzanian isolates showed 99% similarity to T. saginata, and the other 2 isolates showed 100% similarity to T. solium. The present study has shown that Taenia tapeworms are endemic in Kongwa district of Tanzania, as well as in a previously identified Mbulu district. Both T. solium isolates were found to have an "African/Latin American" genotype (cox1).

Eom KS; Chai JY; Yong TS; Min DY; Rim HJ; Kihamia C; Jeon HK

2011-12-01

24

Occurrence of Taenia solium and Cysticercosis in Man in Egypt  

Directory of Open Access Journals (Sweden)

Full Text Available Cysticercosis is emerging as a serious public health and agricultural problem. In Egypt Taenia solium/ human cysticercosis is rare. Therefore, this study aims to survey the occurrence of T. solium and cysticercosis in human in Assiut and Sohage Governorates. Stool samples were collected from 425 patients suffering from gastrointestinal disturbances, who attended some hospitals in Assiut and Sohage Governorates. Stool samples were examined by both direct smear method and simple gravity sedimentation technique. Ninety two serum samples were collected randomly from the patients. IgG antibodies against Taenia solium and its cysticerci (Cysticercus cellulose) were detected in human serum by using ELISA. The occurrence of T. solium among 425 examined patients in the present work was 0.7% by using sedimentation stool examination technique. The seroprevalence of Taenia solium/cysticercosis in humans in Assiut and Sohage Governorates was 6.5% by using ELISA test. A great variation in the ecological distribution of Taenia solium/Cysticercosis in human was detected between Assiut and Sohage Governorates (8.1% & 3.33% respectively). Higher seroprevalence was detected in women (8.5%) than men (3.0%). There was positive correlation between the age of the patient and the infection rate which was 5.3% in the age group below 20 years, 5.5% in the age group 20-40 years and 11.1% in the age group above 40 years. Results obtained in this study reveal that cysticercosis is prevalent among man in the examined areas. Public health education is considered the key factor for control of cysticercosis. [Vet. World 2010; 3(2.000): 57-60

Basem; R. N. Abdo; Amal S.M. Sayed; Asmaa A.A. Hussein,Mohsen; I. Arafa

2010-01-01

25

Isozyme analysis of Taenia solium isolates from Mexico and Colombia  

Directory of Open Access Journals (Sweden)

Full Text Available Mexican and Colombian Taenia solium cysticerci and some species of Taenia adults were assayed using cellulose acetate electrophoresis to distinguish between isolates. Isozyme patterns for ARK, GOT, G3PD, GPI, and MPI were identical in all cysticerci suggesting homozygotic profiles. G6PD and MDH showed different patterns between Mexican and Colombian cysticerci, suggesting regional differences. ME activity was mainly detected in the adult stage suggesting that this enzyme is active in anaerobic environment, while MDH, detected in cysticerci, could be related to an environment that contains oxygen. Finally, the species of taeniid adults analyzed showed different patterns among them.

Pablo Maravilla; Aldo Valera; Valeria Souza; Mario Martinez-Gordillo; Ana Flisser

2003-01-01

26

Isozyme analysis of Taenia solium isolates from Mexico and Colombia  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english Mexican and Colombian Taenia solium cysticerci and some species of Taenia adults were assayed using cellulose acetate electrophoresis to distinguish between isolates. Isozyme patterns for ARK, GOT, G3PD, GPI, and MPI were identical in all cysticerci suggesting homozygotic profiles. G6PD and MDH showed different patterns between Mexican and Colombian cysticerci, suggesting regional differences. ME activity was mainly detected in the adult stage suggesting that this enzyme (more) is active in anaerobic environment, while MDH, detected in cysticerci, could be related to an environment that contains oxygen. Finally, the species of taeniid adults analyzed showed different patterns among them.

Maravilla, Pablo; Valera, Aldo; Souza, Valeria; Martinez-Gordillo, Mario; Flisser, Ana

2003-12-01

27

Human and porcine Taenia solium infection in rural north India.  

UK PubMed Central (United Kingdom)

72 members of a pig farming community and 50 slaughtered pigs in Uttar Pradesh, India, were examined between November 2000 and June 2001 for Taenia solium infection. 27 of the human subjects (38%) had intestinal taeniasis and 7 (9.7%) had reported seizures. All 3 of the latter who were examined had neurocysticercosis. 13 of the pigs (26%) had cysticercosis. Such high prevalences indicate the need for detailed assessment of the disease burden in this community.

Prasad KN; Chawla S; Jain D; Pandey CM; Pal L; Pradhan S; Gupta RK

2002-09-01

28

Corticosteroid Withdrawal Precipitates Perilesional Edema around Calcified Taenia solium Cysts.  

UK PubMed Central (United Kingdom)

Calcified Taenia solium granulomas are the focus of repeated episodes of perilesional edema and seizures in 50% of persons with calcifications, history of seizures, and a positive serology for cysticercosis. The pathophysiology is unclear but recent studies suggest the edema is caused by inflammation. We report two new cases and four other published cases where cessation of corticosteroids appeared to result in recurrence or new appearance of perilesional edema around calcifications. This suggests that perilesional edema is an immune-mediated phenomenon.

Mejia R; Nash TE

2013-09-01

29

Specific Taenia crassiceps and Taenia solium Antigenic Peptides for Neurocysticercosis Immunodiagnosis Using Serum Samples  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Neurocysticercosis (NC), i.e., the presence of the larval form of Taenia solium in tissues, is the most frequent and severe infection involving the central nervous system. Paired serum and cerebrospinal fluid (CSF) samples from patients with NC, CSF and serum samples from a control group, and serum ...

Bueno, Ednéia Casagranda; Vaz, Adelaide José; Machado, Luís Dos Ramos; Livramento, José Antônio; Mielle, Sílvia Regina

30

Taenia solium cysticerci synthesize androgens and estrogens in vitro.  

Science.gov (United States)

Cysticerci from Taenia solium develop in the pig muscle and cause severe diseases in humans. Here we report on the capacity of T. solium cysticerci to synthesize sex steroid hormones. T. solium cysticerci were dissected from infected pork meat. Parasites were incubated for different periods in culture media plus antibiotics and tritiated steroid precursors. Blanks and parasite culture media were extracted and analyzed by thin-layer chromatography (TLC) in two different solvent systems. In some experiments, the scoleces were incubated separately. Results showed that T. solium cysticerci transform [(3)H]androstenedione to [(3)H]testosterone in a time-dependent manner. The production was confirmed in two different solvent systems. The incubation with [(3)H]testosterone yielded only small amounts of [(3)H]androstenedione. The recrystallization procedure further demonstrated that the metabolite identified by TLC was testosterone. The isolated scoleces incubated in the presence of [(3)H]androstenedione yielded [(3)H]testosterone and small quantities of [(3)H]17beta-estradiol. The results reported here demonstrate that T. solium cysticerci have the capacity to synthesize steroid hormones. PMID:16416116

Valdéz, R A; Jiménez, P; Cartas, A L; Gómez, Y; Romano, M C

2006-01-14

31

Taenia solium cysticerci synthesize androgens and estrogens in vitro.  

UK PubMed Central (United Kingdom)

Cysticerci from Taenia solium develop in the pig muscle and cause severe diseases in humans. Here we report on the capacity of T. solium cysticerci to synthesize sex steroid hormones. T. solium cysticerci were dissected from infected pork meat. Parasites were incubated for different periods in culture media plus antibiotics and tritiated steroid precursors. Blanks and parasite culture media were extracted and analyzed by thin-layer chromatography (TLC) in two different solvent systems. In some experiments, the scoleces were incubated separately. Results showed that T. solium cysticerci transform [(3)H]androstenedione to [(3)H]testosterone in a time-dependent manner. The production was confirmed in two different solvent systems. The incubation with [(3)H]testosterone yielded only small amounts of [(3)H]androstenedione. The recrystallization procedure further demonstrated that the metabolite identified by TLC was testosterone. The isolated scoleces incubated in the presence of [(3)H]androstenedione yielded [(3)H]testosterone and small quantities of [(3)H]17beta-estradiol. The results reported here demonstrate that T. solium cysticerci have the capacity to synthesize steroid hormones.

Valdéz RA; Jiménez P; Cartas AL; Gómez Y; Romano MC

2006-04-01

32

Sympatric Occurrence of Taenia solium, T. saginata, and T. asiatica, Thailand  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We confirmed sympatric occurrence of Taenia solium, T. saginata, and T. asiatica in western Thailand. DNA analysis of morphologically identified T. saginata, in a dual infection with T. solium, indicated it was T. asiatica. To our knowledge, this report is the first of T. asiatica and a dual Taenia ...

Anantaphruti, Malinee T.; Yamasaki, Hiroshi; Nakao, Minoru; Waikagul, Jitra; Watthanakulpanich, Dorn; Nuamtanong, Supaporn

33

Does interspecific competition have a moderating effect on Taenia solium transmission dynamics in Southeast Asia?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

It is well understood that sociocultural practices strongly influence Taenia solium transmission; however, the extent to which interspecific parasite competition moderates Taenia transmission has yet to be determined. This is certainly the case in Southeast Asia where T. solium faces competition in ...

Conlan, JV; Vongxay, K; Fenwick, S; Blacksell, SD; Thompson, RC

34

State of the art of Taenia solium as compared to Taenia asiatica.  

UK PubMed Central (United Kingdom)

Three species of tapeworms infect humans in their adult stage (Taenia solium, Taenia saginata and Taenia asiatica). The 3 are flat, opaque white or yellowish, and exceptional long segmented parasites, measuring 1 to 12 m in their adult stage. In this review, the development of the knowledge regarding the first species, mainly focused on understanding how the larval stage or cysticercus is transmitted to humans, is described. The second species is a cosmopolitan parasite that only causes taeniosis and not cysticercosis; therefore, it will not be included. Information on the third species, which is presently being produced, since this species was recognized as such only at the end of the 20th century, will be discussed at the end of this review.

Flisser A

2013-02-01

35

State of the art of Taenia solium as compared to Taenia asiatica.  

Science.gov (United States)

Three species of tapeworms infect humans in their adult stage (Taenia solium, Taenia saginata and Taenia asiatica). The 3 are flat, opaque white or yellowish, and exceptional long segmented parasites, measuring 1 to 12 m in their adult stage. In this review, the development of the knowledge regarding the first species, mainly focused on understanding how the larval stage or cysticercus is transmitted to humans, is described. The second species is a cosmopolitan parasite that only causes taeniosis and not cysticercosis; therefore, it will not be included. Information on the third species, which is presently being produced, since this species was recognized as such only at the end of the 20th century, will be discussed at the end of this review. PMID:23467388

Flisser, Ana

2013-02-18

36

Diferenciação específica entre Taenia saginata e Taenia solium por ensaio de PCR e duplex-PCR  

Directory of Open Access Journals (Sweden)

Full Text Available Este estudo teve como objetivo a padronização de protocolos e a seleção de novos primers para a identificação espécie-específica de Taenia saginata e Taenia solium através da reação em cadeia da polimerase (PCR) e duplex-PCR. Inicialmente, foram recuperadas seqüências depositadas no GenBank (acesso ndegrees AB020399 para T. saginata e ndegrees AB020395 para T. solium) referentes ao gene da subunidade maior do ribossomo (LSU RNAr) de tenídeos. A partir do alinhamento das seqüências, um primer genérico denominado TBR-3 (5'-ggcttgtttgaatggtttgacg- 3') foi selecionado de região conservada e, de diferentes regiões semi-conservadas, os primers específicos TBR-4 para T. saginata (5'-cgactcatgaagataaacaaggt-3') e TBR-5 (5'-cggtcgaacagaccataaatct-3') e TBR-6 (5'-gctactacacctaaattctaacc- 3') para T. solium. Os primers foram avaliados quanto à especificidade através da PCR empregando-se DNA total (DNAt) de amostras de cisticercos e proglotes dos parasitos, previamente identificadas por critérios morfológicos. O par de primers TBR-3/TBR-4 permitiu a amplificação específica do fragmento esperado de 328 pb a partir do DNAt de T. saginata. Os pares TBR-3/TBR-5 e TBR-3/TBR-6 permitiram a amplificação, respectivamente, dos fragmentos específicos de 310pb e 286pb a partir do DNAt de T. solium. A identidade dos produtos de PCR foi comprovada comparando-se a seqüência dos amplicons obtidos às seqüências de referência do gene LSU RNAr registrado no GenBank (ndegrees AB020399 e ndegrees AB020395). As reações apresentaram sensibilidade para detecção de até 1fg do DNAt de T. solium e 0,2fg do DNAt de T. saginata. A combinação dos primers TBR-3/TBR-4 e TBR3/TBR-6 e o tamanho dos fragmentos gênicos obtidos permitiram o estabelecimento de ensaios de duplex-PCR, eficaz na detecção simultânea do DNA de T. saginata e T. solium em sistema único de reação. Os primers utilizados não geraram qualquer produto de amplificação cruzada quando testados com DNAt de Taenia hydatigena, Taenia taeniaeformis, Hymenolepis diminuta, Anoplocephala magna, Paranoplocephala mamillana e Moniezia expansa, nem frente ao DNAt dos hospedeiros Homo sapiens, Bos taurus e Sus scrofa.

Jardim Eurione Antônio Garcia da Veiga; Linhares Guido Fontgalland Coelho; Torres Fernando Araripe Gonçalves; Araújo José Luiz de Barros; Barbosa Silvia Minharro

2006-01-01

37

Immunoinformatics prediction of linear epitopes from Taenia solium TSOL18  

Directory of Open Access Journals (Sweden)

Full Text Available Cysticercosis is a public health problem in several developing countries. The oncosphere protein TSOL18 is the most immunogenic and protective antigen ever reported against porcine cysticercosis, although no specific epitope has been identified to account for these properties. Recent evidence suggests that protection might be associated with conformational epitopes. Linear epitopes from TSOL18 were computationally predicted and evaluated for immunogenicity and protection against porcine cysticercosis. A synthetic peptide was designed based on predicted linear B cell and T cell epitopes that are exposed on the surface of the theoretically modeled structure of TSOL18. Three surface epitopes from TSOL18 were predicted as immunogenic. A peptide comprising a linear arrangement of these epitopes was chemically synthesized. The capacity of the synthetic peptide to protect pigs against an oral challenge with Taenia solium proglottids was tested in a vaccine trial. The synthetic peptide was able to produce IgG antibodies in pigs and was associated to a reduction of the number of cysts, although was not able to provide complete protection, defined as the complete absence of cysts in necropsy. This study demonstrated that B cell and T cell predicted epitopes from TSOL18 were not able to completely protect pigs against an oral challenge with Taenia solium proglottids. Therefore, other linear epitopes or eventually conformational epitopes may be responsible for the protection conferred by TSOL18.

Mirko Zimic; Andres Hazaet Gutierrez; Robert Hugh Gilman; Cesar Lopez; Miguel Quiliano; Wilfredo Evangelista; Armando Gonzales; Hector Hugo Garcia; Patricia Sheen

2011-01-01

38

The effect of gamma radiation on the cysticeri of Taenia Solium  

International Nuclear Information System (INIS)

[en] Cysticerci of Taenia solium were exposed to gamma radiation in doses varying from 20-140 krad. Radiation had an adverse effect on the ability of the cysticerci to evaginate in vitro after a time lag of 9 days. This effect was most marked at doses of 100 krad and higher, thus no cysticerci exposed to 140, 120 and 100 krad evaginated after 12, 18 and 21 days, respectively. On Day +24, when 60% of the control cysticerci evaginated, 55%, 50%, 30% and 40% of the cysticerci exposed to 20, 40, 60, and 80 krad, respectively, evaginated in vitro. Cysticerci exposed to radiation doses of 20-120 krad are as infective to golden hamsters as are unirradiated cysticerci. Cestodes resulting from irradiated cysticerci, however, cannot maintain themselves indefinitely, and are excreted or digested at varying times from Day + 12 onwards. Moreover, cestodes resulting from such irradiated cysticerci do not grow, but are resorbed, and finally consist of only a scolex. By Day + 30 the mean length of the worms resulting from the cysticerci exposed to 20 and 40 krad consist of scolices only and the hamsters fed material exposed to 60 krad were negative. It appears, therefore, that radiation inhibits the ability of the cells in the neck region to divide and thus form new proglottids. Carcasses infested with cysticercosis can possibly be rendered fit for human consumption by exposure to gamma radiation at doses between 20 and 60 krad

1976-01-01

39

Steroid hormone production by parasites: the case of Taenia crassiceps and Taenia solium cysticerci.  

Science.gov (United States)

Many examples of reciprocal endocrine interactions between parasites and hosts have been found in insects, arthropods and mammals. Cysticercosis produced by Taenia solium metacestodes is a widely distributed parasite infection that affects the human and the pig. Taenia crassiceps experimental murine cysticercosis has been used to explore the role of biological factors involved in host-parasite interactions. We had shown that T. crassiceps cysticercosis affects the serum concentration of steroid hormones and the reproduction behavior of the male mice host. In an effort to understand the biology of the parasite, we had investigated the parasite capacity to produce sex steroids. For this purpose, T. crassiceps cysticerci were incubated in the presence of different steroid precursors. TLC and recrystallization procedures showed that testosterone is produced from 3H-androstenedione in cysticerci. The conversion of 3H-testosterone to androstenedione, although present is much less significant. In addition, we had studied the production of testosterone by T. solium cysticerci. For this purpose, cysticerci were dissected from pork meat and incubated as above described. The results showed that T. solium cysticerci also produce testosterone. We have speculated about the importance of androgens in the growth of T. crassiceps cysticerci and found that the addition of the antiandrogen flutamide to the culture media of the parasites significantly decreased 3H-thymidine incorporation. We therefore hypothesized, that the ability of cysticerci to produce testosterone from steroid precursors might be important for the parasite growth and development. PMID:12943707

Romano, M C; Valdéz, R A; Cartas, A L; Gómez, Y; Larralde, C

2003-06-01

40

Steroid hormone production by parasites: the case of Taenia crassiceps and Taenia solium cysticerci.  

UK PubMed Central (United Kingdom)

Many examples of reciprocal endocrine interactions between parasites and hosts have been found in insects, arthropods and mammals. Cysticercosis produced by Taenia solium metacestodes is a widely distributed parasite infection that affects the human and the pig. Taenia crassiceps experimental murine cysticercosis has been used to explore the role of biological factors involved in host-parasite interactions. We had shown that T. crassiceps cysticercosis affects the serum concentration of steroid hormones and the reproduction behavior of the male mice host. In an effort to understand the biology of the parasite, we had investigated the parasite capacity to produce sex steroids. For this purpose, T. crassiceps cysticerci were incubated in the presence of different steroid precursors. TLC and recrystallization procedures showed that testosterone is produced from 3H-androstenedione in cysticerci. The conversion of 3H-testosterone to androstenedione, although present is much less significant. In addition, we had studied the production of testosterone by T. solium cysticerci. For this purpose, cysticerci were dissected from pork meat and incubated as above described. The results showed that T. solium cysticerci also produce testosterone. We have speculated about the importance of androgens in the growth of T. crassiceps cysticerci and found that the addition of the antiandrogen flutamide to the culture media of the parasites significantly decreased 3H-thymidine incorporation. We therefore hypothesized, that the ability of cysticerci to produce testosterone from steroid precursors might be important for the parasite growth and development.

Romano MC; Valdéz RA; Cartas AL; Gómez Y; Larralde C

2003-06-01

 
 
 
 
41

Taenia solium Oncosphere Adhesion to Intestinal Epithelial and Chinese Hamster Ovary Cells In Vitro?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The specific mechanisms underlying Taenia solium oncosphere adherence and penetration in the host have not been studied previously. We developed an in vitro adhesion model assay to evaluate the mechanisms of T. solium oncosphere adherence to the host cells. The following substrates were used: porcin...

Verastegui, Manuela; Gilman, Robert H.; Arana, Yanina; Barber, Dylan; Velásquez, Jeanette; Farfán, Marilu; Chile, Nancy

42

Regional status, epidemiology and impact of Taenia solium cysticercosis in Western and Central Africa  

Digital Repository Infrastructure Vision for European Research (DRIVER)

In West Africa, Taenia solium cysticercosis in both pigs and man has been reported in Benin, Burkina-Faso, Ghana, Ivory Coast, Senegal and Togo, and although official data are lacking, T. solium is anticipated to be present in most of the pig-raising regions of other West African countries as well. ...

Zoli, A.; Shey-Njila, O.; Assana, E.; Nguekam, J. P.; Dorny, P.; Brandt, J.; Geerts, S.

43

The 10 kDa protein of Taenia solium metacestodes shows genus specific antigenicity  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Genus specific antigenicity of the 10 kDa protein in cyst fluid (CF) of Taenia solium metacestodes was demonstrated by comparative immunoblot analysis. When CFs from taeniid metacestodes of T. saginata, T. solium, T. taeniaeformis and T. crassiceps were probed with specific monoclonal antibody (mAb)...

Park, Seung-Kyu; Yun, Doo-Hee; Chung, Joon-Yong; Kong, Yoon; Cho, Seung-Yull

44

PCR test for detecting Taenia solium cysticercosis in pig carcasses.  

UK PubMed Central (United Kingdom)

Polymerase chain reaction (PCR) test was employed to detect Taenia solium DNA in muscle lesions for validation of the meat inspection results of slaughtered pigs. Two sets of oligonucleotide primers, one targeted against the large subunit rRNA gene (TBR primers) and the other targeted against cytochrome c oxidase subunit 1 gene (Cox1 primers) of T. solium were used in this study. On reactivity in PCR test, the TBR primers and the Cox1 primers yielded products of 286 and 984 bp, respectively, in cysticercosis positive cases. Both the sets of primers were found to be highly specific, since they did not yield any PCR product in negative controls. A total of 225 pig carcasses were screened for cysticercosis by meat inspection, out of which 25 carcasses with visible cysts (16 viable and 9 degenerated cysts) were also confirmed to be positive for cysticercosis in PCR test. However, out of the 35 carcasses with suspected lesions on meat inspection, only two were found to be positive for cysticercosis in PCR test. The detection limits for both the primer sets were analyzed. The TBR primer set could detect up to 10 pg of cysticercus DNA, whereas the Cox1 primer set could detect only up to 1 ng. It is evident from the study that PCR test is an efficient tool for validation of meat inspection results and also to rule out ambiguity in carcass judgment of suspected cases of porcine cysticercosis.

Sreedevi C; Hafeez M; Kumar PA; Rayulu VC; Subramanyam KV; Sudhakar K

2012-01-01

45

Genetic Vaccination against Murine Cysticercosis by Using a Plasmid Vector Carrying Taenia solium Paramyosin  

Digital Repository Infrastructure Vision for European Research (DRIVER)

A plasmid vector carrying the immunoprotective amino-terminal fragment of Taenia solium paramyosin (VW2-1) was designed for genetic vaccination studies. Mice that were genetically immunized with VW2-1 and challenged by intraperitoneal inoculation of Taenia crassiceps cysticerci showed 43 to 48% redu...

Solís, Carlos F.; Ostoa-Saloma, Pedro; Lugo-Martínez, Verónica H.; Johnston, Stephen Albert; Laclette, Juan Pedro

46

Isolation and characterization of species-specific DNA probes from Taenia solium and Taenia saginata and their use in an egg detection assay.  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis results from ingestion of the eggs of the tapeworm Taenia solium. Reduction of the incidence of human and swine cysticercosis requires identification and treatment of individuals who carry the adult tapeworm. T. solium and Taenia saginata eggs cannot be differentiated on the basis of m...

Chapman, A; Vallejo, V; Mossie, K G; Ortiz, D; Agabian, N; Flisser, A

47

Crystal Structure of Cu/Zn Superoxide Dismutase from Taenia Solium Reveals Metal-mediated Self-assembly  

Energy Technology Data Exchange (ETDEWEB)

Taenia solium is the cestode responsible for porcine and human cysticercosis. The ability of this parasite to establish itself in the host is related to its evasion of the immune response and its antioxidant defence system. The latter includes enzymes such as cytosolic Cu/Zn superoxide dismutase. In this article, we describe the crystal structure of a recombinant T. solium Cu/Zn superoxide dismutase, representing the first structure of a protein from this organism. This enzyme shows a different charge distribution at the entrance of the active channel when compared with human Cu/Zn superoxide dismutase, giving it interesting properties that may allow the design of specific inhibitors against this cestode. The overall topology is similar to other superoxide dismutase structures; however, there are several His and Glu residues on the surface of the protein that coordinate metal ions both intra- and intermolecularly. Interestingly, one of these ions, located on the {beta}2 strand, establishes a metal-mediated intermolecular {beta}-{beta} interaction, including a symmetry-related molecule. The factors responsible for the abnormal protein-protein interactions that lead to oligomerization are still unknown; however, high metal levels have been implicated in these phenomena, but exactly how they are involved remains unclear. The present results suggest that this structure could be useful as a model to explain an alternative mechanism of protein aggregation commonly observed in insoluble fibrillar deposits.

A Hernandez-Santoyo; A Landa; E Gonzalez-Mondragon; M Pedraza-Escalona; R Parra-Unda; A Rodriguez-Romero

2011-12-31

48

Crystal structure of Cu?/?Zn superoxide dismutase from Taenia solium reveals metal-mediated self-assembly.  

UK PubMed Central (United Kingdom)

Taenia solium is the cestode responsible for porcine and human cysticercosis. The ability of this parasite to establish itself in the host is related to its evasion of the immune response and its antioxidant defence system. The latter includes enzymes such as cytosolic Cu/Zn superoxide dismutase. In this article, we describe the crystal structure of a recombinant T. solium Cu/Zn superoxide dismutase, representing the first structure of a protein from this organism. This enzyme shows a different charge distribution at the entrance of the active channel when compared with human Cu/Zn superoxide dismutase, giving it interesting properties that may allow the design of specific inhibitors against this cestode. The overall topology is similar to other superoxide dismutase structures; however, there are several His and Glu residues on the surface of the protein that coordinate metal ions both intra- and intermolecularly. Interestingly, one of these ions, located on the ?2 strand, establishes a metal-mediated intermolecular ?-? interaction, including a symmetry-related molecule. The factors responsible for the abnormal protein-protein interactions that lead to oligomerization are still unknown; however, high metal levels have been implicated in these phenomena, but exactly how they are involved remains unclear. The present results suggest that this structure could be useful as a model to explain an alternative mechanism of protein aggregation commonly observed in insoluble fibrillar deposits.

Hernández-Santoyo A; Landa A; González-Mondragón E; Pedraza-Escalona M; Parra-Unda R; Rodríguez-Romero A

2011-09-01

49

Simulating transmission and control of Taenia solium infections using a reed-frost stochastic model  

DEFF Research Database (Denmark)

The transmission dynamics of the human-pig zoonotic cestode Taenia solium are explored with both deterministic and stochastic versions of a modified Reed-Frost model. This model, originally developed for microparasitic infections (i.e. bacteria, viruses and protozoa), assumes that random contacts occur between hosts and that hosts can be either susceptible, infected or ‘recovered and presumed immune'. Transmission between humans and pigs is modelled as susceptible roaming pigs scavenging on human faeces infected with T. solium eggs. Transmission from pigs to humans is modelled as susceptible humans eating under-cooked pork meat harbouring T. solium metacestodes. Deterministic models of each scenario were first run, followed by stochastic versions of the models to assess the likelihood of infection elimination in the small population modelled. The effects of three groups of interventions were investigated using the model: (i) interventions affecting the transmission parameters such as use of latrines, meat inspection, and cooking habits; (ii) routine interventions including rapid detection and treatment of human carriers or pig vaccination; and (iii) treatment interventions of either humans or pigs. It is concluded that mass-treatment can result in a short term dramatic reduction in prevalence, whereas interventions targeting interruption of the life cycle lead to long-term reduction in prevalence.

Kyvsgaard, Niels Chr.; Johansen, Maria Vang

2007-01-01

50

The hamster model for identification of specific antigens of Taenia solium tapeworms.  

UK PubMed Central (United Kingdom)

Humans acquire taeniasis by ingesting pork meat infected with Taenia solium cysticerci, which are the only definitive hosts of the adult stage (tapeworm) and responsible for transmitting the human and porcine cysticercosis. Hence, detection of human tapeworm carriers is a key element in the development of viable strategies to control the disease. This paper presents the identification of specific antigens using sera from hamsters infected with T. solium tapeworms analyzed by western blot assay with crude extracts (CEs) and excretion-secretion antigens (E/S Ag) obtained from T. solium cysticerci and tapeworms and extracts from other helminthes as controls. The hamster sera infected with T. solium tapeworms recognized specific bands of 72, 48, 36, and 24? kDa, in percentages of 81, 81, 90, and 88%, respectively, using the T. solium tapeworms E/S Ag. The antigens recognized by these hamster sera could be candidates to improve diagnosis of human T. solium taeniasis.

Ochoa-Sánchez A; Jiménez L; Landa A

2011-01-01

51

Development of the S3Pvac Vaccine Against Porcine Taenia solium Cysticercosis: A Historical Review.  

UK PubMed Central (United Kingdom)

Abstract :? Herein we present a review of our research dealing with vaccination against experimental and naturally acquired porcine Taenia solium cysticercosis using Taenia crassiceps-derived antigens. Results strongly support that the different versions of S3Pvac vaccine are indeed effective against porcine T. solium cysticercosis. Immunological results related to vaccination prove that protection is at least partially mediated by specific immunity. The data also support the validity of T. crassiceps murine cysticercosis as an effective tool to identify vaccine candidates against some metacestode infections.

Sciutto E; Fragoso G; Hernández M; Rosas G; Martínez JJ; Fleury A; Cervantes J; Aluja A; Larralde C

2013-08-01

52

Development of the S3Pvac vaccine against porcine Taenia solium cysticercosis: a historical review.  

Science.gov (United States)

Herein we present a review of our research dealing with vaccination against experimental and naturally acquired porcine Taenia solium cysticercosis using Taenia crassiceps-derived antigens. Results strongly support that the different versions of S3Pvac vaccine are indeed effective against porcine T. solium cysticercosis. Immunological results related to vaccination prove that protection is at least partially mediated by specific immunity. The data also support the validity of T. crassiceps murine cysticercosis as an effective tool to identify vaccine candidates against some metacestode infections. PMID:23445359

Sciutto, Edda; Fragoso, Gladis; Hernández, Marisela; Rosas, Gabriela; Martínez, José J; Fleury, Agnès; Cervantes, Jacquelynne; Aluja, Aline; Larralde, Carlos

2013-02-27

53

The diagnostic importance of species specific and cross-reactive components of Taenia solium, Echinococcus granulosus, and Hymenolepis nana/ Importância diagnóstica da reação cruzada espécie-específica de componentes da Taenia solium, Echinococcus granulosus e Hymenolepis nana  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Soros de pacientes infectados com Taenia solium, Hymenolepis nana e Echinococcus granulosus foram testados contra antígenos parasitários homólogos e heterólogos usando o teste de ELISA e foi verificado alto grau de reatividade cruzada. Para identificar os polipetídeos responsáveis por esta reatividade cruzada foi utilizado o teste "Enzyme Linked Immunoelectro Transfer Blot (EITB)". Soros de pacientes infectados por T.solium, H.nana, e E.granulosus foram colocados em (more) contato com precipitado de sulfato de amônia e antígenos não purificados de T.solium e os de H.nana e E.granulosus. Várias bandas reconhecidas pelos soros de pacientes com infecção por T.solium, H.nana e E.granulosus foram comuns a dois ou três destes cestódeos. Uma única banda foi notada em H.nana a 49 e 66K-Da e no E.granulosus a 17-21 K-Da e 27-32 K-Da. No extrato não purificado de cisticercose uma banda específica não glicoproteica estava presente a 61-67 K-Da além das bandas de glicoproteínas específicas de 50, 42, 24, 21, 18, 14 e 13 K-Da. Nenhum destes soros de pacientes com infecção por H.nana ou E.granulosus reagiu de forma cruzada com estas sete bandas de glicoproteína consideradas específicas à infecção por T.solium Abstract in english Sera from patients infected with Taenia solium, Hymenolepis nana and Echinococcus granulosus were tested against homologous and heterologous parasite antigens using an ELISA assay, and a high degree of cross-reactivity was verified. To identify polypeptides responsible for this cross reactivity, the Enzyme Linked Immunoelectro Transfer Blot (EITB) was used. Sera from infected patients with T.solium, H.nana, and E.granulosus were assessed against crude, ammonium sulphate p (more) recipitated (TSASP), and lentil-lectin purified antigens of T.solium and crude antigens of.H.nana and E.granulosus. Several bands, recognized by sera from patients with T.solium, H.nana, and E.granulosus infections, were common to either two or all three cestodes. Unique reactive bands in H.nana were noted at 49 and 66 K-Da and in E.granulosus at 17-21 K-Da and at 27-32 K-Da. In the crude cysticercosis extract, a specific non glycoprotein band was present at 61-67 K-Da in addiction to specific glycoprotein bands of 50, 42, 24, 21, 18, 14, and 13 K-Da. None of the sera from patients with H.nana or E.granulosus infection cross reacted with these seven glycoprotein bands considered specific for T.solium infection.

Montenegro, Teresa; Gilman, Robert H.; Castillo, Rosa; Tsang, Victor; Brandt, Joy; Guevara, Angela; Sanabria, Hernan; Verastegui, Manuela; Sterling, Charles; Miranda, Elba

1994-08-01

54

The diagnostic importance of species specific and cross-reactive components of Taenia solium, Echinococcus granulosus, and Hymenolepis nana Importância diagnóstica da reação cruzada espécie-específica de componentes da Taenia solium, Echinococcus granulosus e Hymenolepis nana  

Directory of Open Access Journals (Sweden)

Full Text Available Sera from patients infected with Taenia solium, Hymenolepis nana and Echinococcus granulosus were tested against homologous and heterologous parasite antigens using an ELISA assay, and a high degree of cross-reactivity was verified. To identify polypeptides responsible for this cross reactivity, the Enzyme Linked Immunoelectro Transfer Blot (EITB) was used. Sera from infected patients with T.solium, H.nana, and E.granulosus were assessed against crude, ammonium sulphate precipitated (TSASP), and lentil-lectin purified antigens of T.solium and crude antigens of.H.nana and E.granulosus. Several bands, recognized by sera from patients with T.solium, H.nana, and E.granulosus infections, were common to either two or all three cestodes. Unique reactive bands in H.nana were noted at 49 and 66 K-Da and in E.granulosus at 17-21 K-Da and at 27-32 K-Da. In the crude cysticercosis extract, a specific non glycoprotein band was present at 61-67 K-Da in addiction to specific glycoprotein bands of 50, 42, 24, 21, 18, 14, and 13 K-Da. None of the sera from patients with H.nana or E.granulosus infection cross reacted with these seven glycoprotein bands considered specific for T.solium infection.Soros de pacientes infectados com Taenia solium, Hymenolepis nana e Echinococcus granulosus foram testados contra antígenos parasitários homólogos e heterólogos usando o teste de ELISA e foi verificado alto grau de reatividade cruzada. Para identificar os polipetídeos responsáveis por esta reatividade cruzada foi utilizado o teste "Enzyme Linked Immunoelectro Transfer Blot (EITB)". Soros de pacientes infectados por T.solium, H.nana, e E.granulosus foram colocados em contato com precipitado de sulfato de amônia e antígenos não purificados de T.solium e os de H.nana e E.granulosus. Várias bandas reconhecidas pelos soros de pacientes com infecção por T.solium, H.nana e E.granulosus foram comuns a dois ou três destes cestódeos. Uma única banda foi notada em H.nana a 49 e 66K-Da e no E.granulosus a 17-21 K-Da e 27-32 K-Da. No extrato não purificado de cisticercose uma banda específica não glicoproteica estava presente a 61-67 K-Da além das bandas de glicoproteínas específicas de 50, 42, 24, 21, 18, 14 e 13 K-Da. Nenhum destes soros de pacientes com infecção por H.nana ou E.granulosus reagiu de forma cruzada com estas sete bandas de glicoproteína consideradas específicas à infecção por T.solium

Teresa Montenegro; Robert H. Gilman; Rosa Castillo; Victor Tsang; Joy Brandt; Angela Guevara; Hernan Sanabria; Manuela Verastegui; Charles Sterling; Elba Miranda

1994-01-01

55

Taenia solium infections in a rural area of eastern Zambia; a community based study  

Digital Repository Infrastructure Vision for European Research (DRIVER)

BACKGROUND: Taenia solium taeniosis/cysticercosis is a parasitic infection occurring in many developing countries. Data on the status of human infections in Zambia is largely lacking. We conducted a community-based study in Eastern Zambia to determine the prevalence of human taeniosis and cysticerco...

Mwape, K. E.; Phiri, I. K.; Praet, N.; Muma, J. B.; Zulu, G.; Van den Bossche, P.; De Deken, R.; Speybroeck, N.; Dorny, P.

56

The Hamster Model for Identification of Specific Antigens of Taenia solium Tapeworms  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Humans acquire taeniasis by ingesting pork meat infected with Taenia solium cysticerci, which are the only definitive hosts of the adult stage (tapeworm) and responsible for transmitting the human and porcine cysticercosis. Hence, detection of human tapeworm carriers is a key element in the developm...

Ochoa-Sánchez, Alicia; Jiménez, Lucía; Landa, Abraham

57

Spatial Distribution of Taenia solium Porcine Cysticercosis within a Rural Area of Mexico  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis is caused by Taenia solium, a parasitic disease that affects humans and rurally bred pigs in developing countries. The cysticercus may localize in the central nervous system of the human, causing neurocysticercosis, the most severe and frequent form of the disease. There appears to be ...

Morales, Julio; Martínez, José Juan; Rosetti, Marcos; Fleury, Agnes; Maza, Victor; Hernandez, Marisela; Villalobos, Nelly

58

The Lar Gibbon as Definitive and Intermediate Host of Taenia Solium.  

Science.gov (United States)

Man is generally considered to be the only definitive host for Taenia solium. The host-parasite relationship for the bladderworm stage is not as specific and several intermediate hosts are known. By chance, it was found that the white-handed gibbon (Hylob...

F. C. Cadigan J. S. Stanton P. Tanticharoenyos V. Chaicumpa

1967-01-01

59

Serological Diagnosis of Human Cysticercosis by Use of Recombinant Antigens from Taenia solium Cysticerci  

Digital Repository Infrastructure Vision for European Research (DRIVER)

A Taenia solium metacestode cDNA expression library in the lambda ZAPII vector was screened with pooled sera from patients with neurocysticercosis. Sixty primary clones were identified and shown to belong to two classes. The clones NC-3 and NC-9 did not reveal any significant homologies to seque...

Hubert, Kerstin; Andriantsimahavandy, Abel; Michault, Alain; Frosch, Matthias; Mühlschlegel, Fritz A.

60

A seroepidemiological survey of Taenia solium cysticercosis in Nabo, Guangxi Zhuang Autonomous Region, China  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We have observed the seropositive rate of Taenia solium cysticercosis in residents at Nabo Village, Tiandong County, Guangxi Zhuang Autonomous Region, China by enzyme linked immunosorbent assay. The village had been found to be a relatively high endemic area of porcine cysticercosis among roaming pi...

Chung, Joon-Yong; Eom, Keeseon S.; Yang, Yichao; Li, Xenming; Feng, Zheng; Rim, Han-Jong; Cho, Seung-Yull; Kong, Yoon

 
 
 
 
61

Infection with versus exposure to Taenia solium: what do serological test results tell us?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is an endemic zoonosis in many developing countries. Serological tests are the most appropriate diagnostic tools to understand the transmission dynamics of the parasite, but the performances of these methods in such a setting are not known. A south Ecuadorian human popula...

Praet, Nicolas; Rodriguez-Hidalgo, Richar; Speybroeck, Niko; Ahounou, Serge; Benitez-Ortiz, Washington; Berkvens, Dirk

62

Immunolocalization of the 150 kDa protein in cyst fluid of Taenia solium metacestodes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The 150 kDa protein of cyst fluid (CF) of Taenia solium metacestodes was purified by ammonium sulfate fractionation and Superose 6 HR gel filtration chromatography. The purified protein consisted of three subunits (15, 10 and 7 kDa proteins), which were analyzed with the use of a 7.5-15% gradient so...

Yang, Hyun-Jong; Chung, Young-Bae

63

Infection with versus Exposure to Taenia solium: What Do Serological Test Results Tell Us?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is an endemic zoonosis in many developing countries. Serological tests are the most appropriate diagnostic tools to understand the transmission dynamics of the parasite, but the performances of these methods in such a setting are not known. A south Ecuadorian human popula...

Praet, Nicolas; Rodriguez-Hidalgo, Richar; Speybroeck, Niko; Ahounou, Serge; Benitez-Ortiz, Washington; Berkvens, Dirk

64

Protection against Asiatic Taenia solium Induced by a Recombinant 45W-4B Protein?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium is a great threat not only to human health but also to the pig-raising industry. Oncospheral stage-specific 45W proteins are good candidates for the development of anticysticercosis vaccines. In this study, a recombinant 45W-4B protein was highly produced and used for vaccination. Two ...

Luo, Xuenong; Zheng, Yadong; Hou, Junling; Zhang, Shaohua; Cai, Xuepeng

65

Molecular Characterization and Diagnostic Value of Taenia solium Low-Molecular-Weight Antigen Genes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Neurocysticercosis (NCC) caused by infection with the larvae of Taenia solium is an important cause of neurological disease worldwide. In order to establish an enzyme-linked immunosorbent assay (ELISA) for this infection using recombinant proteins, we carried out molecular cloning and identified fou...

Sako, Yasuhito; Nakao, Minoru; Ikejima, Takashi; Piao, Xian Zhi; Nakaya, Kazuhiro; Ito, Akira

66

Kinetics of circulating antigens in pigs experimentally infected with Taenia solium eggs  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Three groups of four piglets were experimentally infected with different doses (10(3), 10(4) and 10(5)) of Taenia solium eggs whereas a fourth group of two pigs received gravid proglottids. At autopsy 6 months post infection, the two latter pigs were heavily infected with more than 3000 living cysts...

Nguekam, A.; Zoli, A. P.; Vondou, L.; Pouedet, S. M. R.; Assana, E.; Dorny, P.; Brandt, J.; Losson, B.; Geerts, S.

67

Partial characterization of a 29 kDa cysteine protease purified from Taenia solium metacestodes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

A 29 kDa cysteine protease of Taenia solium metacestodes was purified by Mono Q anion-exchanger and Superose 6 HR gel filtration chromatography. The enzyme was effectively inhibited by cysteine protease inhibitors, such as iodoacetic acid (IAA) and trans-epoxy-succinyl-L-leucyl-amido (4-guanidino) b...

Kim, Ji-Young; Yang, Hyun-Jong; Kim, Kwang-Sig; Chung, Young-Bae

68

Taenia solium Cysticercosis Hotspots Surrounding Tapeworm Carriers: Clustering on Human Seroprevalence but Not on Seizures  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis is a parasitic disease caused by the tapeworm Taenia solium, common in areas with limited sanitation or with migration from these populations. The adult parasite is hosted in the human intestine and releases large numbers of eggs with the feces. Human beings sometimes ingest eggs due t...

Lescano, Andres G.; Garcia, Hector H.; Gilman, Robert H.; Gavidia, Cesar M.; Tsang, Victor C. W.; Rodriguez, Silvia

69

Use of expressed sequence tags as an alternative approach for the identification of Taenia solium metacestode excretion/secretion proteins.  

UK PubMed Central (United Kingdom)

BACKGROUND: Taenia solium taeniasis/cysticercosis is a zoonotic helminth infection mainly found in rural regions of Africa, Asia and Latin America. In endemic areas, diagnosis of cysticercosis largely depends on serology, but these methods have their drawbacks and require improvement. This implies better knowledge of the proteins secreted and excreted by the parasite. In a previous study, we used a custom protein database containing protein sequences from related helminths to identify T. solium metacestode excretion/secretion proteins. An alternative or complementary approach would be to use expressed sequence tags combined with BLAST and protein mapping to supercontigs of Echinococcus granulosus, a closely related cestode. In this study, we evaluate this approach and compare the results to those obtained in the previous study. FINDINGS: We report 297 proteins organized in 106 protein groups based on homology. Additional classification was done using Gene Ontology information on biological process and molecular function. Of the 106 protein groups, 58 groups were newly identified, while 48 groups confirmed previous findings. Blast2GO analysis revealed that the majority of the proteins were involved in catalytic activities and binding. CONCLUSIONS: In this study, we used translated expressed sequence tags combined with BLAST and mapping strategies to both confirm and complement previous research. Our findings are comparable to recent studies on other helminth genera like Echinococcus, Schistosoma and Clonorchis, indicating similarities between helminth excretion/secretion proteomes.

Victor B; Dorny P; Kanobana K; Polman K; Lindh J; Deelder AM; Palmblad M; Gabriël S

2013-01-01

70

Tamoxifen treatment in hamsters induces protection during taeniosis by Taenia solium.  

UK PubMed Central (United Kingdom)

Human neurocysticercosis by Taenia solium is considered an emergent severe brain disorder in developing and developed countries. Discovery of new antiparasitic drugs has been recently aimed to restrain differentiation and establishment of the T. solium adult tapeworm, for being considered a central node in the disease propagation to both pigs and humans. Tamoxifen is an antiestrogenic drug with cysticidal action on Taenia crassiceps, a close relative of T. solium. Thus, we evaluated the effect of tamoxifen on the in vitro evagination and the in vivo establishment of T. solium. In vitro, tamoxifen inhibited evagination of T. solium cysticerci in a dose-time dependent manner. In vivo, administration of tamoxifen to hamsters decreased the intestinal establishment of the parasite by 70%, while recovered tapeworms showed an 80% reduction in length, appearing as scolices without strobilar development. Since tamoxifen did not show any significant effect on the proliferation of antigen-specific immune cells, intestinal inflammation, and expression of Th1/Th2 cytokines in spleen and duodenum, this drug could exert its antiparasite actions by having direct detrimental effects upon the adult tapeworm. These results demonstrate that tamoxifen exhibits a strong cysticidal and antitaeniasic effect on T. solium that should be further explored in humans and livestock.

Escobedo G; Palacios-Arreola MI; Olivos A; López-Griego L; Morales-Montor J

2013-01-01

71

Tamoxifen treatment in hamsters induces protection during taeniosis by Taenia solium.  

Science.gov (United States)

Human neurocysticercosis by Taenia solium is considered an emergent severe brain disorder in developing and developed countries. Discovery of new antiparasitic drugs has been recently aimed to restrain differentiation and establishment of the T. solium adult tapeworm, for being considered a central node in the disease propagation to both pigs and humans. Tamoxifen is an antiestrogenic drug with cysticidal action on Taenia crassiceps, a close relative of T. solium. Thus, we evaluated the effect of tamoxifen on the in vitro evagination and the in vivo establishment of T. solium. In vitro, tamoxifen inhibited evagination of T. solium cysticerci in a dose-time dependent manner. In vivo, administration of tamoxifen to hamsters decreased the intestinal establishment of the parasite by 70%, while recovered tapeworms showed an 80% reduction in length, appearing as scolices without strobilar development. Since tamoxifen did not show any significant effect on the proliferation of antigen-specific immune cells, intestinal inflammation, and expression of Th1/Th2 cytokines in spleen and duodenum, this drug could exert its antiparasite actions by having direct detrimental effects upon the adult tapeworm. These results demonstrate that tamoxifen exhibits a strong cysticidal and antitaeniasic effect on T. solium that should be further explored in humans and livestock. PMID:23509701

Escobedo, Galileo; Palacios-Arreola, M Isabel; Olivos, Alfonso; López-Griego, Lorena; Morales-Montor, Jorge

2012-12-20

72

Protection of pigs against Taenia solium cysticercosis by immunization with novel recombinant antigens.  

UK PubMed Central (United Kingdom)

Recombinant antigens from the oncosphere stage of the parasite Taenia solium were expressed in Escherichia coli. The TSOL16, TSOL45-1A and TSOL45-1B recombinant antigens, each consisting of fibronectin type III (FnIII) domain S, were produced as fusion proteins with glutathione S-transferase (GST) and maltose binding protein (MBP). Groups of pigs were immunized twice with the GST fusions of the antigens and boosted a third time with the MBP fusions prior to receiving a challenge infection with T. solium eggs. The TSOL16 antigen was found to be capable of inducing high levels of immunity in pigs against a challenge infection with T. solium. Immunological investigations identified differences in immune responses in the pigs vaccinated with the various antigens. The results demonstrate that the TSOL16 antigen could be a valuable adjunct to current porcine vaccination approaches and may allow the further development of new vaccination strategies against T. solium cysticercosis.

Gauci CG; Jayashi CM; Gonzalez AE; Lackenby J; Lightowlers MW

2012-06-01

73

Sensitive In Vitro System To Assess Morphological and Biochemical Effects of Praziquantel and Albendazole on Taenia solium Cysts ? †  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Neurocysticercosis resulting from Taenia solium infections is a major cause of adult-acquired seizures worldwide. Disease is caused by larval cysts, and treatment consists of the anthelmintic drugs albendazole or praziquantel. There are no standard methods to assess drug activity to T. solium cysts ...

Mahanty, S.; Paredes, A.; Marzal, M.; Gonzalez, E.; Rodriguez, S.; Dorny, P.; Guerra-Giraldez, C.; Garcia, H. H.; Nash, T.

74

Taenia solium cysticercosis in the Democratic Republic of Congo : how does pork trade affect the transmission of the parasite?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Background: Taenia solium, a zoonotic parasite that is endemic in most developing countries where pork is consumed, is recognised as the main cause of acquired epilepsy in these regions. T. solium has been reported in almost all of the neighboring countries of Democratic Republic of Congo (DRC) but ...

Praet, Nicolas; Kanobana, Kirezi; Kabwe, Constantin; Maketa, Vivi; Lukanu, Philippe; Lutumba, Pascal; Polman, Katja

75

Taenia solium cysticercosis in the Democratic Republic of Congo: how does pork trade affect the transmission of the parasite?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

BACKGROUND: Taenia solium, a zoonotic parasite that is endemic in most developing countries where pork is consumed, is recognised as the main cause of acquired epilepsy in these regions. T. solium has been reported in almost all of the neighboring countries of Democratic Republic of Congo (DRC) but ...

Praet, N.; Kanobana, K.; Kabwe, C.; Maketa, V.; Lukanu, P.; Lutumba, P.; Polman, K.; Matondo, P.; Speybroeck, N.; Dorny, P.

76

Diferenciação específica entre Taenia saginata e Taenia solium por ensaio de PCR e duplex-PCR/ Specific discrimination between Taenia saginata and Taenia solium by one step PCR assay and duplex-PCR  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Este estudo teve como objetivo a padronização de protocolos e a seleção de novos primers para a identificação espécie-específica de Taenia saginata e Taenia solium através da reação em cadeia da polimerase (PCR) e duplex-PCR. Inicialmente, foram recuperadas seqüências depositadas no GenBank (acesso n° AB020399 para T. saginata e n° AB020395 para T. solium) referentes ao gene da subunidade maior do ribossomo (LSU RNAr) de tenídeos. A partir do alinham (more) ento das seqüências, um primer genérico denominado TBR-3 (5'-ggcttgtttgaatggtttgacg- 3') foi selecionado de região conservada e, de diferentes regiões semi-conservadas, os primers específicos TBR-4 para T. saginata (5'-cgactcatgaagataaacaaggt-3') e TBR-5 (5'-cggtcgaacagaccataaatct-3') e TBR-6 (5'-gctactacacctaaattctaacc- 3') para T. solium. Os primers foram avaliados quanto à especificidade através da PCR empregando-se DNA total (DNAt) de amostras de cisticercos e proglotes dos parasitos, previamente identificadas por critérios morfológicos. O par de primers TBR-3/TBR-4 permitiu a amplificação específica do fragmento esperado de 328 pb a partir do DNAt de T. saginata. Os pares TBR-3/TBR-5 e TBR-3/TBR-6 permitiram a amplificação, respectivamente, dos fragmentos específicos de 310pb e 286pb a partir do DNAt de T. solium. A identidade dos produtos de PCR foi comprovada comparando-se a seqüência dos amplicons obtidos às seqüências de referência do gene LSU RNAr registrado no GenBank (n° AB020399 e n° AB020395). As reações apresentaram sensibilidade para detecção de até 1fg do DNAt de T. solium e 0,2fg do DNAt de T. saginata. A combinação dos primers TBR-3/TBR-4 e TBR3/TBR-6 e o tamanho dos fragmentos gênicos obtidos permitiram o estabelecimento de ensaios de duplex-PCR, eficaz na detecção simultânea do DNA de T. saginata e T. solium em sistema único de reação. Os primers utilizados não geraram qualquer produto de amplificação cruzada quando testados com DNAt de Taenia hydatigena, Taenia taeniaeformis, Hymenolepis diminuta, Anoplocephala magna, Paranoplocephala mamillana e Moniezia expansa, nem frente ao DNAt dos hospedeiros Homo sapiens, Bos taurus e Sus scrofa. Abstract in english This study was conducted to evaluate a protocol and to select novel primers for the species-specific identification of Taenia saginata and Taenia solium by PCR and duplex-PCR assays. Sequences of the LSU rRNA gene of taenids were obtained from the GenBank (T. saginata access n° AB020399 and T. solium access n° AB020395). The sequences were aligned and then used for primer design. The generic primer TBR3 (5'-ggcttgtttgaatggtttgacg- 3') was selected from a conserved (more) region. The T. saginata specific primer TBR-4 (5'-cgactcatgaagataaacaaggt-3') as well as T. solium specific primers TBR-5 (5'-cggtcgaacagaccataaatct-3') and TBR-6 (5'-gctactacacctaaattctaacc- 3') were selected from different semi-conserved regions. The selected sequences were examined in for similarities with other organisms through the GenBank Blast procedure and experimentally by PCR using total DNA (tDNA) extracted from cysticerci and proglottids from both parasites. The primer pair TBR-3/TBR-4 amplified specific fragments of 328 bp from T. saginata tDNA. The pairs TBR-3/TBR5 and TBR-3/TBR-6 amplified, respectively, the expected and specific fragments of 310bp and 286bp from the T. solium tDNA. Sequencing of the amplicons followed by comparison to GenBank reference sequences confirmed the identities of the PCR products. The detection sensitivity was equivalent to 1fg of T. solium tDNA and 0,2fg of T. saginata tDNA. The combination of primers TBR-3/TBR-4 and TBR3/TBR-6 and the size of amplicons allowed the establishment of a duplex-PCR assay to detect T. saginata and T. solium DNA. No cross reaction was observed with any combination of primers in reactions with tDNA of the parasites Taenia hydatigena, Taenia taeniaeformis, Hymenolepis diminuta, Anoplocephala magna, Paranoplocephala mamillana and Moniezia exp

Jardim, Eurione Antônio Garcia da Veiga; Linhares, Guido Fontgalland Coelho; Torres, Fernando Araripe Gonçalves; Araújo, José Luiz de Barros; Barbosa, Silvia Minharro

2006-02-01

77

Diferenciação específica entre Taenia saginata e Taenia solium por ensaio de PCR e duplex-PCR Specific discrimination between Taenia saginata and Taenia solium by one step PCR assay and duplex-PCR  

Directory of Open Access Journals (Sweden)

Full Text Available Este estudo teve como objetivo a padronização de protocolos e a seleção de novos primers para a identificação espécie-específica de Taenia saginata e Taenia solium através da reação em cadeia da polimerase (PCR) e duplex-PCR. Inicialmente, foram recuperadas seqüências depositadas no GenBank (acesso n° AB020399 para T. saginata e n° AB020395 para T. solium) referentes ao gene da subunidade maior do ribossomo (LSU RNAr) de tenídeos. A partir do alinhamento das seqüências, um primer genérico denominado TBR-3 (5'-ggcttgtttgaatggtttgacg- 3') foi selecionado de região conservada e, de diferentes regiões semi-conservadas, os primers específicos TBR-4 para T. saginata (5'-cgactcatgaagataaacaaggt-3') e TBR-5 (5'-cggtcgaacagaccataaatct-3') e TBR-6 (5'-gctactacacctaaattctaacc- 3') para T. solium. Os primers foram avaliados quanto à especificidade através da PCR empregando-se DNA total (DNAt) de amostras de cisticercos e proglotes dos parasitos, previamente identificadas por critérios morfológicos. O par de primers TBR-3/TBR-4 permitiu a amplificação específica do fragmento esperado de 328 pb a partir do DNAt de T. saginata. Os pares TBR-3/TBR-5 e TBR-3/TBR-6 permitiram a amplificação, respectivamente, dos fragmentos específicos de 310pb e 286pb a partir do DNAt de T. solium. A identidade dos produtos de PCR foi comprovada comparando-se a seqüência dos amplicons obtidos às seqüências de referência do gene LSU RNAr registrado no GenBank (n° AB020399 e n° AB020395). As reações apresentaram sensibilidade para detecção de até 1fg do DNAt de T. solium e 0,2fg do DNAt de T. saginata. A combinação dos primers TBR-3/TBR-4 e TBR3/TBR-6 e o tamanho dos fragmentos gênicos obtidos permitiram o estabelecimento de ensaios de duplex-PCR, eficaz na detecção simultânea do DNA de T. saginata e T. solium em sistema único de reação. Os primers utilizados não geraram qualquer produto de amplificação cruzada quando testados com DNAt de Taenia hydatigena, Taenia taeniaeformis, Hymenolepis diminuta, Anoplocephala magna, Paranoplocephala mamillana e Moniezia expansa, nem frente ao DNAt dos hospedeiros Homo sapiens, Bos taurus e Sus scrofa.This study was conducted to evaluate a protocol and to select novel primers for the species-specific identification of Taenia saginata and Taenia solium by PCR and duplex-PCR assays. Sequences of the LSU rRNA gene of taenids were obtained from the GenBank (T. saginata access n° AB020399 and T. solium access n° AB020395). The sequences were aligned and then used for primer design. The generic primer TBR3 (5'-ggcttgtttgaatggtttgacg- 3') was selected from a conserved region. The T. saginata specific primer TBR-4 (5'-cgactcatgaagataaacaaggt-3') as well as T. solium specific primers TBR-5 (5'-cggtcgaacagaccataaatct-3') and TBR-6 (5'-gctactacacctaaattctaacc- 3') were selected from different semi-conserved regions. The selected sequences were examined in for similarities with other organisms through the GenBank Blast procedure and experimentally by PCR using total DNA (tDNA) extracted from cysticerci and proglottids from both parasites. The primer pair TBR-3/TBR-4 amplified specific fragments of 328 bp from T. saginata tDNA. The pairs TBR-3/TBR5 and TBR-3/TBR-6 amplified, respectively, the expected and specific fragments of 310bp and 286bp from the T. solium tDNA. Sequencing of the amplicons followed by comparison to GenBank reference sequences confirmed the identities of the PCR products. The detection sensitivity was equivalent to 1fg of T. solium tDNA and 0,2fg of T. saginata tDNA. The combination of primers TBR-3/TBR-4 and TBR3/TBR-6 and the size of amplicons allowed the establishment of a duplex-PCR assay to detect T. saginata and T. solium DNA. No cross reaction was observed with any combination of primers in reactions with tDNA of the parasites Taenia hydatigena, Taenia taeniaeformis, Hymenolepis diminuta, Anoplocephala magna, Paranoplocephala mamillana and Moniezia expansa, nether from the hosts tDNA Homo sapiens, Bos taurus n

Eurione Antônio Garcia da Veiga Jardim; Guido Fontgalland Coelho Linhares; Fernando Araripe Gonçalves Torres; José Luiz de Barros Araújo; Silvia Minharro Barbosa

2006-01-01

78

Epidemiologic study and control of Taenia solium infections with praziquantel in a rural village of Mexico.  

Science.gov (United States)

This study reports the results of an epidemiologic survey for the detection of Taenia solium in a rural village of 559 inhabitants in Sinaloa, Mexico, as well as a large scale treatment of the population with praziquantel. The study was carried out in two stages. In stage 1, serial stool analysis of 392 persons detected a cluster of three T. solium tapeworms. A fourth T. solium tapeworm was detected through a household census, giving a 1.32% prevalence rate for this helminth. Over 70% of the population over five years of age was treated with a 10 mg/kg dose of praziquantel, and no additional tapeworms were found. Environmental studies for the detection of Taenia sp. eggs in soil, water, and and objects from the houses of tapeworm-infected individuals showed only one soil sample containing eggs compatible with Taenia sp. A total of 72 domestic pigs were examined for the presence of cysticerci under the tongue. One animal had cysts, and belonged to a household that had two T. solium tapeworm infections. Stage 2 of the study was carried out one year after large scale antihelminthic treatment (LSAT), and no infections with Taenia sp. eggs were found. No cysticercus-infected pigs were detected. Intestinal parasitosis decreased from 69.2% to 37.5%. It is concluded that LSAT with praziquantel is efficient in decreasing endemic foci of T. solium. Seropositivity to T. solium bladder fluid antigens was tested by enzyme-linked immunosorbent assay and found to be 11% before LSAT and 7% one year later. In family members living with T. solium tapeworm carriers, the number of seropositive individuals was 28%. The relative risk ratio of seropositivity for persons living in the same household with a T. solium tapeworm carrier was 2.95. Positive response was significantly higher in the 30-39-year-old age group, in which 30% were seropositive in stage 1, compared with 7% one year after LSAT. High seropositivity rates were significantly associated with tapeworm clusters as well as with individuals with a clinical history of seizures. PMID:1951862

Diaz Camacho, S P; Candil Ruiz, A; Suate Peraza, V; Zazueta Ramos, M L; Felix Medina, M; Lozano, R; Willms, K

1991-10-01

79

Epidemiologic study and control of Taenia solium infections with praziquantel in a rural village of Mexico.  

UK PubMed Central (United Kingdom)

This study reports the results of an epidemiologic survey for the detection of Taenia solium in a rural village of 559 inhabitants in Sinaloa, Mexico, as well as a large scale treatment of the population with praziquantel. The study was carried out in two stages. In stage 1, serial stool analysis of 392 persons detected a cluster of three T. solium tapeworms. A fourth T. solium tapeworm was detected through a household census, giving a 1.32% prevalence rate for this helminth. Over 70% of the population over five years of age was treated with a 10 mg/kg dose of praziquantel, and no additional tapeworms were found. Environmental studies for the detection of Taenia sp. eggs in soil, water, and and objects from the houses of tapeworm-infected individuals showed only one soil sample containing eggs compatible with Taenia sp. A total of 72 domestic pigs were examined for the presence of cysticerci under the tongue. One animal had cysts, and belonged to a household that had two T. solium tapeworm infections. Stage 2 of the study was carried out one year after large scale antihelminthic treatment (LSAT), and no infections with Taenia sp. eggs were found. No cysticercus-infected pigs were detected. Intestinal parasitosis decreased from 69.2% to 37.5%. It is concluded that LSAT with praziquantel is efficient in decreasing endemic foci of T. solium. Seropositivity to T. solium bladder fluid antigens was tested by enzyme-linked immunosorbent assay and found to be 11% before LSAT and 7% one year later. In family members living with T. solium tapeworm carriers, the number of seropositive individuals was 28%. The relative risk ratio of seropositivity for persons living in the same household with a T. solium tapeworm carrier was 2.95. Positive response was significantly higher in the 30-39-year-old age group, in which 30% were seropositive in stage 1, compared with 7% one year after LSAT. High seropositivity rates were significantly associated with tapeworm clusters as well as with individuals with a clinical history of seizures.

Diaz Camacho SP; Candil Ruiz A; Suate Peraza V; Zazueta Ramos ML; Felix Medina M; Lozano R; Willms K

1991-10-01

80

A review of the control of clonorchiasis sinensis and Taenia solium taeniasis/cysticercosis in China.  

UK PubMed Central (United Kingdom)

Clonorchiasis sinensis and Taenia solium taeniasis/cysticercosis are major foodborne parasitoses. Clonorchiasis sinensis is actively transmitted in some areas of China, Korea, Russia, Vietnam, etc. Currently, it is estimated that more than 200 million people are at risk of infection, 15-20 million people are infected, and 1.5-2 million show symptoms or complications. In China, it is relatively heavily transmitted in Zhujiang River Delta, including Hong Kong and Macao, and Northeast China, where many Korean people live. The transmission is related to the unhealthy habits of residents who like to have raw fish or half-raw fish. The infection of Clonorchis sinensis could result in serious liver and biliary system damages, and chronic cases may induce liver and bile duct cancers. T. solium taeniasis/cysticercosis is distributed around the world except the areas where the residents have a taboo against pork for religious reasons. Recent years, the urban inhabitants infected with T. solium/Cysticercus are increasing in China. T. solium results in intestinal diseases, and cysticercosis is a very serious disease, especially nervous system cysticercosis. Its symptoms include headache, epilepsy, sudden death, etc. Health education and health promotion, environmental reconstruction, and chemotherapy are the main control measures for these diseases. Through several decades of efforts in China, the achievements of control of clonorchiasis and T. solium taeniasis/cysticercosis are great. For example, in one of the main clonorchiasis-endemic provinces, Shandong Province, clonorchiasis has been controlled. In 31?T. solium taeniasis/cysticercosis-endemic counties of Henan Province, through a 6-year control program, the decline rates of T. solium taeniasis and cysticercosis were 90.8 and 96.8 %, respectively. This paper reviews the researches on the control of clonorchiasis and T. solium taeniasis/cysticercosis in China past decades so as to provide references for other countries where these diseases are endemic to improve the control or elimination of clonorchiasis and T. solium taeniasis/cysticercosis.

Wu W; Qian X; Huang Y; Hong Q

2012-11-01

 
 
 
 
81

Complexities in using sentinel pigs to study Taenia solium transmission dynamics under field conditions.  

UK PubMed Central (United Kingdom)

The transmission dynamics of the pork tapeworm, Taenia solium, remain a matter of research and debate. In a longitudinal field study performed in southeastern Nepal, 18 sentinel pigs were serologically monitored to study the field kinetics of Taenia antigens and anti-T. solium antibodies. At the end of the twelve months' study period, necropsy was performed and suspected lesions were subjected to molecular identification of the Taenia species. The study generated new hypotheses on the transmission dynamics of Taenia spp. and exposed crucial complexities in the use of sentinel pigs in longitudinal field studies. Sentinel pigs can be useful epidemiological tools, but their use should be thoroughly planned before initiating a study and carefully monitored throughout the course of the study. Important aspects to be considered are those affecting the pig's susceptibility to infection, such as passive immunity, age, hormonal levels, and infection with competing Taenia species. In addition, serological test results should be interpreted considering possible cross-reactions and with proper understanding of the significance of a positive test result.

Devleesschauwer B; Aryal A; Tharmalingam J; Joshi DD; Rijal S; Speybroeck N; Gabriël S; Victor B; Dorny P

2013-03-01

82

Complexities in using sentinel pigs to study Taenia solium transmission dynamics under field conditions.  

Science.gov (United States)

The transmission dynamics of the pork tapeworm, Taenia solium, remain a matter of research and debate. In a longitudinal field study performed in southeastern Nepal, 18 sentinel pigs were serologically monitored to study the field kinetics of Taenia antigens and anti-T. solium antibodies. At the end of the twelve months' study period, necropsy was performed and suspected lesions were subjected to molecular identification of the Taenia species. The study generated new hypotheses on the transmission dynamics of Taenia spp. and exposed crucial complexities in the use of sentinel pigs in longitudinal field studies. Sentinel pigs can be useful epidemiological tools, but their use should be thoroughly planned before initiating a study and carefully monitored throughout the course of the study. Important aspects to be considered are those affecting the pig's susceptibility to infection, such as passive immunity, age, hormonal levels, and infection with competing Taenia species. In addition, serological test results should be interpreted considering possible cross-reactions and with proper understanding of the significance of a positive test result. PMID:23298565

Devleesschauwer, Brecht; Aryal, Arjun; Tharmalingam, Jayaraman; Joshi, Durga Datt; Rijal, Suman; Speybroeck, Niko; Gabriël, Sarah; Victor, Bjorn; Dorny, Pierre

2012-12-23

83

Evaluation of Taenia solium and Taenia crassiceps cysticercal antigens for immunodiagnosis of neurocysticercosis using ELISA on cerebrospinal fluid samples/ Avaliação de antígenos de cisticercos de Taenia solium e Taenia crassiceps para o imunodiagnóstico da neurocisticercose por ELISA em amostras de líquido cefalorraquidiano  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese A eficácia de extratos antigênicos de parasitas totais e líquido vesicular de cisticercos de Taenia solium e Taenia crassiceps para o imunodiagnóstico da neurocisticercose foi avaliada por meio de reações de ELISA em amostras de líquido cefalorraquidiano. Anticorpos IgG anti-cisticercos foram pesquisados em amostras de líquido cefalorraquidiano de 23 pacientes com neurocisticercose e 35 pacientes com outras doenças neurológicas. A reação ELISA com o extrato br (more) uto total de cisticercos de Taenia solium apresentou 91,3% de sensibilidade e 94,3% de especificidade, enquanto a sensibilidade e a especificidade da reação ELISA com o extrato total de cisticercos de Taenia crassiceps foram 87% e 94,3%, respectivamente. As reações ELISA com o líquido vesicular de Taenia solium ou Taenia crassiceps mostraram 91,3% de sensibilidade e 97,1% de especificidade. Considerando os resultados obtidos com as quatro preparações antigênicas, o liquido vesicular de cisticercos de Taenia solium e Taenia crassiceps pode ser útil como fonte de antígenos em reações imunológicas usadas para detectar anticorpos específicos em amostras de líquido cefalorraquidiano de pacientes com neurocisticercose. Abstract in english The efficacy of whole parasite and vesicular fluid antigen extracts from Taenia solium and Taenia crassiceps cysticerci for immunodiagnosis of neurocysticercosis was evaluated using ELISA on cerebrospinal fluid samples. Anticysticercal IgG antibodies were assayed in cerebrospinal fluid samples from 23 patients with neurocysticercosis and 35 patients with other neurological disorders. The ELISA reaction for the whole Taenia solium cysticercal extract showed 91.3% sensitivi (more) ty and 94.3% specificity, whereas the sensitivity and specificity of the ELISA for the whole Taenia crassiceps cysticercal extract were 87% and 94.3%, respectively. The ELISA reactions for vesicular fluid from Taenia solium or Taenia crassiceps showed 91.3% sensitivity and 97.1% specificity. Considering the results obtained from the four antigen preparations, vesicular fluid from Taenia solium and Taenia crassiceps cysticerci may be useful as a source of antigens for immunological reactions that are used for detecting specific antibodies in cerebrospinal fluid samples from patients with neurocysticercosis.

Suzuki, Lisandra Akemi; Arruda, Gisele Cristina; Quagliato, Elizabeth Maria Aparecida Barasnevicius; Rossi, Qláudio Lúcio

2007-04-01

84

Evaluation of Taenia solium and Taenia crassiceps cysticercal antigens for immunodiagnosis of neurocysticercosis using ELISA on cerebrospinal fluid samples Avaliação de antígenos de cisticercos de Taenia solium e Taenia crassiceps para o imunodiagnóstico da neurocisticercose por ELISA em amostras de líquido cefalorraquidiano  

Directory of Open Access Journals (Sweden)

Full Text Available The efficacy of whole parasite and vesicular fluid antigen extracts from Taenia solium and Taenia crassiceps cysticerci for immunodiagnosis of neurocysticercosis was evaluated using ELISA on cerebrospinal fluid samples. Anticysticercal IgG antibodies were assayed in cerebrospinal fluid samples from 23 patients with neurocysticercosis and 35 patients with other neurological disorders. The ELISA reaction for the whole Taenia solium cysticercal extract showed 91.3% sensitivity and 94.3% specificity, whereas the sensitivity and specificity of the ELISA for the whole Taenia crassiceps cysticercal extract were 87% and 94.3%, respectively. The ELISA reactions for vesicular fluid from Taenia solium or Taenia crassiceps showed 91.3% sensitivity and 97.1% specificity. Considering the results obtained from the four antigen preparations, vesicular fluid from Taenia solium and Taenia crassiceps cysticerci may be useful as a source of antigens for immunological reactions that are used for detecting specific antibodies in cerebrospinal fluid samples from patients with neurocysticercosis.A eficácia de extratos antigênicos de parasitas totais e líquido vesicular de cisticercos de Taenia solium e Taenia crassiceps para o imunodiagnóstico da neurocisticercose foi avaliada por meio de reações de ELISA em amostras de líquido cefalorraquidiano. Anticorpos IgG anti-cisticercos foram pesquisados em amostras de líquido cefalorraquidiano de 23 pacientes com neurocisticercose e 35 pacientes com outras doenças neurológicas. A reação ELISA com o extrato bruto total de cisticercos de Taenia solium apresentou 91,3% de sensibilidade e 94,3% de especificidade, enquanto a sensibilidade e a especificidade da reação ELISA com o extrato total de cisticercos de Taenia crassiceps foram 87% e 94,3%, respectivamente. As reações ELISA com o líquido vesicular de Taenia solium ou Taenia crassiceps mostraram 91,3% de sensibilidade e 97,1% de especificidade. Considerando os resultados obtidos com as quatro preparações antigênicas, o liquido vesicular de cisticercos de Taenia solium e Taenia crassiceps pode ser útil como fonte de antígenos em reações imunológicas usadas para detectar anticorpos específicos em amostras de líquido cefalorraquidiano de pacientes com neurocisticercose.

Lisandra Akemi Suzuki; Gisele Cristina Arruda; Elizabeth Maria Aparecida Barasnevicius Quagliato; Qláudio Lúcio Rossi

2007-01-01

85

Taenia crassiceps cysticerci: Characterization of the 14-kDa glycoprotein with homologies to antigens from Taenia solium cysticerci.  

UK PubMed Central (United Kingdom)

Glycoproteins from the total vesicular fluid of Taenia crassiceps (VF-Tc) were prepared using three different purification methods, consisting of ConA-lectin affinity chromatography (ConA-Tc), preparative electrophoresis (SDS-PAGE) (14 gp-Tc), and monoclonal antibody immunoaffinity chromatography (18/14-Tc). The complex composition represented by the VF-Tc and ConA-Tc antigens revealed peptides ranging from 101- to 14-kDa and from 92- to 12-kDa, respectively. Immunoblotting using lectins confirmed glucose/mannose (glc/man) residues in the 18- and 14-kDa peptides, which are considered specific and immunodominant for the diagnosis of cysticercosis, and indicated that these fractions are glycoproteins. Serum antibodies from a patient with neurocysticercosis that reacted to the 14 gp band from T. crassiceps (Tc) were eluted from immunoblotting membranes and showed reactivity to 14 gp from Taenia solium. In order to determine the similar peptide sequence, the N-terminal amino acid was determined and analyzed with sequences available in public databases. This sequence revealed partial homology between T. crassiceps and T. solium peptides. In addition, mass spectrometry along with theoretical M(r) and pI of the 14 gp-Tc point suggested a close relationship to some peptides of a 150-kDa protein complex of the T. solium previously described. The identification of these common immunogenic sites will contribute to future efforts to develop recombinant antigens and synthetic peptides for immunological assays.

Peralta RH; Espíndola NM; Pardini AX; Iha AH; Moura H; Barr JR; Vaz AJ; Peralta JM

2010-03-01

86

An ocular cysticercosis in Bali, Indonesia caused by Taenia solium Asian genotype.  

UK PubMed Central (United Kingdom)

An ocular cysticercosis case of a nine-year-old Balinese girl in Indonesia is reported. She presented with redness and pain in the left eye and showed a cysticercus in the anterior chamber in December 2010. Morphological feature of the cysticercus removed from the anterior chamber indicated that it was an immature cysticercus of Taenia species with no hooklets. However, mitochondrial DNA analysis using a piece of histopathological specimen revealed it a cysticercus of Taenia solium Asian genotype. Serology by immunoblot and ELISA highly specific to cysticercosis was negative.

Swastika K; Dewiyani CI; Yanagida T; Sako Y; Sudarmaja M; Sutisna P; Wandra T; Dharmawan NS; Nakaya K; Okamoto M; Ito A

2012-06-01

87

Prevention and control of Taenia solium taeniasis/cysticercosis in Peru.  

UK PubMed Central (United Kingdom)

Taenia solium is endemic in most of the world, causing seizures and other neurological symptoms. Transmission is mainly maintained in rural areas by a human to pig cycle. Despite claims on its eradicability, sustainable interruption of transmission has not yet been reported. This manuscript reviews the conceptual basis for control, available diagnostic and control tools, and recent experiences on control in the field performed in Peru along the past decade.

Gilman RH; Gonzalez AE; Llanos-Zavalaga F; Tsang VC; Garcia HH

2012-09-01

88

Detection of cysteine protease in Taenia solium-induced brain granulomas in naturally infected pigs.  

UK PubMed Central (United Kingdom)

In order to further characterize the immune response around the viable or degenerating Taenia solium cysts in the pig brain, the involvement of cysteine protease in the immune evasion was assessed. Brain tissues from 30 adult pigs naturally infected with T. solium cysticercosis were subjected to histopathology using hematoxylin and eosin stain, and immunohistochemistry using caspase-3 antibodies. Histopathological evaluation revealed lesions of stage I which was characterized by presence of viable parasite surrounded with minimal to moderate inflammatory cells and stage III characterized by the presence of a disintegrating parasite surrounded with high inflammatory cells. The results of immunohistochemistry indicated caspase-3 positive cells interspaced between inflammatory infiltrate mainly in stage I lesions, indicating the presence of cysteine protease. This result confirms the earlier hypothesis that cysteine protease may play a role in inducing immune evasion through apoptosis around viable T. solium cysts.

Mkupasi EM; Sikasunge CS; Ngowi HA; Leifsson PS; Johansen MV

2013-10-01

89

Detection of cysteine protease in Taenia solium-induced brain granulomas in naturally infected pigs.  

Science.gov (United States)

In order to further characterize the immune response around the viable or degenerating Taenia solium cysts in the pig brain, the involvement of cysteine protease in the immune evasion was assessed. Brain tissues from 30 adult pigs naturally infected with T. solium cysticercosis were subjected to histopathology using hematoxylin and eosin stain, and immunohistochemistry using caspase-3 antibodies. Histopathological evaluation revealed lesions of stage I which was characterized by presence of viable parasite surrounded with minimal to moderate inflammatory cells and stage III characterized by the presence of a disintegrating parasite surrounded with high inflammatory cells. The results of immunohistochemistry indicated caspase-3 positive cells interspaced between inflammatory infiltrate mainly in stage I lesions, indicating the presence of cysteine protease. This result confirms the earlier hypothesis that cysteine protease may play a role in inducing immune evasion through apoptosis around viable T. solium cysts. PMID:23726797

Mkupasi, Ernatus Martin; Sikasunge, Chummy Sikalizyo; Ngowi, Helena Aminiel; Leifsson, Pall S; Johansen, Maria Vang

2013-05-14

90

A possible nuclear DNA marker to differentiate the two geographic genotypes of Taenia solium tapeworms.  

UK PubMed Central (United Kingdom)

Cysticercosis caused by infection with embryonated eggs of the pork tapeworm Taenia solium is an important cause of neurological disease worldwide. Based on the phylogenetic analysis of mitochondrial DNA, the pathogen has been divided into two geographic clades, corresponding to Afro-American and Asian genotypes. In this study the genotyping of T. solium was carried out by using the nuclear DNA sequences of the immunodiagnostic antigen genes Ag1V1 and Ag2. The two geographic genotypes were supported by the Ag2 sequences, especially showing unique substitutions in each of the genotypes. It seems likely that the Ag2 may be a novel nuclear DNA marker to distinguish the two geographic genotypes of T. solium.

Sato MO; Sako Y; Nakao M; Wandra T; Nakaya K; Yanagida T; Ito A

2011-01-01

91

Epidemiologia da teníase/cisticercose por Taenia solium e Taenia saginata/ Epidemiology of teniasis/cysticercosis by Taenia solium and Taenia saginata  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese No presente artigo, os autores fazem uma revisão dos aspectos epidemiológicos da teníase e cisticercose. A cisticercose é produzida pelo desenvolvimento da forma larval da Taenia, o Cysticercus, nos tecidos, sendo transmitida pela ingestão de ovos de Taenia. A cisticercose humana e animal são consideradas um grande problema sócio-econômico em muitos países. É considerada uma zoonose endêmica, estando distribuída nos países em desenvolvimento, especialmente na (more) s áreas rurais. A invasão da larva no sistema nervoso central em humanos constitui uma séria complicação. A cisticercose é um dos maiores problemas de saúde pública dos países em desenvolvimento e a neurocisticercose é considerada a doença parasitária mais comum do sistema nervoso humano. A conservação da carne em temperatura inferior a -15ºC durante seis dias, sua cocção adequada, além da inspeção sanitária das carnes e o diagnóstico e tratamento da teníase humana em áreas endêmicas constituem as principais medidas de controle. Abstract in english Is described a review of the epidemiological aspects of teniasis and cysticercosis. Cysticercosis is caused by the development of the larval form of Taenia, wich results in the Cysticercus in tissues, and is transmitted through ingestion of Taenia eggs. Human and animal cysticercosis are a great socioeconomic problem in many countries. It is a endemic zoonosis and is widespread in developing countries especially in rural areas. Larval invasion of the central nervous syste (more) m constitutes a serious complication in humans. Cysticercosis is one of the great public health problems in developing countries and the neurocysticercosis is considered the most common parasitic disease of the human central nervous system. The freezing of meat for six days in temperatures below -15ºC, its adequate cooking, meat inspection and treatment individual patients infected with adult worms in endemic areas are the main control measures.

Pfuetzenreiter, Márcia Regina; Pires, Fernando Dias de Ávila

2000-06-01

92

Epidemiologia da teníase/cisticercose por Taenia solium e Taenia saginata Epidemiology of teniasis/cysticercosis by Taenia solium and Taenia saginata  

Directory of Open Access Journals (Sweden)

Full Text Available No presente artigo, os autores fazem uma revisão dos aspectos epidemiológicos da teníase e cisticercose. A cisticercose é produzida pelo desenvolvimento da forma larval da Taenia, o Cysticercus, nos tecidos, sendo transmitida pela ingestão de ovos de Taenia. A cisticercose humana e animal são consideradas um grande problema sócio-econômico em muitos países. É considerada uma zoonose endêmica, estando distribuída nos países em desenvolvimento, especialmente nas áreas rurais. A invasão da larva no sistema nervoso central em humanos constitui uma séria complicação. A cisticercose é um dos maiores problemas de saúde pública dos países em desenvolvimento e a neurocisticercose é considerada a doença parasitária mais comum do sistema nervoso humano. A conservação da carne em temperatura inferior a -15ºC durante seis dias, sua cocção adequada, além da inspeção sanitária das carnes e o diagnóstico e tratamento da teníase humana em áreas endêmicas constituem as principais medidas de controle.Is described a review of the epidemiological aspects of teniasis and cysticercosis. Cysticercosis is caused by the development of the larval form of Taenia, wich results in the Cysticercus in tissues, and is transmitted through ingestion of Taenia eggs. Human and animal cysticercosis are a great socioeconomic problem in many countries. It is a endemic zoonosis and is widespread in developing countries especially in rural areas. Larval invasion of the central nervous system constitutes a serious complication in humans. Cysticercosis is one of the great public health problems in developing countries and the neurocysticercosis is considered the most common parasitic disease of the human central nervous system. The freezing of meat for six days in temperatures below -15ºC, its adequate cooking, meat inspection and treatment individual patients infected with adult worms in endemic areas are the main control measures.

Márcia Regina Pfuetzenreiter; Fernando Dias de Ávila Pires

2000-01-01

93

Antígenos de larva de Taenia solium em ELISA para diagnóstico da cisticercose bovina/ Taenia solium metacestode antigens in ELISA for the diagnosis of bovine cysticercosis  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Foram avaliados alguns parâmetros inerentes ao ELISA, por meio de ensaios de reatividade de soros-controle positivos e negativos para a cisticercose bovina com relação a três tipos de antígenos de larva de Taenia solium: total, de escólex e de membrana. As concentrações de antígeno de 0,25; 0,5; 1; 2 e 4µg por orifício, e as diluições de soro de 1:25, 1:50, 1:100 e 1:200, foram os parâmetros que menos influenciaram no desempenho do teste. A substância bloqu (more) eadora, o leite desnatado e as diluições de conjugado, 1:1.250, 1:2.500 e 1:5.000, representaram os melhores indicadores de desempenho do teste. Concluiu-se que essa combinação de critérios deve ser considerada no diagnóstico da cisticercose bovina, em atividades de rotina ou de padronização do referido teste, considerando os três antígenos de larva de T. solium estudados. Abstract in english Some parameters of ELISA were evaluated using positive and negative bovine sera for cysticercosis and three types of antigens of Taenia solium larvae: total, scolex and membrane. The antigen concentrations (0.25; 0.5; 1; 2 and 4µg/well) and the serum dilutions (1:25, 1:50, 1:100 and 1:200) were the parameters that influenced less the test performance; while blocking substance, skimmed milk, and conjugate dilutions, 1:1.250, 1:2.500 and 1:5.000 were the best indexes of th (more) e test performance. It was concluded that this combination of criteria should be considered in the diagnosis of bovine cysticercosis, in routine diagnosis and for the ELISA test standardization.

Monteiro, L.L.; Pinto, P.S.A.; Salcedo, J.H.P.; Araújo, J.V.; Santos, W.L.M.; Cecon, P.R.

2007-02-01

94

Antígenos de larva de Taenia solium em ELISA para diagnóstico da cisticercose bovina Taenia solium metacestode antigens in ELISA for the diagnosis of bovine cysticercosis  

Directory of Open Access Journals (Sweden)

Full Text Available Foram avaliados alguns parâmetros inerentes ao ELISA, por meio de ensaios de reatividade de soros-controle positivos e negativos para a cisticercose bovina com relação a três tipos de antígenos de larva de Taenia solium: total, de escólex e de membrana. As concentrações de antígeno de 0,25; 0,5; 1; 2 e 4µg por orifício, e as diluições de soro de 1:25, 1:50, 1:100 e 1:200, foram os parâmetros que menos influenciaram no desempenho do teste. A substância bloqueadora, o leite desnatado e as diluições de conjugado, 1:1.250, 1:2.500 e 1:5.000, representaram os melhores indicadores de desempenho do teste. Concluiu-se que essa combinação de critérios deve ser considerada no diagnóstico da cisticercose bovina, em atividades de rotina ou de padronização do referido teste, considerando os três antígenos de larva de T. solium estudados.Some parameters of ELISA were evaluated using positive and negative bovine sera for cysticercosis and three types of antigens of Taenia solium larvae: total, scolex and membrane. The antigen concentrations (0.25; 0.5; 1; 2 and 4µg/well) and the serum dilutions (1:25, 1:50, 1:100 and 1:200) were the parameters that influenced less the test performance; while blocking substance, skimmed milk, and conjugate dilutions, 1:1.250, 1:2.500 and 1:5.000 were the best indexes of the test performance. It was concluded that this combination of criteria should be considered in the diagnosis of bovine cysticercosis, in routine diagnosis and for the ELISA test standardization.

L.L. Monteiro; P.S.A. Pinto; J.H.P. Salcedo; J.V. Araújo; W.L.M. Santos; P.R. Cecon

2007-01-01

95

Characterization of the carbohydrate components of Taenia solium oncosphere proteins and their role in the antigenicity.  

UK PubMed Central (United Kingdom)

This study examines the carbohydrate composition of Taenia solium whole oncosphere antigens (WOAs), in order to improve the understanding of the antigenicity of the T. solium. Better knowledge of oncosphere antigens is crucial to accurately diagnose previous exposure to T. solium eggs and thus predict the development of neurocysticercosis. A set of seven lectins conjugates with wide carbohydrate specificity were used on parasite fixations and somatic extracts. Lectin fluorescence revealed that D-mannose, D-glucose, D-galactose and N-acetyl-D-galactosamine residues were the most abundant constituents of carbohydrate chains on the surface of T. solium oncosphere. Lectin blotting showed that posttranslational modification with N-glycosylation was abundant while little evidence of O-linked carbohydrates was observed. Chemical oxidation and enzymatic deglycosylation in situ were performed to investigate the immunoreactivity of the carbohydrate moieties. Linearizing or removing the carbohydrate moieties from the protein backbones did not diminish the immunoreactivity of these antigens, suggesting that a substantial part of the host immune response against T. solium oncosphere is directed against the peptide epitopes on the parasite antigens. Finally, using carbohydrate probes, we demonstrated for the first time that the presence of several lectins on the surface of the oncosphere was specific to carbohydrates found in intestinal mucus, suggesting a possible role in initial attachment of the parasite to host cells.

Arana Y; Verastegui M; Tuero I; Grandjean L; Garcia HH; Gilman RH

2013-10-01

96

Characterization of the carbohydrate components of Taenia solium oncosphere proteins and their role in the antigenicity.  

Science.gov (United States)

This study examines the carbohydrate composition of Taenia solium whole oncosphere antigens (WOAs), in order to improve the understanding of the antigenicity of the T. solium. Better knowledge of oncosphere antigens is crucial to accurately diagnose previous exposure to T. solium eggs and thus predict the development of neurocysticercosis. A set of seven lectins conjugates with wide carbohydrate specificity were used on parasite fixations and somatic extracts. Lectin fluorescence revealed that D-mannose, D-glucose, D-galactose and N-acetyl-D-galactosamine residues were the most abundant constituents of carbohydrate chains on the surface of T. solium oncosphere. Lectin blotting showed that posttranslational modification with N-glycosylation was abundant while little evidence of O-linked carbohydrates was observed. Chemical oxidation and enzymatic deglycosylation in situ were performed to investigate the immunoreactivity of the carbohydrate moieties. Linearizing or removing the carbohydrate moieties from the protein backbones did not diminish the immunoreactivity of these antigens, suggesting that a substantial part of the host immune response against T. solium oncosphere is directed against the peptide epitopes on the parasite antigens. Finally, using carbohydrate probes, we demonstrated for the first time that the presence of several lectins on the surface of the oncosphere was specific to carbohydrates found in intestinal mucus, suggesting a possible role in initial attachment of the parasite to host cells. PMID:23982308

Arana, Yanina; Verastegui, Manuela; Tuero, Iskra; Grandjean, Louis; Garcia, Hector H; Gilman, Robert H

2013-08-28

97

Detection of Taenia solium antigens and anti-T. solium antibodies in paired serum and cerebrospinal fluid samples from patients with intraparenchymal or extraparenchymal neurocysticercosis  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Background. Neurocysticercosis (NCC) is a frequent cause of epilepsy worldwide. Compared with the more common parenchymal brain cysts, extraparenchymal infections are difficult to manage and have a poor prognosis. Serological assays are used to detect circulating Taenia solium antigens or anti-T. so...

Rodriguez, S.; Dorny, P.; Tsang, V. C. W.; Pretell, E. J.; Brandt, J.; Lescano, A. G.; Gonzalez, A. E.; Gilman, R. H.

98

Comparative evaluation of purified Taenia solium glycoproteins and crude metacestode extracts by immunoblotting for the serodiagnosis of human T. solium cysticercosis.  

Digital Repository Infrastructure Vision for European Research (DRIVER)

A lentil-lectin purified glycoprotein (LL-Gp) and a crude saline extract of Taenia solium metacestodes were compared for the immunodiagnosis of human cysticercosis by immunoblotting. The LL-Gp preparation was 95% sensitive for antibodies against a range of seven antigens with molecular masses of 50 ...

Rodriguez-Canul, R; Allan, J C; Fletes, C; Sutisna, I P; Kapti, I N; Craig, P S

99

Cestode infestations: hydatid disease and cysticercosis.  

Science.gov (United States)

Although humans can be definitive hosts for cestodes (tapeworms), major pathologic conditions occur during cestode larval stages when humans serve as the intermediate host for these parasites. The most relevant forms of human disease caused by cestode larvae are echinococcosis, caused by Echinococcus granulosus (cystic echinococcosis) and Echinococcus multilocularis (alveolar echinococcosis), and cysticercosis, caused by Taenia solium. These infections occur worldwide, but their relevance is particularly high in developing countries, where poor hygiene conditions facilitate the transmission of the parasites. The therapeutic approach is often complex, requiring surgery and/or chemotherapy or, in the case of cystic echinococcosis, percutaneous treatments. PMID:22632647

Brunetti, Enrico; White, A Clinton

2012-06-01

100

Cestode infestations: hydatid disease and cysticercosis.  

UK PubMed Central (United Kingdom)

Although humans can be definitive hosts for cestodes (tapeworms), major pathologic conditions occur during cestode larval stages when humans serve as the intermediate host for these parasites. The most relevant forms of human disease caused by cestode larvae are echinococcosis, caused by Echinococcus granulosus (cystic echinococcosis) and Echinococcus multilocularis (alveolar echinococcosis), and cysticercosis, caused by Taenia solium. These infections occur worldwide, but their relevance is particularly high in developing countries, where poor hygiene conditions facilitate the transmission of the parasites. The therapeutic approach is often complex, requiring surgery and/or chemotherapy or, in the case of cystic echinococcosis, percutaneous treatments.

Brunetti E; White AC Jr

2012-06-01

 
 
 
 
101

Control of Taenia solium taeniasis/cysticercosis: past practices and new possibilities.  

UK PubMed Central (United Kingdom)

SUMMARY Neurocysticercosis continues to be a major health burden on humans living in many regions of the world, despite the availability of highly effective taeniacides and identification of the cause, Taenia solium, as being potentially eradicable. Several T. solium control trials have been undertaken, generally achieving limited success and none that has been fully documented has achieved what was demonstrated to be a sustainable level of disease control. Pigs act as intermediate hosts for T. solium and two new control tools have become available for application in pigs - single-dose oxfendazole treatment of porcine cysticercosis and the TSOL18 vaccine. Three potential intervention scenarios for pigs are compared for control of cysticercosis, using either oxfendazole or vaccination. A control scenario involving vaccination plus oxfendazole treatment delivered at 4 monthly intervals was predicted to achieve the best outcome, with no pigs slaughtered at 12 months of age having viable T. solium cysticerci. Now that new control tools are available, there are opportunities to concentrate research attention on evaluation of novel control scenarios leading to the implementation of effective and sustainable control programmes and a reduction in the global burden of neurocysticercosis.

Lightowlers MW

2013-08-01

102

Taenia solium taeniosis/cysticercosis in Africa: risk factors, epidemiology and prospects for control using vaccination.  

UK PubMed Central (United Kingdom)

Poor sanitary conditions, free-roaming of domestic pigs and lack of awareness of the disease play an important role in the perpetuation of the Taenia solium taeniosis and cysticercosis in Africa. Traditional pig production systems known as the source of T. solium taeniosis/cysticercosis complex are predominant in the continent, representing 60-90% of pig production in rural areas. It has been reported that T. solium cysticercosis is the main cause of acquired epilepsy in human population and results in considerable public health problems and economic costs to the endemic countries. Although the socioeconomic impact and public health burden of cysticercosis have been demonstrated, up to now no large-scale control programme has been undertaken in Africa. Most disease control trials reported in the literature have been located in Latin America and Asia. This review discusses the risk factors and epidemiology of T. solium cysticercosis in Africa and critically analyzes the options available for implementing control of this zoonotic disease in the continent.

Assana E; Lightowlers MW; Zoli AP; Geerts S

2013-07-01

103

Seroprevalence of Taenia solium infections in Croatian patients presenting with epilepsy.  

UK PubMed Central (United Kingdom)

Epilepsy is one of the most common neurological disorders, while neurocysticercosis caused by Taenia solium infection of the central nervous system currently represents the leading cause of secondary epilepsy in Central and South America, East and South Asia, and sub-Saharan Africa. As a result of increased migration from these endemic regions, neurocysticercosis and subsequent epilepsy are becoming a growing public health problem in developed countries as well. In order to determine the prevalence of T. solium infection in patients with epilepsy in Croatia, a retrospective serological study was conducted. A total of 770 serum samples were tested for the presence of T. solium IgG antibodies using a commercial qualitative enzyme immunoassay. The Western blot technique was used as a confirmatory test for the diagnosis. The overall seroprevalence rate of T. solium infection in patients with clinically proven epilepsy was 1.5%. Although the results have shown that infection with this tapeworm is rare in Croatia, this study hopes to increase awareness about the importance of preventive measures and benefits of accurate and timely diagnosis. Intervention measures for infection control are crucial, namely sanitation improvement, control of domestic pig-breeding, detailed meat inspection, detection and treatment of tapeworm carriers, hand washing and health education.

Meštrovi? T; Sviben M; Vilibi?-?avlek T; Ljubin-Sternak S; Tabain I; Mlinari?-Galinovi? G

2012-09-01

104

Vaccine development against the Taenia solium parasite: The role of recombinant protein expression in Escherichia coli.  

UK PubMed Central (United Kingdom)

Taenia solium is a zoonotic parasite that causes cysticercosis. The parasite is a major cause of human disease in impoverished communities where it is transmitted to humans from pigs which act as intermediate hosts. Vaccination of pigs to prevent transmission of T. solium to humans is an approach that has been investigated to control the disease. A recombinant vaccine antigen, TSOL18, has been remarkably successful at reducing infection of pigs with T. solium in several experimental challenge trials. The vaccine has been shown to eliminate transmission of naturally acquired T. solium in a field trial conducted in Africa. We recently reported that the vaccine was also effective in a field trial conducted in Peru. The TSOL18 recombinant antigen for each of these trials has been produced by expression in Escherichia coli. Here we discuss research that has been undertaken on the TSOL18 antigen and related antigens with a focus on improved methods of preparation of recombinant TSOL18 and optimized expression in Escherichia coli.

Gauci C; Jayashi C; Lightowlers MW

2013-09-01

105

Taenia solium taeniosis/cysticercosis in Africa: risk factors, epidemiology and prospects for control using vaccination.  

Science.gov (United States)

Poor sanitary conditions, free-roaming of domestic pigs and lack of awareness of the disease play an important role in the perpetuation of the Taenia solium taeniosis and cysticercosis in Africa. Traditional pig production systems known as the source of T. solium taeniosis/cysticercosis complex are predominant in the continent, representing 60-90% of pig production in rural areas. It has been reported that T. solium cysticercosis is the main cause of acquired epilepsy in human population and results in considerable public health problems and economic costs to the endemic countries. Although the socioeconomic impact and public health burden of cysticercosis have been demonstrated, up to now no large-scale control programme has been undertaken in Africa. Most disease control trials reported in the literature have been located in Latin America and Asia. This review discusses the risk factors and epidemiology of T. solium cysticercosis in Africa and critically analyzes the options available for implementing control of this zoonotic disease in the continent. PMID:23312868

Assana, Emmanuel; Lightowlers, Marshall W; Zoli, André P; Geerts, Stanny

2012-12-20

106

Vaccine development against the Taenia solium parasite: The role of recombinant protein expression in Escherichia coli.  

Science.gov (United States)

Taenia solium is a zoonotic parasite that causes cysticercosis. The parasite is a major cause of human disease in impoverished communities where it is transmitted to humans from pigs which act as intermediate hosts. Vaccination of pigs to prevent transmission of T. solium to humans is an approach that has been investigated to control the disease. A recombinant vaccine antigen, TSOL18, has been remarkably successful at reducing infection of pigs with T. solium in several experimental challenge trials. The vaccine has been shown to eliminate transmission of naturally acquired T. solium in a field trial conducted in Africa. We recently reported that the vaccine was also effective in a field trial conducted in Peru. The TSOL18 recombinant antigen for each of these trials has been produced by expression in Escherichia coli. Here we discuss research that has been undertaken on the TSOL18 antigen and related antigens with a focus on improved methods of preparation of recombinant TSOL18 and optimized expression in Escherichia coli. PMID:23196744

Gauci, Charles; Jayashi, César; Lightowlers, Marshall W

2012-11-29

107

Efectos en el desarrollo del metacestodo de Taenia solium inducidos por dosis bajas de radiación gamma  

Directory of Open Access Journals (Sweden)

Full Text Available Con el objetivo de controlar la teniasis (cisticercosis) se efectuó este estudio en el que se evaluaron los efectos que induce la radiación gamma en el metacestodo de Taenia solium (T. solium) en la evaginación in vitro y en el desarrollo de T. solium en el modelo del hámster. Los parásitos se obtuvieron de varios cerdos infectados y se irradiaron con 0.2 y 0.3 kGy. La viabilidad de los metacestodos se evaluó mediante la prueba de evaginación in vitro y la inoculación en hámsteres dorados (Mesocricetus auratus), previamente inmunodeprimidos. En los metacestodos irradiados con 0.3 kGy disminuyó la capacidad de evaginar in vitro (P = 0.008). En los hámsteres inmunodeprimidos que se inocularon con metacestodos irradiados con 0.3 y 0.2 kGy no se desarrollaron tenias en sus intestinos, únicamente se observaron escolices adheridos a la mucosa intestinal. La cantidad total de escolices obtenidos de los metacestodos irradiados con 0.3 kGy fue menor (P = 0.01). Con base en los presentes resultados se propone que una dosis de 0.3 kGy es útil para inhibir el ciclo parasitario de T. solium.

Fernando Iván Flores Pérez; Aline S. de Aluja; José Juan Martínez Maya

2006-01-01

108

Determinación por medio de marcadores moleculares SSCP y RAPD de la diversidad genética en la especie Taenia solium en Colombia DETERMINATION BY SSCP AND RAPD OF GENETIC DIVERSITY IN Taenia solium ESPECIES, MAIN CAUSATIVE AGENT OF TENIOSIS AND CYSTICERCOSIS IN COLOMBIA  

Directory of Open Access Journals (Sweden)

Full Text Available Utilizando las técnicas moleculares de SSCP y RAPD se pudo evidenciar rápida y claramente la variabilidad genética en Colombia de larvas del céstodo Taenia solium analizando fragmentos de genes de ADN mitocondrial y fragmentos aleatorios de ADN nuclear. El ADN estudiado se obtuvo de ocho aislados de cisticercos de cerdo provenientes de tres departamentos de Colombia: Antioquia, Nariño y Sucre. Los fragmentos obtenidos por PCR de los genes NADH deshidrogenasa 1 (ND1) y citocromo oxidasa c subunidad I (COI) al ser denaturados y analizados en geles no denaturantes de acrilamida, mostraron al menos tres patrones diferentes por cada gen analizado, verificando que estos genes conservados mitocondriales son polimórficos en T. solium colombiana. Por otra parte, los cebadores decaméricos de RAPD produjeron patrones polimórficos, corroboraron la diversidad genética entre los diferentes aislamientos analizadosSSCP and RAPD techniques were performed in order to detect the genetic variability of Taenia solium cestode, using both mitochondrial and nuclear DNA fragments. The DNA was extracted from eight different cysts isolated of pigs originated from three distant Colombian provinces: Antioquia, Nariño and Sucre. Gene fragments corresponding to NADH dehydrogenase 1 (ND1) and cytochrome oxidase c subunit I (COI) were amplified by PCR using total DNA from individual cysts and later run on non denaturing SSCP acrylamide gels. Three different patterns were obtained by SSCP for both genes indicating that ND1 and COI mitochondrial genes are polymorphic in Colombian T. solium species. COI patterns were more polymorphic, related to the geographical origin. Furthermore, RAPD decameric primers showed a nuclear polymorphic DNA, that corroborates the genetic diversity between this isolates

MARCELA FERNÁNDEZ; AMALIA MUÑOZ; MAURICIO CORREDOR

2006-01-01

109

Simple and reliable preparation of immunodiagnostic antigens for Taenia solium cysticercosis.  

UK PubMed Central (United Kingdom)

SUMMARY Cysticercosis caused by infection with the larval stage of Taenia solium is an important cause of neurological disease worldwide and immunodiagnosis is important for the control and elimination of cysticercosis. In the present study, we established a simple and reliable preparation of immunodiagnostic low-molecular-weight antigens (LMWAgs) from T. solium cyst fluids by a cation-exchange chromatography (CEC). Banding patterns of LMWAgs on SDS-PAGE were different between isolates from Ecuador and China. All cysticercosis patient sera and some echinococcosis patient sera recognized both LMWAgs by enzyme-linked immunosorbent assay (ELISA), but sera from healthy persons were not positive. There was no statistical difference in immunodiagnostic performance of LMWAgs prepared from different geographical isolates. These results indicated that these novel immunodiagnostic antigen preparations could contribute the control and prevention of cysticercosis in endemic areas, especially developing countries.

Sako Y; Itoh S; Okamoto M; Nakaya K; Ito A

2013-06-01

110

Epidemiology of Taenia solium in Nepal: is it influenced by the social characteristics of the population and the presence of Taenia asiatica?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The transmission of the zoonotic pork tapeworms Taenia solium and T. asiatica depends on a combination of specific risk factors, such as open defecation, backyard pig raising and the consumption of raw or undercooked pork and viscera. A community-based survey was conducted among 289 households in so...

Devleesschauwer, B.; Aryal, A.; Joshi, D. D.; Rijal, S.; Sherchand, J. B.; Praet, N.; Speybroeck, N.; Duchateau, L.

111

Prevalence and risk factors associated with human Taenia solium infections in Mbozi District, Mbeya Region, Tanzania.  

UK PubMed Central (United Kingdom)

BACKGROUND: Taenia solium cysticercosis/taeniosis is emerging as a serious public health and economic problem in many developing countries. This study was conducted to determine prevalence and risk factors of human T. solium infections in Mbeya Region, Tanzania. METHODS AND FINDINGS: A cross-sectional survey was conducted in 13 villages of Mbozi district in 2009. Sera of 830 people (mean 37.9±11.3 years (SD); 43% females) were tested for circulating cysticerci antigen (Ag-ELISA) and antibody (Ab-ELISA). A subset of persons found seropositive by Ag-ELISA underwent computed tomography (CT) scan of the brain for evidence of neurocysticercosis. Stool samples from 820 of the same participants were tested for taeniosis by copro-antigens (copro-Ag-ELISA) and formol-ether concentration technique. Cases of T. solium taeniosis were confirmed serologically by EITB assay (rES38). A questionnaire was used for identification of risk factors. Active cysticercosis by positive Ag-ELISA was found in 139 (16.7%) persons while anti-cysticercal antibodies were detected in 376 (45.3%) persons by Ab-ELISA. Among 55 persons positive for Ag-ELISA undergoing CT scan, 30 (54.6%) were found to have structures in the brain suggestive of neurocysticercosis. Using faecal analysis, 43 (5.2%) stool samples tested positive for taeniosis by copro-Ag-ELISA while Taenia eggs were detected in 9 (1.1%) stool samples by routine coprology. Antibodies specifically against adult T. solium were detected in 34 copro-Ag-ELISA positive participants by EITB (rES38) indicating T. solium taeniosis prevalence of 4.1%. Increasing age and hand washing by dipping in contrast to using running water, were found associated with Ag-ELISA seropositivity by logistic regression. Gender (higher risk in females) and water source were risk factors associated with Ab-ELISA seropositivity. Reported symptoms of chronic severe headaches and history of epileptic seizures were found associated with positive Ag-ELISA (p?0.05). CONCLUSION: The present study indicates T. solium infection in humans is highly endemic in the southern highlands of Tanzania.

Mwanjali G; Kihamia C; Kakoko DV; Lekule F; Ngowi H; Johansen MV; Thamsborg SM; Willingham AL 3rd

2013-01-01

112

Cu,Zn superoxide dismutase: cloning and analysis of the Taenia solium gene and Taenia crassiceps cDNA.  

UK PubMed Central (United Kingdom)

Cytosolic Cu,Zn superoxide dismutase (Cu,Zn-SOD) catalyzes the dismutation of superoxide (O(2)(-)) to oxygen and hydrogen peroxide (H(2)O(2)) and plays an important role in the establishment and survival of helminthes in their hosts. In this work, we describe the Taenia solium Cu,Zn-SOD gene (TsCu,Zn-SOD) and a Taenia crassiceps (TcCu,Zn-SOD) cDNA. TsCu,Zn-SOD gene that spans 2.841 kb, and has three exons and two introns; the splicing junctions follow the GT-AG rule. Analysis in silico of the gene revealed that the 5'-flanking region has three putative TATA and CCAAT boxes, and transcription factor binding sites for NF1 and AP1. The transcription start site was a C, located at 22 nucleotides upstream of the translation start codon (ATG). Southern blot analysis showed that TcCu,Zn-SOD and TsCu,Zn-SOD genes are encoded by a single copy. The deduced amino acid sequences of TsCu,Zn-SOD gene and TcCu,Zn-SOD cDNA reveal 98.47% of identity, and the characteristic motives, including the catalytic site and ?-barrel structure of the Cu,Zn-SOD. Proteomic and immunohistochemical analysis indicated that Cu,Zn-SOD does not have isoforms, is distributed throughout the bladder wall and is concentrated in the tegument of T. solium and T. crassiceps cysticerci. Expression analysis revealed that TcCu,Zn-SOD mRNA and protein expression levels do not change in cysticerci, even upon exposure to O(2)(-) (0-3.8 nmol/min) and H(2)O(2) (0-2mM), suggesting that this gene is constitutively expressed in these parasites.

Parra-Unda R; Vaca-Paniagua F; Jiménez L; Landa A

2012-01-01

113

Evaluating the Efficacy of Teaching Methods Regarding Prevention of Human Epilepsy Caused by Taenia solium Neurocysticercosis in Western Kenya  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium neurocysticercosis is a major cause of adult-onset epilepsy in developing countries. A questionnaire was administered to 282 Kenyan farmers, followed by a workshop, a second questionnaire, one-on-one training, and a third questionnaire. People who attended workshops were more likely to...

Wohlgemut, Jared; Dewey, Cate; Levy, Mike; Mutua, Florence

114

Progesterone Induces Scolex Evagination of the Human Parasite Taenia solium: Evolutionary Implications to the Host-Parasite Relationship  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is a health problem in underdeveloped and developed countries. Sex hormones are involved in cysticercosis prevalence in female and male pigs. Here, we evaluated the effects of progesterone and its antagonist RU486 on scolex evagination, which is the initial step in ...

Escobedo, Galileo; Camacho-Arroyo, Ignacio; Hernández-Hernández, Olivia Tania; Ostoa-Saloma, Pedro; García-Varela, Martín

115

Protein and Antigen Diversity in the Vesicular Fluid of Taenia Solium Cysticerci Dissected from Naturally Infected Pigs  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis caused by Taenia solium is a health threat for humans and pigs living in developing countries, for which there is neither a flawless immunodiagnostic test nor a totally effective vaccine. Suspecting of individual diversity of hosts and parasites as possible sources of the variations of...

Esquivel-Velázquez, Marcela; Larralde, Carlos; Morales, Julio; Ostoa-Saloma, Pedro

116

Taenia solium Cysticercosis in the Democratic Republic of Congo: How Does Pork Trade Affect the Transmission of the Parasite?  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium is a parasite that can affect both humans and pigs, causing important economic losses in pig production and being the main cause of acquired epilepsy in endemic areas. However, the parasite has been neglected in many African countries and particularly in the Democratic Republic of Cong...

Praet, Nicolas; Kanobana, Kirezi; Kabwe, Constantin; Maketa, Vivi; Lukanu, Philippe; Lutumba, Pascal; Polman, Katja

117

ELISA test for the diagnosis of cysticercosis in pigs using antigens of Taenia solium and Taenia crassiceps cysticerci  

Directory of Open Access Journals (Sweden)

Full Text Available In the present study ELISA was standardized for the diagnosis of swine cysticercosis based on necropsy parameters and confirmed positive and negative control sera. Serum samples from pigs with other infections were also assayed to determine possible cross-reactions. Four antigens were assayed: from Taenia crassiceps vesicular fluid (VF-Tcra) and crude larvae extract (T-Tcra), and from Taenia solium extracts of scolex (S-Ts) and of larvae (T-Ts). A checkerboard evaluation of antigen, serum and conjugate dilutions, as well as the use of Tween-20 and skim cow milk in wash and blocking solution had a marked effect on improving ELISA performance. All the antigens showed a good performance, but VF-Tcra was the best, with 96.0% and 80.0% sensitivities for cut-offs respectively at 2sd and 3sd, and corresponding specificities of 97.5% and 100.0%. Cross-reactivity was observed only with hydatidosis and ascaridiosis. In view of the high performance observed, the ELISA test should be recommended for the diagnosis of cysticercosis in suspected swine in slaughterhouses and for the screening of cysticercosis in swine production. These results will support integrated measures of cysticercosis control throughout the chain of swine production, effectively contributing to public health.

PINTO Paulo Sérgio de Arruda; VAZ Adelaide José; GERMANO Pedro Manuel Leal; NAKAMURA Paulo Mutuko

2000-01-01

118

Prevalence and associated risk factors of Taenia solium taeniasis in a rural pig farming community of north India.  

UK PubMed Central (United Kingdom)

There is a lack of information on the disease burden due to Taenia solium taeniasis and its associated risk factors in pig farming communities throughout the world. The present study was conducted in a rural pig farming community of north India to estimate the prevalence of T. solium taeniasis and associated factors. Demographic, clinical and epidemiological data were collected from 1181 subjects in 210 households in 30 villages. Stool specimens from 924 subjects were examined for eggs of Taenia and other parasites. Identification of T. solium was confirmed by morphological features of segments and species-specific DNA detection from segments and stool. The prevalence of T. solium taeniasis was 18.6% (172/924); factors associated with taeniasis on multivariate analysis were age above 15 years, history of passage of Taenia segments in stool, undercooked pork consumption and poor hand hygiene (hand-washing with clay/water after defecation). Seventy-eight subjects (6.6%) with epilepsy were identified. The study showed alarmingly high rates of epilepsy and T. solium taeniasis in the study community; it highlights the need for large-scale imaging-based surveys to identify the factors associated with epilepsy including neurocysticercosis. Health education, mass anthelminthic therapy and other preventive measures are required to control the menace of the disease.

Prasad KN; Prasad A; Gupta RK; Pandey CM; Singh U

2007-12-01

119

In Vitro Effects of Albendazole Sulfoxide and Praziquantel against Taenia solium and Taenia crassiceps Cysts  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We investigated the minimum exposure times of prazicuantel (PZQ) and albendazole sulfoxide (ABZSO) required for their activities against Taenia cysts in vitro as well as the 50 and 99% effective concentrations. The results showed that although the effects of both drugs are time and concentration dep...

Palomares, Francisca; Palencia, Guadalupe; Pérez, Rodolfo; González-Esquivel, Dinora; Castro, Nelly; Cook, Helgi Jung

120

Morphologic and Genetic Identification of Taenia Tapeworms in Tanzania and DNA Genotyping of Taenia solium  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Species identification of Taenia tapeworms was performed using morphologic observations and multiplex PCR and DNA sequencing of the mitochondrial cox1 gene. In 2008 and 2009, a total of 1,057 fecal samples were collected from residents of Kongwa district of Dodoma region, Tanzania, and examined micr...

Eom, Keeseon S.; Chai, Jong-Yil; Yong, Tai-Soon; Min, Duk-Young; Rim, Han-Jong; Kihamia, Charles; Jeon, Hyeong-Kyu

 
 
 
 
121

Progesterone induces mucosal immunity in a rodent model of human taeniosis by Taenia solium.  

UK PubMed Central (United Kingdom)

More than one quarter of human world's population is exposed to intestinal helminth parasites. The Taenia solium tapeworm carrier is the main risk factor in the transmission of both human neurocysticercosis and porcine cysticercosis. Sex steroids play an important role during T. solium infection, particularly progesterone has been proposed as a key immunomodulatory hormone involved in susceptibility to human taeniosis in woman and cysticercosis in pregnant pigs. Thus, we evaluated the effect of progesterone administration upon the experimental taeniosis in golden hamsters (Mesocricetus auratus). Intact female adult hamsters were randomly divided into 3 groups: progesterone-subcutaneously treated; olive oil-treated as the vehicle group; and untreated controls. Animals were treated every other day during 4 weeks. After 2 weeks of treatment, all hamsters were orally infected with 4 viable T. solium cysticerci. After 2 weeks post infection, progesterone-treated hamsters showed reduction in adult worm recovery by 80%, compared to both vehicle-treated and non-manipulated infected animals. In contrast to control and vehicle groups, progesterone treatment diminished tapeworm length by 75% and increased proliferation rate of leukocytes from spleen and mesenteric lymph nodes of infected hamsters by 5-fold. The latter exhibited high expression levels of IL-4, IL-6 and TNF-? at the duodenal mucosa, accompanied with polymorphonuclear leukocytes infiltration. These results support that progesterone protects hamsters from the T. solium adult tapeworm establishment by improving the intestinal mucosal immunity, suggesting a potential use of analogues of this hormone as novel inductors of the gut immune response against intestinal helminth infections and probably other bowel-related disorders.

Escobedo G; Camacho-Arroyo I; Nava-Luna P; Olivos A; Pérez-Torres A; Leon-Cabrera S; Carrero JC; Morales-Montor J

2011-01-01

122

Assessment of the social burden of Taenia solium Cysticercosis in Angonia District, Mozambique  

DEFF Research Database (Denmark)

Introduction: Taenia solium cysticercosis is a zoonosis of both public health and agricultural importance in many lowincome countries. This study aimed at estimating the societal burden of T. solium cysticercosis in Angonia district, Mozambique, an area highly endemic for the disease. Materials and Methods: Epidemiological data on human and porcine cysticercosis were collected from 2008 to 2009 in Angonia district, and made available for burden assessment. Study subjects were 1723 persons and 661 pigs. Methods included a questionnaire survey, Ag-ELISA detection of human and porcine cysticercosis and human brain computer tomography. All data were compiled in the software for statistical analysis ‘R’. To estimate the DALYs lost due to neurocysticercosis – associated epilepsy and headache a DALY calculator was used. To estimate the total costs a cost analysis model was used. Results: Approximately 5% and 0.8% of the total population of Angonia district was estimated to suffer from NCC-associated epilepsy and headache, respectively. Around two thirds of the diseased population never received any treatment. The estimates were based on reported prevalence of epilepsy and headache of 15.6% and 30.9%, respectively. Among people with reported epilepsy, 42.5% had NCC. The number of pigs diagnosed with cysticercosis corresponded to 35% of the total pig population. The estimated average number of DALYs lost due to NCC associated epilepsy and headache was 12.1 per thousand persons per year. The total annual costs due to T. solium cysticercosis were estimated at 1.3 million Euro of which 87% were costs linked to human cysticercosis and 13% were due to pig production losses. The annual monetary burden per case of NCC-associated epilepsy amounted at 51.0 Euro. Conclusions: Twelve DALYs per thousand persons per year and a cost of more than one million Euro per year makes T. solium cysticercosis a serious public health and agricultural threat for Angonia district.

Trevisan, Chiara; Praet, Nicolas

123

Progesterone Induces Mucosal Immunity in a Rodent Model of Human Taeniosis by Taenia solium  

Directory of Open Access Journals (Sweden)

Full Text Available More than one quarter of human world's population is exposed to intestinal helminth parasites. The Taenia solium tapeworm carrier is the main risk factor in the transmission of both human neurocysticercosis and porcine cysticercosis. Sex steroids play an important role during T. solium infection, particularly progesterone has been proposed as a key immunomodulatory hormone involved in susceptibility to human taeniosis in woman and cysticercosis in pregnant pigs. Thus, we evaluated the effect of progesterone administration upon the experimental taeniosis in golden hamsters (Mesocricetus auratus). Intact female adult hamsters were randomly divided into 3 groups: progesterone-subcutaneously treated; olive oil-treated as the vehicle group; and untreated controls. Animals were treated every other day during 4 weeks. After 2 weeks of treatment, all hamsters were orally infected with 4 viable T. solium cysticerci. After 2 weeks post infection, progesterone-treated hamsters showed reduction in adult worm recovery by 80%, compared to both vehicle-treated and non-manipulated infected animals. In contrast to control and vehicle groups, progesterone treatment diminished tapeworm length by 75% and increased proliferation rate of leukocytes from spleen and mesenteric lymph nodes of infected hamsters by 5-fold. The latter exhibited high expression levels of IL-4, IL-6 and TNF-? at the duodenal mucosa, accompanied with polymorphonuclear leukocytes infiltration. These results support that progesterone protects hamsters from the T. solium adult tapeworm establishment by improving the intestinal mucosal immunity, suggesting a potential use of analogues of this hormone as novel inductors of the gut immune response against intestinal helminth infections and probably other bowel-related disorders.

Galileo Escobedo, Ignacio Camacho-Arroyo, Paul Nava-Luna, Alfonso Olivos, Armando Pérez-Torres, Sonia Leon-Cabrera, J.C. Carrero, Jorge Morales-Montor

2011-01-01

124

Progesterone induces scolex evagination of the human parasite Taenia solium: evolutionary implications to the host-parasite relationship.  

UK PubMed Central (United Kingdom)

Taenia solium cysticercosis is a health problem in underdeveloped and developed countries. Sex hormones are involved in cysticercosis prevalence in female and male pigs. Here, we evaluated the effects of progesterone and its antagonist RU486 on scolex evagination, which is the initial step in the development of the adult worm. Interestingly, progesterone increased T. solium scolex evagination and worm growth, in a concentration-independent pattern. Progesterone effects could be mediated by a novel T. solium progesterone receptor (TsPR), since RU486 inhibits both scolex evagination and worm development induced by progesterone. Using RT-PCR and western blot, sequences related to progesterone receptor were detected in the parasite. A phylogenetic analysis reveals that TsPR is highly related to fish and amphibian progesterone receptors, whereas it has a distant relation with birds and mammals. Conclusively, progesterone directly acts upon T. solium cysticerci, possibly through its binding to a progesterone receptor synthesized by the parasite.

Escobedo G; Camacho-Arroyo I; Hernández-Hernández OT; Ostoa-Saloma P; García-Varela M; Morales-Montor J

2010-01-01

125

Progesterone Induces Scolex Evagination of the Human Parasite Taenia solium: Evolutionary Implications to the Host-Parasite Relationship  

Directory of Open Access Journals (Sweden)

Full Text Available Taenia solium cysticercosis is a health problem in underdeveloped and developed countries. Sex hormones are involved in cysticercosis prevalence in female and male pigs. Here, we evaluated the effects of progesterone and its antagonist RU486 on scolex evagination, which is the initial step in the development of the adult worm. Interestingly, progesterone increased T. solium scolex evagination and worm growth, in a concentration-independent pattern. Progesterone effects could be mediated by a novel T. solium progesterone receptor (TsPR), since RU486 inhibits both scolex evagination and worm development induced by progesterone. Using RT-PCR and western blot, sequences related to progesterone receptor were detected in the parasite. A phylogenetic analysis reveals that TsPR is highly related to fish and amphibian progesterone receptors, whereas it has a distant relation with birds and mammals. Conclusively, progesterone directly acts upon T. solium cysticerci, possibly through its binding to a progesterone receptor synthesized by the parasite.

Galileo Escobedo; Ignacio Camacho-Arroyo; Olivia Tania Hernández-Hernández; Pedro Ostoa-Saloma; Martín García-Varela; Jorge Morales-Montor

2010-01-01

126

ELISA test for the diagnosis of cysticercosis in pigs using antigens of Taenia solium and Taenia crassiceps cysticerci Teste ELISA para diagnóstico da cisticercose suína usando antígenos de larvas de Taenia solium e Taenia crassiceps  

Directory of Open Access Journals (Sweden)

Full Text Available In the present study ELISA was standardized for the diagnosis of swine cysticercosis based on necropsy parameters and confirmed positive and negative control sera. Serum samples from pigs with other infections were also assayed to determine possible cross-reactions. Four antigens were assayed: from Taenia crassiceps vesicular fluid (VF-Tcra) and crude larvae extract (T-Tcra), and from Taenia solium extracts of scolex (S-Ts) and of larvae (T-Ts). A checkerboard evaluation of antigen, serum and conjugate dilutions, as well as the use of Tween-20 and skim cow milk in wash and blocking solution had a marked effect on improving ELISA performance. All the antigens showed a good performance, but VF-Tcra was the best, with 96.0% and 80.0% sensitivities for cut-offs respectively at 2sd and 3sd, and corresponding specificities of 97.5% and 100.0%. Cross-reactivity was observed only with hydatidosis and ascaridiosis. In view of the high performance observed, the ELISA test should be recommended for the diagnosis of cysticercosis in suspected swine in slaughterhouses and for the screening of cysticercosis in swine production. These results will support integrated measures of cysticercosis control throughout the chain of swine production, effectively contributing to public health.Foi padronizado o teste ELISA para o diagnóstico da cisticercose suína. Após confirmação por exame post-mortem, os soros dos respectivos animais foram empregados como controles positivos e negativos. Soros de suínos portadores de infecções heterólogas foram ensaiados para determinação de reações cruzadas. Os quatro antígenos testados na fase de padronização foram líquido vesicular (VF) e extrato total (T) de larvas de Taenia crassiceps (Tcra) e de extrato de escólex (S) e de cisticercos (T) de Taenia solium (Tso). A titulação em bloco das ótimas concentrações de antígenos e diluições de soros e de conjugado, bem como o emprego de Tween-20 e de leite desnatado nas soluções bloqueadora e de lavagem exerceram nítida influência no desempenho do teste ELISA. Todos os antígenos revelaram bom desempenho na diferenciação entre soros positivos e negativos para cisticercose. O antígeno VF-Tcra apresentou as mais altas taxas de desempenho, seguido do T-Tcra. As taxas de desempenho para o antígeno VF-Tcra foram, respectivamente, para pontos de corte com 2sd e 3sd, de 96,0% e 80,0% para sensibilidade e de 97,5% e 100,0% para especificidade. Foi detectada reação cruzada com soros de hidatidose e de ascaridiose. Considerando o bom desempenho observado, o teste padronizado pode ser recomendado em matadouros no diagnóstico de animais suspeitos e no levantamento da ocorrência da doença nos segmentos de criação, sobretudo nos clandestinos, dando suporte às medidas de controle da cisticercose, integradas em toda a cadeia de produção da carne suína, exercendo efetiva contribuição à Saúde Pública.

Paulo Sérgio de Arruda PINTO; Adelaide José VAZ; Pedro Manuel Leal GERMANO; Paulo Mutuko NAKAMURA

2000-01-01

127

ELISA test for the diagnosis of cysticercosis in pigs using antigens of Taenia solium and Taenia crassiceps cysticerci/ Teste ELISA para diagnóstico da cisticercose suína usando antígenos de larvas de Taenia solium e Taenia crassiceps  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Foi padronizado o teste ELISA para o diagnóstico da cisticercose suína. Após confirmação por exame post-mortem, os soros dos respectivos animais foram empregados como controles positivos e negativos. Soros de suínos portadores de infecções heterólogas foram ensaiados para determinação de reações cruzadas. Os quatro antígenos testados na fase de padronização foram líquido vesicular (VF) e extrato total (T) de larvas de Taenia crassiceps (Tcra) e de extrato (more) de escólex (S) e de cisticercos (T) de Taenia solium (Tso). A titulação em bloco das ótimas concentrações de antígenos e diluições de soros e de conjugado, bem como o emprego de Tween-20 e de leite desnatado nas soluções bloqueadora e de lavagem exerceram nítida influência no desempenho do teste ELISA. Todos os antígenos revelaram bom desempenho na diferenciação entre soros positivos e negativos para cisticercose. O antígeno VF-Tcra apresentou as mais altas taxas de desempenho, seguido do T-Tcra. As taxas de desempenho para o antígeno VF-Tcra foram, respectivamente, para pontos de corte com 2sd e 3sd, de 96,0% e 80,0% para sensibilidade e de 97,5% e 100,0% para especificidade. Foi detectada reação cruzada com soros de hidatidose e de ascaridiose. Considerando o bom desempenho observado, o teste padronizado pode ser recomendado em matadouros no diagnóstico de animais suspeitos e no levantamento da ocorrência da doença nos segmentos de criação, sobretudo nos clandestinos, dando suporte às medidas de controle da cisticercose, integradas em toda a cadeia de produção da carne suína, exercendo efetiva contribuição à Saúde Pública. Abstract in english In the present study ELISA was standardized for the diagnosis of swine cysticercosis based on necropsy parameters and confirmed positive and negative control sera. Serum samples from pigs with other infections were also assayed to determine possible cross-reactions. Four antigens were assayed: from Taenia crassiceps vesicular fluid (VF-Tcra) and crude larvae extract (T-Tcra), and from Taenia solium extracts of scolex (S-Ts) and of larvae (T-Ts). A checkerboard evaluation (more) of antigen, serum and conjugate dilutions, as well as the use of Tween-20 and skim cow milk in wash and blocking solution had a marked effect on improving ELISA performance. All the antigens showed a good performance, but VF-Tcra was the best, with 96.0% and 80.0% sensitivities for cut-offs respectively at 2sd and 3sd, and corresponding specificities of 97.5% and 100.0%. Cross-reactivity was observed only with hydatidosis and ascaridiosis. In view of the high performance observed, the ELISA test should be recommended for the diagnosis of cysticercosis in suspected swine in slaughterhouses and for the screening of cysticercosis in swine production. These results will support integrated measures of cysticercosis control throughout the chain of swine production, effectively contributing to public health.

PINTO, Paulo Sérgio de Arruda; VAZ, Adelaide José; GERMANO, Pedro Manuel Leal; NAKAMURA, Paulo Mutuko

2000-04-01

128

Immunolocalization of TSOL18 and TSOL45-1A, the successful protective peptides against porcine cysticercosis, in Taenia solium oncospheres  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium life cycle includes humans as definitive hosts and pigs as intermediate hosts. One of the measures to stop the life cycle of this parasite is by vaccination of pigs. In experiments performed in pigs with TSOL18 and TSOL45-1A, two recombinant T. solium proteins, 99.5% and 97.0% protecti...

Martinez-Ocaña, Joel; Romero-Valdovinos, Mirza; de Kaminsky, Rina G; Maravilla, Pablo; Flisser, Ana

129

Genetic polymorphism in Taenia solium metacestodes from different Brazilian geographic areas  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english The aim of the present study is to investigate genetic polymorphisms in Taenia solium metacestodes from different Brazilian geographical areas and to relate them to antibody recognition in serum samples of neurocysticercosis (NC) patients. Metacestodes were obtained from the Distrito Federal (DF), Bahia, Minas Gerais (MG) and São Paulo (SP) regions of Brazil. Samples of human sera from 49 individuals with NC, 68 individuals with other helminthiasis and 40 healthy volunte (more) ers were analysed (157 individuals in total). Antigens were prepared and used in enzyme-linked immunosorbent assay and western blotting assays to detect specific immunoglobulin G antibodies. Genetic distances between metacestode populations were analysed using random amplified polymorphic DNA (RAPD) analysis. Our results show that there was a higher frequency of reactivity in the DF region in the sera from NC patients (p

Barcelos, Ivanildes Solange da Costa; Souza, Maria Aparecida; Pena, Janethe Deolinda de Oliveira; Machado, Gleyce Alves; Moura, Lísia Gomes Martins de; Costa-Cruz, Julia Maria

2012-02-01

130

Novel inhibitors to Taenia solium Cu/Zn superoxide dismutase identified by virtual screening.  

UK PubMed Central (United Kingdom)

We describe in this work a successful virtual screening and experimental testing aimed to the identification of novel inhibitors of superoxide dismutase of the worm Taenia solium (TsCu/Zn-SOD), a human parasite. Conformers from LeadQuest(®) database of drug-like compounds were selected and then docked on the surface of TsCu/Zn-SOD. Results were screened looking for ligand contacts with receptor side-chains not conserved in the human homologue, with a subsequent development of a score optimization by a set of energy minimization steps, aimed to identify lead compounds for in vitro experiments. Six out of fifty experimentally tested compounds showed ?M inhibitory activity toward TsCu/Zn-SOD. Two of them showed species selectivity since did not inhibit the homologous human enzyme when assayed in vitro.

García-Gutiérrez P; Landa-Piedra A; Rodríguez-Romero A; Parra-Unda R; Rojo-Domínguez A

2011-12-01

131

Anti-Taenia solium larval stage Ig G antibodies in patients with epileptic seizures.  

UK PubMed Central (United Kingdom)

BACKGROUND: Cysticercosis is the most common differential diagnosis for epilepsy. The present study was carried out to assess the serological response among patients with epileptic seizures visiting JIPMER Hospital Puducherry. MATERIALS AND METHODS: A total of 934 serum samples were collected from patients with epileptic seizures. A standardized questionnaire was designed to obtain information on the demographic, socioeconomic, environmental, and behavioral characteristics related to the transmission of infection. An enzyme-linked immunosorbent assay (ELISA) was used to detect the anti-Taenia solium larval stage IgG antibodies. Samples found reactive and inconclusive by ELISA were further tested by the enzyme immunotransfer blot (EITB). RESULTS: The frequency of antibodies in the serum samples of the above-mentioned population was 16.2% by EITB. Anti-Taenia solium larval stage antibodies were detected in serum samples of 163 patients, out of which 27 (16.56%) patients belonged to the 0 - 15-year age group, 82 (50.30%) patients were in the 16 - 40-year age group, and 52 (31.90%) patients were above 41 years, respectively. Although the sera from males had higher OD values than those from females, the difference was not statistically significant. Out of 163 seropositive by ELISA, 152 (93.25%) were found to be positive by EITB. Out of the 152, 61 (40.13%) were farmers and 79 (51.97%) were office or factory workers. CONCLUSIONS: In conclusion, the results indicate a probable endemic situation and a high prevalence of cysticercosis in patients with epileptic seizures. Living in poor sanitary conditions seems to be an important factor related to human cysticercosis in Puducherry and the neighboring districts of Tamil Nadu.

Parija SC; Raman GA

2011-01-01

132

Detecting spatial clusters of Taenia solium infections in a rural block in South India.  

UK PubMed Central (United Kingdom)

Neurocysticercosis (NCC) is a major cause of seizures/epilepsy in countries endemic for the disease. The objectives of this study were to spatially map the burden of active epilepsy (AE), NCC, taeniasis, seroprevalence for cysticercal antibodies and positivity to circulating cysticercal antigens in Kaniyambadi block (approximately 100 villages comprising 100 000 population) of Vellore district and to detect spatial clusters of AE, NCC, taeniasis and seroprevalence. Using geographic information system (GIS) techniques, all 21 study villages with over 8000 houses (population of 38 105) were mapped. Clustering of different indices of Taenia solium infection was determined using a spatial scan statistic (SaTScan). There was a primary spatial cluster of AE with a log likelihood ratio (LLR) of 10.8 and relative risk (RR) of 22.4; however, no significant clustering for NCC was detected. Five significant spatial clusters of seropositivity for cysticercal antibodies, two clusters of seropositivity for cysticercal antigens and one for taeniasis were detected (LLR of 8.35 and RR of 36.67). Our study has demonstrated the use of GIS methods in mapping and identifying 'hot spots' of various indices of T. solium infection in humans. This spatial analysis has identified pockets with high transmission rates so that preventive measures could be focused on an intensive scale.

Raghava MV; Prabhakaran V; Jayaraman T; Muliyil J; Oommen A; Dorny P; Vercruysse J; Rajshekhar V

2010-09-01

133

Some risk factors for Taenia solium cysticercosis in semi-intensively raised pigs in Zuru, Nigeria  

Directory of Open Access Journals (Sweden)

Full Text Available The prevalence of Taenia solium cysticercosis in live pigs and at post mortem was determined in the Zuru area of Kebbi State, Nigeria. Prevalence rates of 5.85% (n = 205) and 14.40% (n = 118), respectively, were obtained from live pigs examined by lingual palpation and post-mortem examination. There was a significant (p0.05) relationship between age and infectivity. Human taeniosis was assessed by direct microscopy of stool samples from volunteers; a prevalence of 8% (n = 50) was obtained. Environmental (soil, water and water from washed vegetables) samples were analysed; one of the water samples and some soil samples were positive for taeniid ova. Of the pig-rearing households that responded to the questionnaire survey 93% (n = 100) allow their pigs to scavenge freely around residential areas and refuse dumps, 2% had epileptic patients and over 80% did not have knowledge on how T. solium infection is acquired and its public health significance. To obtain baseline data for effective control and possible eradication, there is the need for a serological and epidemiological survey of this significant parasitic zoonosis in the study area and other parts of Nigeria where pigs are reared and/or pork is consumed.

Moses Gweba; Olufemi O. Faleke; Abdulkadir U. Junaidu; Joseph P. Fabiyi; Akinyemi O. Fajinmi

2010-01-01

134

Characterization of a monoclonal antibody that specifically inhibits triosephosphate isomerase activity of Taenia solium.  

Science.gov (United States)

In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile. PMID:23707345

Víctor, Sanabria-Ayala; Yolanda, Medina-Flores; Araceli, Zavala-Carballo; Lucía, Jiménez; Abraham, Landa

2013-05-21

135

Characterization of a monoclonal antibody that specifically inhibits triosephosphate isomerase activity of Taenia solium.  

UK PubMed Central (United Kingdom)

In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile.

Víctor SA; Yolanda MF; Araceli ZC; Lucía J; Abraham L

2013-08-01

136

Genetic polymorphism in Taenia solium metacestodes from different Brazilian geographic areas  

Directory of Open Access Journals (Sweden)

Full Text Available The aim of the present study is to investigate genetic polymorphisms in Taenia solium metacestodes from different Brazilian geographical areas and to relate them to antibody recognition in serum samples of neurocysticercosis (NC) patients. Metacestodes were obtained from the Distrito Federal (DF), Bahia, Minas Gerais (MG) and São Paulo (SP) regions of Brazil. Samples of human sera from 49 individuals with NC, 68 individuals with other helminthiasis and 40 healthy volunteers were analysed (157 individuals in total). Antigens were prepared and used in enzyme-linked immunosorbent assay and western blotting assays to detect specific immunoglobulin G antibodies. Genetic distances between metacestode populations were analysed using random amplified polymorphic DNA (RAPD) analysis. Our results show that there was a higher frequency of reactivity in the DF region in the sera from NC patients (p < 0.05), while discrimination between active and inactive NC was seen only in extracts from the MG and SP regions (p < 0.05). Using RAPD, the sample from the DF region presented a greater increase compared to the other regions. A relationship between genetic polymorphisms among T. solium metacestodes from different areas in Brazil and the differences in antibody detection in patients with NC were established.

Ivanildes Solange da Costa Barcelos; Maria Aparecida Souza; Janethe Deolinda de Oliveira Pena; Gleyce Alves Machado; Lísia Gomes Martins de Moura; Julia Maria Costa-Cruz

2012-01-01

137

Epidemiology and management of cysticercosis and Taenia solium taeniasis in Europe, systematic review 1990-2011.  

UK PubMed Central (United Kingdom)

BACKGROUND: Cysticercosis is caused by the invasion of human or pig tissues by the metacestode larval stage of Taenia solium. In Europe, the disease was endemic in the past but the autochthonous natural life cycle of the parasite is currently completed very rarely. Recently, imported cases have increased in parallel to the increased number of migrations and international travels. The lack of specific surveillance systems for cysticercosis leads to underestimation of the epidemiological and clinical impacts. OBJECTIVES: To review the available data on epidemiology and management of cysticercosis in Europe. METHODS: A review of literature on human cysticercosis and T. solium taeniasis in Europe published between 1990-2011 was conducted. RESULTS: Out of 846 cysticercosis cases described in the literature, 522 cases were autochthonous and 324 cases were imported. The majority (70.1%) of the autochthonous cases were diagnosed in Portugal from 1983 and 1994. Imported cases of which 242 (74.7%) diagnosed in migrants and 57 (17.6%) in European travellers, showed an increasing trend. Most of imported cases were acquired in Latin America (69.8% of migrants and 44.0% of travellers). The majority of imported cases were diagnosed in Spain (47.5%), France (16.7%) and Italy (8.3%). One third of neurosurgical procedures were performed because the suspected diagnosis was cerebral neoplasm. Sixty eight autochthonous and 5 imported T. solium taeniasis cases were reported. CONCLUSIONS: Cysticercosis remains a challenge for European care providers, since they are often poorly aware of this infection and have little familiarity in managing this disease. Cysticercosis should be included among mandatory reportable diseases, in order to improve the accuracy of epidemiological information. European health care providers might benefit from a transfer of knowledge from colleagues working in endemic areas and the development of shared diagnostic and therapeutic processes would have impact on the quality of the European health systems.

Zammarchi L; Strohmeyer M; Bartalesi F; Bruno E; Muñoz J; Buonfrate D; Nicoletti A; García HH; Pozio E; Bartoloni A

2013-01-01

138

Chinchilla laniger can be used as an experimental model for Taenia solium taeniasis.  

Science.gov (United States)

Chinchilla laniger has been reported as an experimental definitive host for Taenia solium; however no information about its suitability and yield of gravid tapeworm proglottids containing viable and infective eggs has been published. In total 55 outbred female chinchillas were infected with 4 cysticerci each; hosts were immunodeppressed with 6 or 8 mg of methyl-prednisolone acetate every 14 days starting the day of infection and their discomfort was followed. Kinetics of coproantigen ELISA or expelled proglottids was used to define the infection status. Efficiency of tapeworm establishment was 21% and of parasite gravidity was 8%; chinchillas showed some degree of suffering along the infection. Viability of eggs obtained from gravid proglottids was tested comparing methods previously published, our results showed 62% viability with propidium iodide, 54% with trypan blue, 34% with neutral red, 30% by oncosphere activation and 7% with bromide 3-(4,5-dimetil-tiazol-2-il)-2,5-difenil-tetrazolio (MTT) reduction; no statistical differences were obtained between most techniques, except activation. Four piglets were infected with 50,000 eggs each, necropsy was performed 3 months later and, after counting the number of cysticerci recovered, the percentage of infection was similar to data obtained with T. solium eggs recovered from humans. Our results demonstrate that the experimental model of T. solium taeniasis in C. laniger is a good alternative for providing eggs and adult tapeworms to be used in different types of experiments; optimization of the model probably depends on the use of inbred hosts and on the reduction of infected animals' suffering. PMID:21723412

Maravilla, Pablo; Garza-Rodriguez, Adriana; Gomez-Diaz, Benjamin; Jimenez-Gonzalez, Diego Emiliano; Toral-Bastida, Elizabeth; Martinez-Ocaña, Joel; West, Brett; Molina, Nadia; Garcia-Cortes, Ramon; Kawa-Karasik, Simon; Romero-Valdovinos, Mirza; Avila-Ramirez, Guillermina; Flisser, Ana

2011-06-24

139

Hygiene and restraint of pigs is associated with absence of Taenia solium cysticercosis in a rural community of Mexico  

Directory of Open Access Journals (Sweden)

Full Text Available Objective. To determine the prevalence and risk factors associated to pig cysticercosis in a rural community of Veracruz, Mexico. Material and Methods. Swine cysticercosis was diagnosed by tongue palpation and circulating antibodies in pigs kept in 178 household backyards. Risk factors were assessed by interviewing owners to collect information on pig breeding conditions and demographic characteristics. Results. None of the 53 pigs studied showed cysts in the tongue, nor antibodies against Taenia solium in Western blot assays. Latrines were available in 91% of the houses and pigs were kept in restrained areas. Conclusions. The present study shows that pig breeding under restraint with basic hygiene and sanitary conditions, may be effective and practical interventions to restrain Taenia solium in rural communities. The English version of this paper is available too at: http://www.insp.mx/salud/index.html

Vázquez-Flores Sonia; Ballesteros-Rodea Gilberto; Flisser Ana; Schantz Peter M.

2001-01-01

140

Efficacy of ivermectin and oxfendazole against Taenia solium cysticercosis and other parasitoses in naturally infected pigs.  

Science.gov (United States)

Smallholder semi-confined pig production is a fast growing practice in sub-Saharan Africa with an unfortunate outcome of high prevalence of Taenia solium cysticercosis and other parasitoses. The widely used anthelmintic for control of endo and ecto-parasites in pigs in the area is ivermectin at a recommended dose of 0.3mg/kg. This study was conducted to evaluate the efficacy and safety in pigs after subcutaneous injection of ivermectin (IVM, 0.3mg/kg) and orally administration of oxfendazole (OFZ, 30mg/kg) in treatment of porcine cysticercosis and other parasitoses in naturally infected pigs. A total of 61 pigs with T. solium cysticercosis (38 males and 23 females) as identified by tongue palpation with age ranging from 3 to 24 months were recruited. The pigs were stratified based on sex, age and number of cysts on the tongue and randomly allocated to IVM, OFZ and control groups. Three days before treatment and two weeks after treatment faecal samples and skin scrapings were taken to establish the burden of endo- and ectoparasites, respectively and the effect of the treatment. No adverse effect was observed in any of the treatment groups throughout the study period. Half of the pigs from each group were slaughtered at week four and the remaining half at week twelve post treatment. The IVM treatment group had no significant effect (p=0.224) on T. solium cysts viability in comparison to the control group. Significant effect on cysts viability was observed in the OFZ treated group (pAscaris suum, strongyles and Trichuris suis two weeks after treatment. At slaughter, Oesophagostomum dentatum, Ascarops strongylina and Physocephalus sexalatus were recovered from pigs in the IVM treated and in the control groups. Ivermectin was 100% effective in control of Sarcoptes scabiei. In conclusion, IVM at a single dose of 0.3mg/kg was efficacious against ectoparasites but did not effectively cure pigs from T. solium cysticercosis or nematodes. Oxfendazole, on the other hand, killed all nematodes and muscle cysts, but did not have any effect on ectoparasites. A combination of the two drugs would be a most useful treatment option for control of pig parasitoses in sub-Saharan Africa. PMID:23806569

Mkupasi, Ernatus Martin; Ngowi, Helena Aminiel; Sikasunge, Chummy Sikalizyo; Leifsson, Pall S; Johansen, Maria Vang

2013-06-24

 
 
 
 
141

Efficacy of ivermectin and oxfendazole against Taenia solium cysticercosis and other parasitoses in naturally infected pigs.  

UK PubMed Central (United Kingdom)

Smallholder semi-confined pig production is a fast growing practice in sub-Saharan Africa with an unfortunate outcome of high prevalence of Taenia solium cysticercosis and other parasitoses. The widely used anthelmintic for control of endo and ecto-parasites in pigs in the area is ivermectin at a recommended dose of 0.3mg/kg. This study was conducted to evaluate the efficacy and safety in pigs after subcutaneous injection of ivermectin (IVM, 0.3mg/kg) and orally administration of oxfendazole (OFZ, 30mg/kg) in treatment of porcine cysticercosis and other parasitoses in naturally infected pigs. A total of 61 pigs with T. solium cysticercosis (38 males and 23 females) as identified by tongue palpation with age ranging from 3 to 24 months were recruited. The pigs were stratified based on sex, age and number of cysts on the tongue and randomly allocated to IVM, OFZ and control groups. Three days before treatment and two weeks after treatment faecal samples and skin scrapings were taken to establish the burden of endo- and ectoparasites, respectively and the effect of the treatment. No adverse effect was observed in any of the treatment groups throughout the study period. Half of the pigs from each group were slaughtered at week four and the remaining half at week twelve post treatment. The IVM treatment group had no significant effect (p=0.224) on T. solium cysts viability in comparison to the control group. Significant effect on cysts viability was observed in the OFZ treated group (p<0.001) compared to IVM and control groups in all muscle tissues. Regarding to brain cysts, neither of the drugs was efficacious. Ivermectin and OFZ treatments significantly reduced (p<0.001) the faecal egg count of Ascaris suum, strongyles and Trichuris suis two weeks after treatment. At slaughter, Oesophagostomum dentatum, Ascarops strongylina and Physocephalus sexalatus were recovered from pigs in the IVM treated and in the control groups. Ivermectin was 100% effective in control of Sarcoptes scabiei. In conclusion, IVM at a single dose of 0.3mg/kg was efficacious against ectoparasites but did not effectively cure pigs from T. solium cysticercosis or nematodes. Oxfendazole, on the other hand, killed all nematodes and muscle cysts, but did not have any effect on ectoparasites. A combination of the two drugs would be a most useful treatment option for control of pig parasitoses in sub-Saharan Africa.

Mkupasi EM; Ngowi HA; Sikasunge CS; Leifsson PS; Johansen MV

2013-10-01

142

Immune response to different fractions of Taenia solium cyst fluid antigens in patients with neurocysticercosis.  

UK PubMed Central (United Kingdom)

The immunopathogenesis of neurocysticercosis (NCC) largely remains unknown. We analyzed the immune response to different fractions of Taenia solium cyst fluid antigens in patients with NCC. Lymphocytes were separated from 48 patients with NCC-related active epilepsy and 30 healthy controls. T. solium (isolated from pig muscles) antigens (crude lysate, CL; cyst wall, CW and cyst fluid, CF) at 20 ?g/well concentrations were used to stimulate the cells in a lymphocyte transformation test (LTT). Only CF antigen stimulated cell proliferation significantly greater than control (p<0.001), hence cyst fluid antigens were further studied. The CF antigens were electro-blotted on nitrocellulose membrane (NC), cut at 0.5 cm distance and particulate antigens were prepared. A total of 12 fractions, designated F1 to F12 according to molecular weight were tested in-vitro for LTT. After 72 h of stimulation by the different fractions, Th1 (IL-1?, TNF-?, IL-2) and Th2 (IL-4, IL-10) cytokine responses were determined in culture supernatants by ELISA. Low molecular weight fractions F1 through F4 (Mol. wt.<25 kDa) were found to be potent inducers of cytokines. Fractions F1, F3 and F4 induced the production of Th1 (IL-1?, TNF-?, IL-2), whereas F2 induced the production of Th2 (IL-4 and IL-10) cytokine. The study shows that the low molecular weight fractions of CF antigens are immuno-dominant. Most of these fractions (F1, F3, F4) induce strong Th1 immune response except F2 which induces Th2 response. Further studies are needed to identify the different antigens present in these fractions to determine the molecules responsible for the immune response.

Amit P; Prasad KN; Kumar GR; Shweta T; Sanjeev J; Kumar PV; Mukesh T

2011-03-01

143

Detection of Taenia solium taeniasis coproantigen is an early indicator of treatment failure for taeniasis.  

UK PubMed Central (United Kingdom)

Taenia solium causes taeniasis and cysticercosis, a zoonotic complex associated with a significant burden of epilepsy in most countries. Reliable diagnosis and efficacious treatment of taeniasis are needed for disease control. Currently, cure can be confirmed only after a period of at least 1 month, by negative stool microscopy. This study assessed the performance of detection by a coproantigen enzyme-linked immunosorbent assay (CoAg-ELISA) for the early evaluation of the efficacy of antiparasitic treatment of human T. solium taeniasis. We followed 69 tapeworm carriers who received niclosamide as standard treatment. Stool samples were collected on days 1, 3, 7, 15, 30, and 90 after treatment and were processed by microscopy and CoAg-ELISA. The efficacy of niclosamide was 77.9% (53/68). Thirteen patients received a second course of treatment and completed the follow-up. CoAg-ELISA was therefore evaluated for a total of 81 cases (68 treatments, 13 retreatments). In successful treatments (n = 64), the proportion of patients who became negative by CoAg-ELISA was 62.5% after 3 days, 89.1% after 7 days, 96.9% after 15 days, and 100% after 30 days. In treatment failures (n = 17), the CoAg-ELISA result was positive for 70.6% of patients after 3 days, 94.1% after 7 days, and 100% after 15 and 30 days. Only 2 of 17 samples in cases of treatment failure became positive by microscopy by day 30. The presence of one scolex, but not multiple scolices, in posttreatment stools was strongly associated with cure (odds ratio [OR], 52.5; P < 0.001). CoAg-ELISA is useful for the assessment of treatment failure in taeniasis. Early assessment at day 15 would detect treatment failure before patients become infective.

Bustos JA; Rodriguez S; Jimenez JA; Moyano LM; Castillo Y; Ayvar V; Allan JC; Craig PS; Gonzalez AE; Gilman RH; Tsang VC; Garcia HH

2012-04-01

144

Detection of Taenia solium taeniasis coproantigen is an early indicator of treatment failure for taeniasis.  

Science.gov (United States)

Taenia solium causes taeniasis and cysticercosis, a zoonotic complex associated with a significant burden of epilepsy in most countries. Reliable diagnosis and efficacious treatment of taeniasis are needed for disease control. Currently, cure can be confirmed only after a period of at least 1 month, by negative stool microscopy. This study assessed the performance of detection by a coproantigen enzyme-linked immunosorbent assay (CoAg-ELISA) for the early evaluation of the efficacy of antiparasitic treatment of human T. solium taeniasis. We followed 69 tapeworm carriers who received niclosamide as standard treatment. Stool samples were collected on days 1, 3, 7, 15, 30, and 90 after treatment and were processed by microscopy and CoAg-ELISA. The efficacy of niclosamide was 77.9% (53/68). Thirteen patients received a second course of treatment and completed the follow-up. CoAg-ELISA was therefore evaluated for a total of 81 cases (68 treatments, 13 retreatments). In successful treatments (n = 64), the proportion of patients who became negative by CoAg-ELISA was 62.5% after 3 days, 89.1% after 7 days, 96.9% after 15 days, and 100% after 30 days. In treatment failures (n = 17), the CoAg-ELISA result was positive for 70.6% of patients after 3 days, 94.1% after 7 days, and 100% after 15 and 30 days. Only 2 of 17 samples in cases of treatment failure became positive by microscopy by day 30. The presence of one scolex, but not multiple scolices, in posttreatment stools was strongly associated with cure (odds ratio [OR], 52.5; P < 0.001). CoAg-ELISA is useful for the assessment of treatment failure in taeniasis. Early assessment at day 15 would detect treatment failure before patients become infective. PMID:22336287

Bustos, Javier A; Rodriguez, Silvia; Jimenez, Juan A; Moyano, Luz M; Castillo, Yesenia; Ayvar, Viterbo; Allan, James C; Craig, Philip S; Gonzalez, Armando E; Gilman, Robert H; Tsang, Victor C W; Garcia, Hector H

2012-02-15

145

Fatty acid compositions of Taenia solium metacestode and its surrounding tissues.  

UK PubMed Central (United Kingdom)

Fatty acids (FAs) are the main energy sources of living organisms and are the major components of cellular and organelle membranes. Their compositions also affect the flexibility/rigidity of cells and cell vitality. The Taenia solium metacestode (TsM) causes neurocysticercosis (NC), which is one of the most common helminthic infections of the central nerve system. We investigated the FA composition of the cyst fluid (CF) and parenchyma of the TsM, together with those of the granuloma and swine tissue surrounding the granuloma. The FA fractions of the TsM CF and swine tissue showed a composition and proportional contents comparable to each other, in which C18:0 (stearic acid), C18:1n9c (oleic acid), C20:4 (arachidonic acid) and C16:0 (palmitic acid) constituted the major fractions. However, the relative amount of individual FAs of the TsM parenchyma and granuloma differed from those of TsM CF and swine tissue, which contained enriched C16:0 and a lower amount of C20:4. Saturated FAs were the major constituents in parenchyma and granuloma, 50.4% and 46.1%, respectively. Conversely, monounsaturated FAs were the major constituents of CF and swine tissue, 38.7% and 40.3%, respectively. Our results strongly suggest that host-derived FAs might translocate across the parasite syncytial membrane and be stored in the CF.

Kim SH; Bae YA; Nam JS; Yang Y; Nawa Y; Kong Y

2013-02-01

146

Relationship between serum antibodies and Taenia solium larvae burden in pigs raised in field conditions.  

UK PubMed Central (United Kingdom)

BACKGROUND: Serological tests have been used for the diagnosis of Taenia solium infection in pigs. However, those serological results do not necessarily correlate with the actual infection burden after performing pig necropsy. This study aimed to evaluate the Electro Immuno Transfer Blot (EITB) seropositivity with infection burden in naturally infected pigs. METHODOLOGY/PRINCIPAL FINDINGS: In an endemic area of Peru, 476 pigs were sampled. Seroprevalence was 60.5 ± 4.5% with a statistically higher proportion of positive older pigs (>8 months) than young pigs. The logistic model showed that pigs >8 month of age were 2.5 times more likely to be EITB-positive than ? 8 months. A subset of 84 seropositive pigs were necropsied, with 45.2% (38/84) positive to 1-2 bands, 46.4% (39/84) to 3 bands, and 8.3% (7/84) to 4+ bands. 41 out of 84 positive pigs were negative to necropsy (48.8%) and 43 (51%) had one or more cysts (positive predictive value). Older pigs showed more moderate and heavy infection burdens compared to younger pigs. In general, regardless of the age of the pig, the probability of having more cysts (parasite burden) increases proportionally with the number of EITB bands. CONCLUSIONS/SIGNIFICANCE: The probability of being necropsy-positive increased with the number of bands, and age. Therefore, the EITB is a measure of exposure rather than a test to determine the real prevalence of cysticercosis infection.

Gavidia CM; Verastegui MR; Garcia HH; Lopez-Urbina T; Tsang VC; Pan W; Gilman RH; Gonzalez AE

2013-05-01

147

Relationship between Serum Antibodies and Taenia solium Larvae Burden in Pigs Raised in Field Conditions  

Science.gov (United States)

Background Serological tests have been used for the diagnosis of Taenia solium infection in pigs. However, those serological results do not necessarily correlate with the actual infection burden after performing pig necropsy. This study aimed to evaluate the Electro Immuno Transfer Blot (EITB) seropositivity with infection burden in naturally infected pigs. Methodology/Principal Findings In an endemic area of Peru, 476 pigs were sampled. Seroprevalence was 60.5±4.5% with a statistically higher proportion of positive older pigs (>8 months) than young pigs. The logistic model showed that pigs >8 month of age were 2.5 times more likely to be EITB-positive than ?8 months. A subset of 84 seropositive pigs were necropsied, with 45.2% (38/84) positive to 1–2 bands, 46.4% (39/84) to 3 bands, and 8.3% (7/84) to 4+ bands. 41 out of 84 positive pigs were negative to necropsy (48.8%) and 43 (51%) had one or more cysts (positive predictive value). Older pigs showed more moderate and heavy infection burdens compared to younger pigs. In general, regardless of the age of the pig, the probability of having more cysts (parasite burden) increases proportionally with the number of EITB bands. Conclusions/Significance The probability of being necropsy-positive increased with the number of bands, and age. Therefore, the EITB is a measure of exposure rather than a test to determine the real prevalence of cysticercosis infection.

Gavidia, Cesar M.; Verastegui, Manuela R.; Garcia, Hector H.; Lopez-Urbina, Teresa; Tsang, Victor C. W.; Pan, William; Gilman, Robert H.; Gonzalez, Armando E.

2013-01-01

148

Efficacy and Safety of Anthelmintics Tested against Taenia solium Cysticercosis in Pigs.  

UK PubMed Central (United Kingdom)

Porcine cysticercosis, an infection caused by Taenia solium metacestodes, is continuously being reported in low-income countries of Latin America, Asia, and sub-Saharan Africa. The disease was declared eradicable by the International Task Force for Diseases Eradication (ITFDE) in 1993, and it is listed among the 17 WHO Neglected Tropical Diseases and Neglected Zoonoses that are potentially eradicable. In view of that, WHO has proposed a step-wise approach to its elimination, including chemotherapy of infected pigs. Different drugs have been tested on porcine cysticercosis with varying efficacies. These include flubendazole, fenbendazole, albendazole, albendazole sulphoxide, oxfendazole, praziquantel, and nitazoxanide. This review summarises available information on the efficacies and adverse effects shown by these drugs in pigs. Oxfendazole has shown to be effective for the control of porcine cysticercosis; however, it needs to be integrated with other control approaches. There is a need for standardised guidelines for evaluating the efficacy of anthelmintics against porcine cysticercosis, and more efficacy studies are needed since the conclusions so far are based on a limited number of studies using few infected pigs.

Mkupasi EM; Sikasunge CS; Ngowi HA; Johansen MV

2013-07-01

149

Efficacy and Safety of Anthelmintics Tested against Taenia solium Cysticercosis in Pigs.  

Science.gov (United States)

Porcine cysticercosis, an infection caused by Taenia solium metacestodes, is continuously being reported in low-income countries of Latin America, Asia, and sub-Saharan Africa. The disease was declared eradicable by the International Task Force for Diseases Eradication (ITFDE) in 1993, and it is listed among the 17 WHO Neglected Tropical Diseases and Neglected Zoonoses that are potentially eradicable. In view of that, WHO has proposed a step-wise approach to its elimination, including chemotherapy of infected pigs. Different drugs have been tested on porcine cysticercosis with varying efficacies. These include flubendazole, fenbendazole, albendazole, albendazole sulphoxide, oxfendazole, praziquantel, and nitazoxanide. This review summarises available information on the efficacies and adverse effects shown by these drugs in pigs. Oxfendazole has shown to be effective for the control of porcine cysticercosis; however, it needs to be integrated with other control approaches. There is a need for standardised guidelines for evaluating the efficacy of anthelmintics against porcine cysticercosis, and more efficacy studies are needed since the conclusions so far are based on a limited number of studies using few infected pigs. PMID:23936558

Mkupasi, Ernatus Martin; Sikasunge, Chummy Sikalizyo; Ngowi, Helena Aminiel; Johansen, Maria Vang

2013-07-25

150

Histological and ultrastructural localization of antigen B in the metacestode of Taenia solium  

Energy Technology Data Exchange (ETDEWEB)

The morphological localization of antigen B (AgB) in the tissues of the Taenia solium metacestode was studied by immunological and biochemical methods. Indirect immunofluorescence carried out on vibratome sections showed that AgB is widely distributed throughout the tissue. A more intense fluorescence was observed in the tegumentary cytons of the bladder wall and in the lumen of the spiral canal of the invaginated scolex. Ultrastructural analysis of larvae washed in PBS after dissection from meat and then incubated with rabbit antibodies against AgB, followed by peroxidase-labeled goat anti-rabbit IgG, did not exhibit electron-dense material on the external surface. Larvae fixed in glutaraldehyde immediately after dissection and exposed to the immunoperoxidase reagents did exhibit electron-dense material on microtriches, indicating that AgB is only loosely bound to the external surface. Crude extracts of surface-radioiodinated cysticerci analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) contained no labeled proteins with the molecular weight of AgB. Autoradiography of the immunoelectrophoretograms in which the crude extract was confronted with antibodies to AgB demonstrated that this antigen was not labeled, and therefore is not exposed on the tegumentary surface. The results suggest that AgB is synthesized by the tegumentary cytons of the parasite and secreted through the tegumental membrane into the host tissues and the lumen of the spiral canal.

Laclette, J.P.; Merchant, M.T.; Willms, K.

1987-02-01

151

Transcriptome analysis of Taenia solium cysticerci using Open Reading Frame ESTs (ORESTES)  

Directory of Open Access Journals (Sweden)

Full Text Available Abstract Background Human infection by the pork tapeworm Taenia solium affects more than 50 million people worldwide, particularly in underdeveloped and developing countries. Cysticercosis which arises from larval encystation can be life threatening and difficult to treat. Here, we investigate for the first time the transcriptome of the clinically relevant cysticerci larval form. Results Using Expressed Sequence Tags (ESTs) produced by the ORESTES method, a total of 1,520 high quality ESTs were generated from 20 ORESTES cDNA mini-libraries and its analysis revealed fragments of genes with promising applications including 51 ESTs matching antigens previously described in other species, as well as 113 sequences representing proteins with potential extracellular localization, with obvious applications for immune-diagnosis or vaccine development. Conclusion The set of sequences described here will contribute to deciphering the expression profile of this important parasite and will be informative for the genome assembly and annotation, as well as for studies of intra- and inter-specific sequence variability. Genes of interest for developing new diagnostic and therapeutic tools are described and discussed.

Almeida Carolina R; Stoco Patricia H; Wagner Glauber; Sincero Thaís CM; Rotava Gianinna; Bayer-Santos Ethel; Rodrigues Juliana B; Sperandio Maísa M; Maia Antônio AM; Ojopi Elida PB; Zaha Arnaldo; Ferreira Henrique B; Tyler Kevin M; Dávila Alberto MR; Grisard Edmundo C; Dias-Neto Emmanuel

2009-01-01

152

Histological and ultrastructural localization of antigen B in the metacestode of Taenia solium  

International Nuclear Information System (INIS)

The morphological localization of antigen B (AgB) in the tissues of the Taenia solium metacestode was studied by immunological and biochemical methods. Indirect immunofluorescence carried out on vibratome sections showed that AgB is widely distributed throughout the tissue. A more intense fluorescence was observed in the tegumentary cytons of the bladder wall and in the lumen of the spiral canal of the invaginated scolex. Ultrastructural analysis of larvae washed in PBS after dissection from meat and then incubated with rabbit antibodies against AgB, followed by peroxidase-labeled goat anti-rabbit IgG, did not exhibit electron-dense material on the external surface. Larvae fixed in glutaraldehyde immediately after dissection and exposed to the immunoperoxidase reagents did exhibit electron-dense material on microtriches, indicating that AgB is only loosely bound to the external surface. Crude extracts of surface-radioiodinated cysticerci analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) contained no labeled proteins with the molecular weight of AgB. Autoradiography of the immunoelectrophoretograms in which the crude extract was confronted with antibodies to AgB demonstrated that this antigen was not labeled, and therefore is not exposed on the tegumentary surface. The results suggest that AgB is synthesized by the tegumentary cytons of the parasite and secreted through the tegumental membrane into the host tissues and the lumen of the spiral canal

1987-01-01

153

Fatty acid compositions of Taenia solium metacestode and its surrounding tissues.  

Science.gov (United States)

Fatty acids (FAs) are the main energy sources of living organisms and are the major components of cellular and organelle membranes. Their compositions also affect the flexibility/rigidity of cells and cell vitality. The Taenia solium metacestode (TsM) causes neurocysticercosis (NC), which is one of the most common helminthic infections of the central nerve system. We investigated the FA composition of the cyst fluid (CF) and parenchyma of the TsM, together with those of the granuloma and swine tissue surrounding the granuloma. The FA fractions of the TsM CF and swine tissue showed a composition and proportional contents comparable to each other, in which C18:0 (stearic acid), C18:1n9c (oleic acid), C20:4 (arachidonic acid) and C16:0 (palmitic acid) constituted the major fractions. However, the relative amount of individual FAs of the TsM parenchyma and granuloma differed from those of TsM CF and swine tissue, which contained enriched C16:0 and a lower amount of C20:4. Saturated FAs were the major constituents in parenchyma and granuloma, 50.4% and 46.1%, respectively. Conversely, monounsaturated FAs were the major constituents of CF and swine tissue, 38.7% and 40.3%, respectively. Our results strongly suggest that host-derived FAs might translocate across the parasite syncytial membrane and be stored in the CF. PMID:22971473

Kim, Seon-Hee; Bae, Young-An; Nam, Jin-Sik; Yang, Yichao; Nawa, Yukifumi; Kong, Yoon

2012-08-29

154

Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography  

Directory of Open Access Journals (Sweden)

Full Text Available The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene) ethanol Triton X-114 (TX-114) partitioning in the diagnosis of human neurocysticercosis (NCC). Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound ) fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound ) and aqueous (AJ unbound ) fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot.

Gleyce Alves Machado; Heliana Batista de Oliveira; Margareth Leitão Gennari-Cardoso; José Roberto Mineo; Julia Maria Costa-Cruz

2013-01-01

155

Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography.  

UK PubMed Central (United Kingdom)

The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene) ethanol Triton X-114 (TX-114) partitioning in the diagnosis of human neurocysticercosis (NCC). Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound ) fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound ) and aqueous (AJ unbound ) fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot.

Machado GA; Oliveira HB; Gennari-Cardoso ML; Mineo JR; Costa-Cruz JM

2013-05-01

156

Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene) ethanol Triton X-114 (TX-114) partitioning in the diagnosis of human neurocysticercosis (NCC). Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as (more) follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound ) fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound ) and aqueous (AJ unbound ) fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot.

Machado, Gleyce Alves; Oliveira, Heliana Batista de; Gennari-Cardoso, Margareth Leitão; Mineo, José Roberto; Costa-Cruz, Julia Maria

2013-05-01

157

A cross-sectional study of Taenia solium in a multiple taeniid-endemic region reveals competition may be protective.  

UK PubMed Central (United Kingdom)

We conducted cross-sectional surveys for taeniasis and cysticercosis in humans, pigs, and dogs in four northern provinces of Laos. Human cysticercosis and taeniasis prevalence was 2.2% (95% confidence interval [CI] = 1.4-3.0%) and 8.4% (95% CI = 6.9-9.9%), respectively. Eating uncooked beef, being male, province of residence, age, and ethnicity were significant risk factors for taeniasis and only province of residence was a significant risk factor for cystiercosis. Thirty-five human tapeworms were recovered during the survey and 33 (94.3%) and 2 (5.7%) were identified as Taenia saginata and T. solium, respectively. Maximum-likelihood adjusted prevalence of T. solium and T. hydatigena in pigs was 4.2% (95% CI = 0.5-7.9%) and 55.9% (95% CI = 47.5-64.3%), respectively, and T. hydatigena taeniasis in dogs was 4.8% (95% CI = 0.0-11.3%). Taenia hydatigena and T. saginata were the most prevalent taeniids in the respective pig and human populations and together may suppress T. solium transmission.

Conlan JV; Vongxay K; Khamlome B; Dorny P; Sripa B; Elliot A; Blacksell SD; Fenwick S; Thompson RC

2012-08-01

158

A cross-sectional study of Taenia solium in a multiple taeniid-endemic region reveals competition may be protective.  

Science.gov (United States)

We conducted cross-sectional surveys for taeniasis and cysticercosis in humans, pigs, and dogs in four northern provinces of Laos. Human cysticercosis and taeniasis prevalence was 2.2% (95% confidence interval [CI] = 1.4-3.0%) and 8.4% (95% CI = 6.9-9.9%), respectively. Eating uncooked beef, being male, province of residence, age, and ethnicity were significant risk factors for taeniasis and only province of residence was a significant risk factor for cystiercosis. Thirty-five human tapeworms were recovered during the survey and 33 (94.3%) and 2 (5.7%) were identified as Taenia saginata and T. solium, respectively. Maximum-likelihood adjusted prevalence of T. solium and T. hydatigena in pigs was 4.2% (95% CI = 0.5-7.9%) and 55.9% (95% CI = 47.5-64.3%), respectively, and T. hydatigena taeniasis in dogs was 4.8% (95% CI = 0.0-11.3%). Taenia hydatigena and T. saginata were the most prevalent taeniids in the respective pig and human populations and together may suppress T. solium transmission. PMID:22855759

Conlan, James V; Vongxay, Khamphouth; Khamlome, Boualam; Dorny, Pierre; Sripa, Banchob; Elliot, Aileen; Blacksell, Stuart D; Fenwick, Stanley; Thompson, R C Andrew

2012-08-01

159

Protein and Antigen Diversity in the Vesicular Fluid of Taenia Solium Cysticerci Dissected from Naturally Infected Pigs  

Directory of Open Access Journals (Sweden)

Full Text Available Cysticercosis caused by Taenia solium is a health threat for humans and pigs living in developing countries, for which there is neither a flawless immunodiagnostic test nor a totally effective vaccine. Suspecting of individual diversity of hosts and parasites as possible sources of the variations of the parasite loads among cysticercotic animals and of the limited success of such immunological applications as well as, we explored and measured both in nine cases of naturally acquired porcine cysticercosis. For this purpose, 2-Dimensional IgG immunoblots were performed by reacting the sera of each cysticercotic pig with the antigens contained in the vesicular fluid (VF) of their own cysticerci. We found an unexpectedly large diversity among the proteins and antigens contained in each of the nine VFs. Also diverse were the serum IgG antibody responses of the nine pigs, as none of their 2D- immunoblot images exhibited the same number of spots and resembled each other in only 6.3% to 65.3% of their features. So large an individual immunological diversity of the cysticercal antigens and of the infected pigs´ IgG antibody response should be taken into account in the design of immunological tools for diagnosis and prevention of cysticercosis and should also be considered as a possibly significant source of diversity in Taenia solium´s infectiveness and pathogenicity.

Marcela Esquivel-Velázquez, Carlos Larralde, Julio Morales, Pedro Ostoa-Saloma

2011-01-01

160

Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography.  

Science.gov (United States)

The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene) ethanol Triton X-114 (TX-114) partitioning in the diagnosis of human neurocysticercosis (NCC). Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound ) fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound ) and aqueous (AJ unbound ) fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot. PMID:23778661

Machado, Gleyce Alves; Oliveira, Heliana Batista de; Gennari-Cardoso, Margareth Leitão; Mineo, José Roberto; Costa-Cruz, Julia Maria

2013-05-01

 
 
 
 
161

Seroprevalence of antibodies (IgG) to Taenia solium among pig rearers and associated risk factors in Jos metropolis, Nigeria.  

UK PubMed Central (United Kingdom)

INTRODUCTION: In Nigeria, Taenia solium cysticercosis is a problem in rural areas where most pigs are kept and in urban areas where infected pork can be consumed. METHODOLOGY: We performed enzyme linked immunosorbent assays on serum samples collected from pig rearers in Jos, Nigeria, to determine the prevalence of IgG antibodies. RESULTS: Of 125 subjects tested, 12 (9.6%) were positive for T. solium. Seroprevalence did not differ significantly (P>0.05) according to education, age, occupation, study location, gender or whether the subjects consumed pork. However, a statistical difference (P<0.05) in seroprevalence was observed according to type and availability of toilet used, personal hygiene after using the toilet, and type of pig management practiced. Females were about two times more likely to be seroprevalent than males (OR=1.7; 95% CI= 0.43-6.67; P=0.4) and subjects who consumed pork were four times more likely to have anti T. solium antibodies than those who did not eat pork (OR=4.2; 95%CI=0.52-33.57; P=0.2). Those who defecated in the bush were 8.3 times more likely to suffer from T. solium infection than those who used water system toilets (OR=8.3; 95%CI=1.56-43.7; P=0.01). Subjects who did not wash their hands after defecating were 6 times more likely to contract T. solium compared to those who washed their hands with water (OR=5.5; 95% CI=1.39-21.89; P=0.01). CONCLUSIONS: Our results show that using a toilet and practicing good personal hygiene can reduce cases of T. solium infection in a community.

Rebecca WP; Eugene II; Joshua K

2013-02-01

162

Genotoxicity induced by Taenia solium and its reduction by immunization with calreticulin in a hamster model of taeniosis.  

Science.gov (United States)

Genotoxicity induced by neurocysticercosis has been demonstrated in vitro and in vivo in humans. The adult stage of Taenia solium lodges in the small intestine and is the main risk factor to acquire neurocysticercosis, nevertheless its carcinogenic potential has not been evaluated. In this study, we determined the genotoxic effect of T. solium infection in the hamster model of taeniosis. In addition, we assessed the effect of oral immunization with recombinant T. solium calreticulin (rTsCRT) plus cholera toxin as adjuvant on micronuclei induction, as this protein has been shown to induce 33-44% protection in the hamster model of taeniosis. Blood samples were collected from the orbital venous plexus of noninfected and infected hamsters at different days postinfection, as well as from orally immunized animals, to evaluate the frequency of micronucleated reticulocytes as a measure of genotoxicity induced by parasite exposure and rTsCRT vaccination. Our results indicate that infection with T. solium caused time-dependent DNA damage in vivo and that rTsCRT immunization reduced the genotoxic damage induced by the presence of the tapeworms. PMID:23704053

Salazar, Ana María; Mendlovic, Fela; Cruz-Rivera, Mayra; Chávez-Talavera, Oscar; Sordo, Monserrat; Avila, Guillermina; Flisser, Ana; Ostrosky-Wegman, Patricia

2013-05-24

163

Genotoxicity induced by Taenia solium and its reduction by immunization with calreticulin in a hamster model of taeniosis.  

UK PubMed Central (United Kingdom)

Genotoxicity induced by neurocysticercosis has been demonstrated in vitro and in vivo in humans. The adult stage of Taenia solium lodges in the small intestine and is the main risk factor to acquire neurocysticercosis, nevertheless its carcinogenic potential has not been evaluated. In this study, we determined the genotoxic effect of T. solium infection in the hamster model of taeniosis. In addition, we assessed the effect of oral immunization with recombinant T. solium calreticulin (rTsCRT) plus cholera toxin as adjuvant on micronuclei induction, as this protein has been shown to induce 33-44% protection in the hamster model of taeniosis. Blood samples were collected from the orbital venous plexus of noninfected and infected hamsters at different days postinfection, as well as from orally immunized animals, to evaluate the frequency of micronucleated reticulocytes as a measure of genotoxicity induced by parasite exposure and rTsCRT vaccination. Our results indicate that infection with T. solium caused time-dependent DNA damage in vivo and that rTsCRT immunization reduced the genotoxic damage induced by the presence of the tapeworms.

Salazar AM; Mendlovic F; Cruz-Rivera M; Chávez-Talavera O; Sordo M; Avila G; Flisser A; Ostrosky-Wegman P

2013-06-01

164

Clonación de genes por spliced leader a partir de genotecas de expresión de cisticercos de Taenia solium  

Directory of Open Access Journals (Sweden)

Full Text Available Cysticercosis is caused by the larval stage of Taenia solium (cysticercus). The diagnosis of the disease is limited by the availability of parasite antigens; an alternative would be the cloning of gene encoding antigens. In T. solium, as in other parasites, an alternative mechanism in the processing of some mRNAs called transsplicing occurs, in which a small RNA known as Spliced Leader (SL) is added to the 5´ end of pre-mRNA molecules, forming a common 5´-terminal exon of the mature mRNAs. Due to limitations for diagnosing the disease, in addition to the interest in the study of this mechanism, the aim of this work was to clone molecules that use this post-transcriptional processing. In this study we did a screening by PCR from cDNA library of T. solium cysticerci using the forward primer TSSL-DW2 and the reverse primer ZAP-3´UP that hybridize with SL and vector sequence, respectively. cDNAs of different sizes were obtained that were cloned in maintenance plasmids (pGEM-Teasy). The presence of inserts and their sizes were estimated by colony PCR, obtaining a total of 56 clones of different sizes (500-1200 bp). This design allows the identification of of T. solium genes using the trans-splicing mechanism; and besides being an easy strategy to clone complete molecules, it opens the way for future investigations on the diagnosis of cysticercosis

Oswgladys Garrido; Dayana Requena; Carlos Flores Angulo; Teresa Gárate; Elizabeth Ferrer

2012-01-01

165

Taenia solium Infections in a rural area of Eastern Zambia-a community based study.  

UK PubMed Central (United Kingdom)

BACKGROUND: Taenia solium taeniosis/cysticercosis is a parasitic infection occurring in many developing countries. Data on the status of human infections in Zambia is largely lacking. We conducted a community-based study in Eastern Zambia to determine the prevalence of human taeniosis and cysticercosis in a rural community. METHODS AND FINDINGS: Stool and serum samples were collected from willing participants. Geographical references of the participants' households were determined and household questionnaires administered. Taeniosis was diagnosed in stool samples by coprology and by the polyclonal antibody-based copro-antigen enzyme-linked immunosorbent assay (copro-Ag ELISA), while cysticercosis was diagnosed in serum by the B158/B60 monoclonal antibody-based antigen ELISA (sero-Ag ELISA). Identification of the collected tapeworm after niclosamide treatment and purgation was done using polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP). A total of 255 households from 20 villages participated in the study, 718 stool and 708 serum samples were collected and examined. Forty-five faecal samples (6.3%) were found positive for taeniosis on copro-Ag ELISA while circulating cysticercus antigen was detected in 5.8% (41/708) individuals. The tapeworm recovered from one of the cases was confirmed to be T. solium on PCR-RFLP. Seropositivity (cysticercosis) was significantly positively related to age (p?=?0.00) and to copro-Ag positivity (taeniosis) (p?=?0.03) but not to gender. Change point analysis revealed that the frequency of cysticercus antigens increased significantly in individuals above the age of 30. Copro-Ag positivity was not related to age or gender. The following risk factors were noted to be present in the study community: free-range pig husbandry system and poor sanitation with 47.8% of the households visited lacking latrines. CONCLUSIONS: This study has recorded high taeniosis and cysticercosis prevalences and identified the need for further studies on transmission dynamics and impact of the disease on the local people.

Mwape KE; Phiri IK; Praet N; Muma JB; Zulu G; Van den Bossche P; de Deken R; Speybroeck N; Dorny P; Gabriël S

2012-01-01

166

Taenia solium taeniosis/cysticercosis in Asia: epidemiology, impact and issues.  

UK PubMed Central (United Kingdom)

Several reports of patients with cysticercosis from many countries in Asia such as India, China, Indonesia, Thailand, Korea, Taiwan and Nepal are a clear indicator of the wide prevalence of Taenia solium cysticercosis and taeniosis in these and other Asian countries. However, epidemiological data from community based studies are sparse and available only for a few countries in Asia. Cysticercosis is the cause of epilepsy in up to 50% of Indian patients presenting with partial seizures. It is also a major cause of epilepsy in Bali (Indonesia), Vietnam and possibly China and Nepal. Seroprevalence studies indicate high rates of exposure to the parasite in several countries (Vietnam, China, Korea and Bali (Indonesia)) with rates ranging from 0.02 to 12.6%. Rates of taeniosis, as determined by stool examination for ova, have also been reported to range between 0.1 and 6% in the community in India, Vietnam, China, and Bali (Indonesia). An astonishingly high rate of taeniosis of 50% was reported from an area in Nepal populated by pig rearing farmers. In addition to poor sanitation, unhealthy pig rearing practices, low hygienic standards, unusual customs such as consumption of raw pork is an additional factor contributing to the spread of the disease in some communities of Asia. Undoubtedly, cysticercosis is a major public health problem in several Asian countries effecting several million people by not only causing neurological morbidity but also imposing economic hardship on impoverished populations. However, there are wide variations in the prevalence rates in different regions and different socio-economic groups in the same country. It is important to press for the recognition of cysticercosis as one of the major public health problems in Asia that needs to be tackled vigorously by the governments and public health authorities of the region.

Rajshekhar V; Joshi DD; Doanh NQ; van De N; Xiaonong Z

2003-06-01

167

Imunodiagnóstico da cisticercose em suíno experimentalmente infectado com ovos de Taenia solium, utilizando antígeno de escólex de Cysticercus cellulosae/ Immunodiagnosis of cysticercosis in swine experimentally infected with Taenia solium eggs, using antigen of Cysticercus cellulosae scolex  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Colheu-se sangue de sete suínos infectados com ovos de Taenia solium, semanalmente, durante 140 dias, para realizar ELISA no soro, utilizando antígeno de escólex (Es-Tso) de C. cellulosae. Em todos os animais, após o 21º dia pós-infecção, houve incremento significativo de anticorpos IgG, que assim se mantiveram até o final do experimento. A sensibilidade do ELISA variou entre 87,5 e 100%. À necropsia, foram identificados 238 cisticercos. Seis suínos apresentara (more) m pelo menos um cisto no coração, língua ou masseter. Não se observou correlação entre concentração de anticorpos e número de cisticercos identificados. Abstract in english Blood samples from seven swines infected with eggs of Taenia solium, were collected weekly during a period of 140 days. The ELISA was carried out in serum, using antigen from Cysticercus cellulosae scolex (Es-Tso). The antibody levels for all animals significantly increased and maintained constant from the 21th day post-infection to the end of the experiment. The sensitivity of the ELISA test averaged between 87.5% and 100%. At the necropsy, 238 cysticerci were identified (more) . Six swines presented at least one cysticercus in one of the organs: heart, tongue or masseter. No correlation between concentration of antibodies and number of identified cysticerci at necropsy, was observed.

Soares, K.A.; Silva, M.R.M.; Poleti, M.D.; Maia, A.A.M.

2006-02-01

168

Imunodiagnóstico da cisticercose em suíno experimentalmente infectado com ovos de Taenia solium, utilizando antígeno de escólex de Cysticercus cellulosae Immunodiagnosis of cysticercosis in swine experimentally infected with Taenia solium eggs, using antigen of Cysticercus cellulosae scolex  

Directory of Open Access Journals (Sweden)

Full Text Available Colheu-se sangue de sete suínos infectados com ovos de Taenia solium, semanalmente, durante 140 dias, para realizar ELISA no soro, utilizando antígeno de escólex (Es-Tso) de C. cellulosae. Em todos os animais, após o 21º dia pós-infecção, houve incremento significativo de anticorpos IgG, que assim se mantiveram até o final do experimento. A sensibilidade do ELISA variou entre 87,5 e 100%. À necropsia, foram identificados 238 cisticercos. Seis suínos apresentaram pelo menos um cisto no coração, língua ou masseter. Não se observou correlação entre concentração de anticorpos e número de cisticercos identificados.Blood samples from seven swines infected with eggs of Taenia solium, were collected weekly during a period of 140 days. The ELISA was carried out in serum, using antigen from Cysticercus cellulosae scolex (Es-Tso). The antibody levels for all animals significantly increased and maintained constant from the 21th day post-infection to the end of the experiment. The sensitivity of the ELISA test averaged between 87.5% and 100%. At the necropsy, 238 cysticerci were identified. Six swines presented at least one cysticercus in one of the organs: heart, tongue or masseter. No correlation between concentration of antibodies and number of identified cysticerci at necropsy, was observed.

K.A. Soares; M.R.M. Silva; M.D. Poleti; A.A.M. Maia

2006-01-01

169

Release of Glycoprotein (GP1) from the Tegumental Surface of Taenia solium by Phospholipase C from Clostridium perfringens Suggests a Novel Protein-Anchor to Membranes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

In order to explore how molecules are linked to the membrane surface in larval Taenia solium, whole cysticerci were incubated in the presence of phospholipase C from Clostridium perfringens (PLC). Released material was collected and analyzed in polyacrylamide gels with sodium dodecyl sulfate. Two ma...

Landa, Abraham; Willms, Kaethe; Laclette, Juan Pedro

170

Characterization of the 8-Kilodalton Antigens of Taenia solium Metacestodes and Evaluation of Their Use in an Enzyme-Linked Immunosorbent Assay for Serodiagnosis  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The Western blot for cysticercosis, which uses lentil lectin purified glycoprotein (LLGP) antigens extracted from the metacestode of Taenia solium, has been the “gold standard” serodiagnostic assay since it was first described in 1989. We report that the diagnostic antigens at 14, 18, and 21 kDa, as...

Hancock, Kathy; Khan, Azra; Williams, Fatima B.; Yushak, Melinda L.; Pattabhi, Sowmya; Noh, John; Tsang, Victor C. W.

171

Seroprevalence to the Antigens of Taenia solium Cysticercosis among Residents of Three Villages in Burkina Faso: A Cross-Sectional Study  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium cysticercosis is a neglected tropical zoonosis transmitted between humans and pigs. This infection is particularly prevalent in areas where sanitation, hygiene and pig management practices are poor. There is very little information about the importance of this infection in West Africa,...

Carabin, Hélène; Millogo, Athanase; Praet, Nicolas; Hounton, Sennen; Tarnagda, Zékiba; Ganaba, Rasmané; Dorny, Pierre

172

Seroprevalence to the antigens of Taenia solium cysticercosis among residents of three villages in Burkina Faso: a cross-sectional study  

Digital Repository Infrastructure Vision for European Research (DRIVER)

BACKGROUND: There is limited published information on the prevalence of human cysticercosis in West Africa. The aim of this pilot study was to estimate the prevalence of Taenia solium cysticercosis antigens in residents of three villages in Burkina Faso. METHODS/PRINCIPAL FINDINGS: Three villages we...

Carabin, H.; Millogo, A.; Praet, N.; Hounton, S.; Tarnagda, Z.; Ganaba, R.; Dorny, P.; Nitiéma, P.; Cowan, L. D.

173

Prevalence of Taenia solium cysticercosis in swine from a community-based study in 21 villages of the Eastern Cape Province, South Africa  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The pork tapeworm, Taenia solium, causative organism of porcine cysticercosis and human neurocysticercosis is known to occur in areas of South Africa including Eastern Cape Province but, despite increasing reports of its occurrence throughout the subregion, the prevalence is yet to be clearly establ...

Krecek, R C; Michael, L M; Schantz, P M; Ntanjana, L; Smith, M F; Dorny, P; Harrison, L J S; Grimm, F; Praet, N; Willingham, A L

174

Immunological mechanisms involved in the protection against intestinal taeniosis elicited by oral immunization with Taenia solium calreticulin.  

UK PubMed Central (United Kingdom)

Oral immunization with functional recombinant Taenia solium calreticulin (rTsCRT) induces 37% reduction in tapeworm burden in the experimental model of intestinal taeniosis in hamsters. Furthermore, tapeworms recovered from vaccinated animals exhibit diminished length, being frequently found in more posterior parts of the small intestine. The aim of this study was to analyze the immunological mechanisms involved in protection in response to rTsCRT oral immunization. Hamsters were orally immunized with rTsCRT using cholera toxin (CT) as adjuvant, weekly for 4 weeks. Fifteen days after the last boost animals were challenged with four T. solium cysticerci. Reduction in the adult worm recovery and increased transcription of mRNA for IL-4 and IFN-? in the mucosa of rTsCRT+CT immunized animals were observed. Immunization also induced goblet cell hyperplasia in the mucosa surrounding the implantation site of the parasite. Specific IgG and IgA antibodies in serum and fecal supernatants were detected after the second immunization, being more pronounced after challenge. Our data suggest that oral vaccination with rTsCRT+CT regulates a local expression of IL-4 and IFN-?, stimulating secretion of IgA that, together with the increase of goblet cells and mucin production, could result in an unfavorable environment for T. solium promoting an impaired tapeworm development.

Leon-Cabrera S; Cruz-Rivera M; Mendlovic F; Romero-Valdovinos M; Vaughan G; Salazar AM; Avila G; Flisser A

2012-11-01

175

Immunological mechanisms involved in the protection against intestinal taeniosis elicited by oral immunization with Taenia solium calreticulin.  

Science.gov (United States)

Oral immunization with functional recombinant Taenia solium calreticulin (rTsCRT) induces 37% reduction in tapeworm burden in the experimental model of intestinal taeniosis in hamsters. Furthermore, tapeworms recovered from vaccinated animals exhibit diminished length, being frequently found in more posterior parts of the small intestine. The aim of this study was to analyze the immunological mechanisms involved in protection in response to rTsCRT oral immunization. Hamsters were orally immunized with rTsCRT using cholera toxin (CT) as adjuvant, weekly for 4 weeks. Fifteen days after the last boost animals were challenged with four T. solium cysticerci. Reduction in the adult worm recovery and increased transcription of mRNA for IL-4 and IFN-? in the mucosa of rTsCRT+CT immunized animals were observed. Immunization also induced goblet cell hyperplasia in the mucosa surrounding the implantation site of the parasite. Specific IgG and IgA antibodies in serum and fecal supernatants were detected after the second immunization, being more pronounced after challenge. Our data suggest that oral vaccination with rTsCRT+CT regulates a local expression of IL-4 and IFN-?, stimulating secretion of IgA that, together with the increase of goblet cells and mucin production, could result in an unfavorable environment for T. solium promoting an impaired tapeworm development. PMID:22921496

Leon-Cabrera, Sonia; Cruz-Rivera, Mayra; Mendlovic, Fela; Romero-Valdovinos, Mirza; Vaughan, Gilberto; Salazar, Ana María; Avila, Guillermina; Flisser, Ana

2012-08-16

176

Immune responses to a recombinant attenuated Salmonella typhimurium strain expressing a Taenia solium oncosphere antigen TSOL18.  

UK PubMed Central (United Kingdom)

A tapeworm, Taenia solium, remains a great threat to human health, particularly in developing countries. The life cycle of T. solium is thought to be terminated via vaccination of intermediate hosts. In this study, we constructed a recombinant attenuated Salmonella typhimurium live vaccine strain ?4558 expressing a TSOL18 antigen. SDS-PAGE and Western blot confirmed the expression of the interest protein and its antigenic property. The recombinant strain stably propagated in vitro, of which the growth was not reversely influenced by TSOL18 protein expressed. It was also shown that mice survived 10(12) CFU of S. typhimurium ?4558, while all mice infected with 10(7) CFU of the wild-type died within five days. The mouse experiment indicated that vaccine strain ?4558 induced a high titer of specific antibody for a long time. In contrast to the controls, the vaccinated mice had an obvious augment of CD4(+) and CD8(+) T lymphocytes and the percentage of helper CD4(+)/CD8(+) T lymphocytes was significantly increased (p<0.01). After oral administration, S. typhimurium ?4558 was first colonized mainly in the Peyer's patches and then predominantly in the mesenteric lymph nodes and spleens in the vaccinated mice. In addition, the high levels of specific anti-TSOL18 antibodies were also observed in pigs administrated with S. typhimurium ?4558. Collectively, these results demonstrate the possibility of use of an attenuated S. typhimurium strain as a vector to deliver protective antigens of T. solium.

Ding J; Zheng Y; Wang Y; Dou Y; Chen X; Zhu X; Wang S; Zhang S; Liu Z; Hou J; Zhai J; Yan H; Luo X; Cai X

2013-01-01

177

Structural and Binding Properties of Two Paralogous Fatty Acid Binding Proteins of Taenia solium Metacestode  

Science.gov (United States)

Background Fatty acid (FA) binding proteins (FABPs) of helminths are implicated in acquisition and utilization of host-derived hydrophobic substances, as well as in signaling and cellular interactions. We previously demonstrated that secretory hydrophobic ligand binding proteins (HLBPs) of Taenia solium metacestode (TsM), a causative agent of neurocysticercosis (NC), shuttle FAs in the surrounding host tissues and inwardly transport the FAs across the parasite syncytial membrane. However, the protein molecules responsible for the intracellular trafficking and assimilation of FAs have remained elusive. Methodology/Principal Findings We isolated two novel TsMFABP genes (TsMFABP1 and TsMFABP2), which encoded 133- and 136-amino acid polypeptides with predicted molecular masses of 14.3 and 14.8 kDa, respectively. They shared 45% sequence identity with each other and 15–95% with other related-members. Homology modeling demonstrated a characteristic ?-barrel composed of 10 anti-parallel ?-strands and two ?-helices. TsMFABP2 harbored two additional loops between ?-strands two and three, and ?-strands six and seven, respectively. TsMFABP1 was secreted into cyst fluid and surrounding environments, whereas TsMFABP2 was intracellularly confined. Partially purified native proteins migrated to 15 kDa with different isoelectric points of 9.2 (TsMFABP1) and 8.4 (TsMFABP2). Both native and recombinant proteins bound to 11-([5-dimethylaminonaphthalene-1-sulfonyl]amino)undecannoic acid, dansyl-DL-?-amino-caprylic acid, cis-parinaric acid and retinol, which were competitively inhibited by oleic acid. TsMFABP1 exhibited high affinity toward FA analogs. TsMFABPs showed weak binding activity to retinol, but TsMFABP2 showed relatively high affinity. Isolation of two distinct genes from an individual genome strongly suggested their paralogous nature. Abundant expression of TsMFABP1 and TsMFABP2 in the canal region of worm matched well with the histological distributions of lipids and retinol. Conclusions/Significance The divergent biochemical properties, physiological roles and cellular distributions of the TsMFABPs might be one of the critical mechanisms compensating for inadequate de novo FA synthesis. These proteins might exert harmonized or independent roles on lipid assimilation and intracellular signaling. The specialized distribution of retinol in the canal region further implies that cells in this region might differentiate into diverse cell types during metamorphosis into an adult worm. Identification of bioactive systems pertinent to parasitic homeostasis may provide a valuable target for function-related drug design.

Yang, Hyun-Jong; Shin, Joo-Ho; Diaz-Camacho, Sylvia Paz; Nawa, Yukifumi; Kang, Insug; Kong, Yoon

2012-01-01

178

[Evaluation of epidemiological situation of cestode infections in Poland in the years 1997-2006 on the basis of data from san-epid stations].  

UK PubMed Central (United Kingdom)

Between 1997-2006, 3,523 intestinal cestode infections were registered in Poland. Among them 2,748 were caused by Taenia saginata, 41 by T. solium, 533 by Taenia species, 20 by Hymenolepis nana, 5 by Hymenolepis diminuta, 11 by Diphyllobothrium latum, 3 by Dipylidium caninum. Moreover, 350 cases of cystic echinococcosis and 8 cases of cysticercosis were also registered. The obtained results confirmed decreasing frequency of intestinal cestodoses in Poland.

Waloch M; Sobolewska A; Dzbe?ski TH

2010-01-01

179

Epidemiology of Taenia solium in Nepal: is it influenced by the social characteristics of the population and the presence of Taenia asiatica?  

Science.gov (United States)

The transmission of the zoonotic pork tapeworms Taenia solium and T. asiatica depends on a combination of specific risk factors, such as open defecation, backyard pig raising and the consumption of raw or undercooked pork and viscera. A community-based survey was conducted among 289 households in south-eastern Nepal to study the heterogeneity of these risk factor frequencies as a function of the social composition of the population. The frequency of open defecation, backyard pig raising and pork consumption differed significantly (P < 0.005) among the different coexisting caste and ethnic groups. In the same survey, the taeniosis prevalence was examined among the different groups. Tapeworm carriers were identified at a high prevalence among the Dum, one of the most disadvantaged communities of Nepal. A PCR-RFLP assay revealed that all collected tapeworm specimens were T. asiatica, a species thus far not known to occur in South Asia. These results can help to understand the epidemiology of T. solium in Nepal, which appears to be more complex than thought so far. PMID:22643112

Devleesschauwer, Brecht; Aryal, Arjun; Joshi, Durga Datt; Rijal, Suman; Sherchand, Jeevan Bahadur; Praet, Nicolas; Speybroeck, Niko; Duchateau, Luc; Vercruysse, Jozef; Dorny, Pierre

2012-05-30

180

Epidemiology of Taenia solium in Nepal: is it influenced by the social characteristics of the population and the presence of Taenia asiatica?  

UK PubMed Central (United Kingdom)

The transmission of the zoonotic pork tapeworms Taenia solium and T. asiatica depends on a combination of specific risk factors, such as open defecation, backyard pig raising and the consumption of raw or undercooked pork and viscera. A community-based survey was conducted among 289 households in south-eastern Nepal to study the heterogeneity of these risk factor frequencies as a function of the social composition of the population. The frequency of open defecation, backyard pig raising and pork consumption differed significantly (P < 0.005) among the different coexisting caste and ethnic groups. In the same survey, the taeniosis prevalence was examined among the different groups. Tapeworm carriers were identified at a high prevalence among the Dum, one of the most disadvantaged communities of Nepal. A PCR-RFLP assay revealed that all collected tapeworm specimens were T. asiatica, a species thus far not known to occur in South Asia. These results can help to understand the epidemiology of T. solium in Nepal, which appears to be more complex than thought so far.

Devleesschauwer B; Aryal A; Joshi DD; Rijal S; Sherchand JB; Praet N; Speybroeck N; Duchateau L; Vercruysse J; Dorny P

2012-08-01

 
 
 
 
181

Disruption of the blood-brain barrier in pigs naturally infected with Taenia solium, untreated and after anthelmintic treatment.  

UK PubMed Central (United Kingdom)

Neurocysticercosis is a widely prevalent disease in the tropics that causes seizures and a variety into of neurological symptoms in most of the world. Experimental models are limited and do not allow assessment of the degree of inflammation around brain cysts. The vital dye Evans Blue (EB) was injected to 11 pigs naturally infected with Taenia solium cysts to visually identify the extent of disruption of the blood-brain barrier. A total of 369 cysts were recovered from the 11 brains and classified according to the staining of their capsules as blue or unstained. The proportion of cysts with blue capsules was significantly higher in brains from pigs that had received anthelmintic treatment 48 and 120h before the EB infusion, indicating a greater compromise of the blood-brain barrier due to treatment. The model could be useful for understanding the pathology of treatment-induced inflammation in neurocysticercosis.

Guerra-Giraldez C; Marzal M; Cangalaya C; Balboa D; Orrego MÁ; Paredes A; Gonzales-Gustavson E; Arroyo G; García HH; González AE; Mahanty S; Nash TE

2013-08-01

182

[Qualitative and quantitative study of Taenia solium posoncospheres in the muscular tissue of pigs with and without cysticercosis  

UK PubMed Central (United Kingdom)

It was determined the presence of posoncospheres in muscular tissues in 20 natural cysticercotic pigs and in 20 pigs apparently free of Taenia solium metacestodes. Ten differents anatomical regions were dissected, giving 400 samples in total. The animals were slaughtered in Ecatepec, Mexico State, Mexico. The samples were kept in bottles with saline and were processed in the Laboratorio de Biología de Parásitos, Facultad de Medicina, Universidad Nacional Autónoma de México (UNAM); cysticercus were counted and later on the resulting muscular mass was grinded and observations were made in the sediment, for posoncospheres search. Mann-Whitney statistical method revealed meaningful differences between postoncospheres in cysticercotic pigs and not apparently cysticercotic pigs. The Linear Correlation Analysis showed no relation between cysticercus quantity and postoncospheres quantity in the same samples. Postoncospheres were found in cysticercotic animals and in those apparently free of cysticercus, in the last group the quantity was bigger.

Jiménez Rodríguez JA; Arteaga ID; Rojas Wastavino G; Salazar Schettino PM

1995-07-01

183

Disruption of the blood-brain barrier in pigs naturally infected with Taenia solium, untreated and after anthelmintic treatment.  

Science.gov (United States)

Neurocysticercosis is a widely prevalent disease in the tropics that causes seizures and a variety into of neurological symptoms in most of the world. Experimental models are limited and do not allow assessment of the degree of inflammation around brain cysts. The vital dye Evans Blue (EB) was injected to 11 pigs naturally infected with Taenia solium cysts to visually identify the extent of disruption of the blood-brain barrier. A total of 369 cysts were recovered from the 11 brains and classified according to the staining of their capsules as blue or unstained. The proportion of cysts with blue capsules was significantly higher in brains from pigs that had received anthelmintic treatment 48 and 120h before the EB infusion, indicating a greater compromise of the blood-brain barrier due to treatment. The model could be useful for understanding the pathology of treatment-induced inflammation in neurocysticercosis. PMID:23684909

Guerra-Giraldez, Cristina; Marzal, Miguel; Cangalaya, Carla; Balboa, Diana; Orrego, Miguel Ángel; Paredes, Adriana; Gonzales-Gustavson, Eloy; Arroyo, Gianfranco; García, Hector H; González, Armando E; Mahanty, Siddhartha; Nash, Theodore E

2013-05-15

184

Observaciones al Microscopio Electrónico de Barrido del Interior de un Proglótido de un Parásito Adulto de Taenia solium Scanning Electron Microscopy Observations of the Cross-Section of a Taenia solium Adult Tapeworm  

Directory of Open Access Journals (Sweden)

Full Text Available No existen, hasta el momento, imágenes que muestren la disposición de la citoarquitectura de parásitos adultos de Taenia solium, parásitos los cuales se encuentran en el intestino de portadores humanos asintomáticos. Las causas de ello podrían tener como base el que cuando se recuperan los parásitos, ellos han sufrido alteraciones debidas a la respuesta inmune de sus hospederos o bien, por el efecto que han producido en los parásitos los fármacos antihelmínticos que hayan sido usados en el tratamiento de los pacientes. Una de las alternativas que se han encontrado para la obtención de parásitos adultos, es la obtención de tenias a partir del modelo de teniosis experimental en hámsteres dorados e inmunosuprimidos y que gracias a este modelo se han podido efectuar diferentes tipos de estudios de los parásitos de esta fase infectiva. El propósito de este reporte es presentar imágenes de ultraestructura, obtenidas mediante Microscopía Electrónica de Barrido, de un corte transversal obtenido de un proglótido de una tenia recuperada de una infección experimental. Las imágenes se obtuvieron a diferentes aumentos y muestran aspectos relacionados con la superficie tegumentaria, el tegumento sincicial continuo, la capa germinal que incluye el soma de algunas células subtegumentarias y los ductos del sistema protonefridial tanto vacíos como llenos con corpúsculos calcáreos. Las imágenes ultraestructurales obtenidas muestran una forma de observación de la anatomía microscopica de los parásitos en estudio y ello contribuye a ampliar el conocimiento de los mismos en relación a aspectos de su biología celular y su fisiología.There are no clear morphological evidences of the cytoarchitecture of intestinal adult tapeworms of Taenia solium recovered from infected humans. Parasites could be altered because of the host´s immunological response or by the direct action of drugs used for antihelminthic treatment. Experimental taeniosis in immunosuppressed golden hamsters is a useful way for recovering and studying adult parasites. The purpose of this report is to show images, taken at the ultrastructural level by Scanning Electron Microscopy (SEM), of a cross-sectioned strobilar chain from an adult tapeworm. The parasite was recovered from an experimental infection. Images were taken at several magnifications; they show the brush border tegumental surface, the syncytial tegument, the germinal layer, some cell bodies and the protonephridial system ducts: empty or filled with calcareous corpuscles. Ultrastructural images taken using SEM of T. solium adult parasites, recovered from experimental infections, could be a new way for observing the microscopic anatomy of these parasites and for increasing the knowledge of aspects related to their cellular biology and physiology.

Javier R Ambrosio; Armando Zepeda-Rodríguez; Araceli Ferrer; Olivia Reynoso-Ducoing; Teresa I Fortoul

2011-01-01

185

Observaciones al Microscopio Electrónico de Barrido del Interior de un Proglótido de un Parásito Adulto de Taenia solium/ Scanning Electron Microscopy Observations of the Cross-Section of a Taenia solium Adult Tapeworm  

Scientific Electronic Library Online (English)

Full Text Available Abstract in spanish No existen, hasta el momento, imágenes que muestren la disposición de la citoarquitectura de parásitos adultos de Taenia solium, parásitos los cuales se encuentran en el intestino de portadores humanos asintomáticos. Las causas de ello podrían tener como base el que cuando se recuperan los parásitos, ellos han sufrido alteraciones debidas a la respuesta inmune de sus hospederos o bien, por el efecto que han producido en los parásitos los fármacos antihelmínticos (more) que hayan sido usados en el tratamiento de los pacientes. Una de las alternativas que se han encontrado para la obtención de parásitos adultos, es la obtención de tenias a partir del modelo de teniosis experimental en hámsteres dorados e inmunosuprimidos y que gracias a este modelo se han podido efectuar diferentes tipos de estudios de los parásitos de esta fase infectiva. El propósito de este reporte es presentar imágenes de ultraestructura, obtenidas mediante Microscopía Electrónica de Barrido, de un corte transversal obtenido de un proglótido de una tenia recuperada de una infección experimental. Las imágenes se obtuvieron a diferentes aumentos y muestran aspectos relacionados con la superficie tegumentaria, el tegumento sincicial continuo, la capa germinal que incluye el soma de algunas células subtegumentarias y los ductos del sistema protonefridial tanto vacíos como llenos con corpúsculos calcáreos. Las imágenes ultraestructurales obtenidas muestran una forma de observación de la anatomía microscopica de los parásitos en estudio y ello contribuye a ampliar el conocimiento de los mismos en relación a aspectos de su biología celular y su fisiología. Abstract in english There are no clear morphological evidences of the cytoarchitecture of intestinal adult tapeworms of Taenia solium recovered from infected humans. Parasites could be altered because of the host´s immunological response or by the direct action of drugs used for antihelminthic treatment. Experimental taeniosis in immunosuppressed golden hamsters is a useful way for recovering and studying adult parasites. The purpose of this report is to show images, taken at the ultrastruc (more) tural level by Scanning Electron Microscopy (SEM), of a cross-sectioned strobilar chain from an adult tapeworm. The parasite was recovered from an experimental infection. Images were taken at several magnifications; they show the brush border tegumental surface, the syncytial tegument, the germinal layer, some cell bodies and the protonephridial system ducts: empty or filled with calcareous corpuscles. Ultrastructural images taken using SEM of T. solium adult parasites, recovered from experimental infections, could be a new way for observing the microscopic anatomy of these parasites and for increasing the knowledge of aspects related to their cellular biology and physiology.

Ambrosio, Javier R; Zepeda-Rodríguez, Armando; Ferrer, Araceli; Reynoso-Ducoing, Olivia; Fortoul, Teresa I

2011-03-01

186

In vitro analysis of albendazole sulfoxide enantiomers shows that (+)-(R)-albendazole sulfoxide is the active enantiomer against Taenia solium.  

UK PubMed Central (United Kingdom)

Albendazole is an anthelmintic drug widely used in the treatment of neurocysticercosis (NCC), an infection of the brain with Taenia solium cysts. However, drug levels of its active metabolite, albendazole sulfoxide (ABZSO), are erratic, likely resulting in decreased efficacy and suboptimal cure rates in NCC. Racemic albendazole sulfoxide is composed of ABZSO (+)-(R)- and (-)-(S) enantiomers that have been shown to differ in pharmacokinetics and activity against other helminths. The antiparasitic activities of racemic ABZSO and its (+)-(R)- and (-)-(S) enantiomers against T. solium cysts were evaluated in vitro. Parasites were collected from naturally infected pigs, cultured, and exposed to the racemic mixture or to each enantiomer (range, 10 to 500 ng/ml) or to praziquantel as a reference drug. The activity of each compound against cysts was assayed by measuring the ability to evaginate and inhibition of alkaline phosphatase (AP) and parasite antigen release. (+)-(R)-ABZSO was significantly more active than (-)-(S)-ABZSO in suppressing the release of AP and antigen into the supernatant in a dose- and time-dependent manner, indicating that most of the activity of ABZSO resides in the (+)-(R) enantiomer. Use of this enantiomer alone may lead to increased efficacy and/or less toxicity compared to albendazole.

Paredes A; de Campos Lourenço T; Marzal M; Rivera A; Dorny P; Mahanty S; Guerra-Giraldez C; García HH; Nash TE; Cass QB

2013-02-01

187

Comparative evaluation of different immunoassays for the detection of Taenia solium cysticercosis in swine with low parasite burden  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english Seven swine were experimentally infected with Taenia solium eggs and blood samples from each animal were periodically collected. At the end of the experiment (t140) the animals did not show clinical aspects of cysticercosis or parasites in tongue inspection. All animals were slaughtered and cut into thin slices in searching for cysts. The number of cysts found in each animal varied from 1 to 85. Enzyme-linked immunosorbent assay (ELISA) tests for antibody (Ab) detection a (more) nd for antigen (Ag) detection were performed, which presented respectively 71 and 57% of positivity. By immunoblot (IB), using 18/14(T. crassiceps Ag) or lentil-lectin-purified glycoproteins from T. solium Ag (LLGP) as Ag, five (71%) and six (86%) animals were positive, respectively. The association between Ag-ELISA with any IB (18/14 or LLGP) allowed the detection of all animals at 140 days post-experimental infection (days p.e.i.). The use of IB 18/14 combined to the Ag-ELISA allowed the detection of all animals since 70 days p.e.i., and the association between IB LLGP and Ag-ELISA allowed the detection of all animals since 112 days p.e.i. While all animals could be considered healthy by conventional screening tests, the use of immunoassays for detecting Ab and Ag showed better accuracy; therefore it would be more useful than usual clinical examination for screening cysticercosis in slightly infected pigs.

Gomes, Andréia Bartachini; Soares, Killarney Ataíde; Bueno, Ednéia Casagrande; Espindola, Noeli Maria; Iha, Alberto Hiroshi; Maia, Antônio Augusto Mendes; Peralta, Regina Helena Saramargo; Vaz, Adelaide José

2007-09-01

188

In vitro analysis of albendazole sulfoxide enantiomers shows that (+)-(R)-albendazole sulfoxide is the active enantiomer against Taenia solium.  

Science.gov (United States)

Albendazole is an anthelmintic drug widely used in the treatment of neurocysticercosis (NCC), an infection of the brain with Taenia solium cysts. However, drug levels of its active metabolite, albendazole sulfoxide (ABZSO), are erratic, likely resulting in decreased efficacy and suboptimal cure rates in NCC. Racemic albendazole sulfoxide is composed of ABZSO (+)-(R)- and (-)-(S) enantiomers that have been shown to differ in pharmacokinetics and activity against other helminths. The antiparasitic activities of racemic ABZSO and its (+)-(R)- and (-)-(S) enantiomers against T. solium cysts were evaluated in vitro. Parasites were collected from naturally infected pigs, cultured, and exposed to the racemic mixture or to each enantiomer (range, 10 to 500 ng/ml) or to praziquantel as a reference drug. The activity of each compound against cysts was assayed by measuring the ability to evaginate and inhibition of alkaline phosphatase (AP) and parasite antigen release. (+)-(R)-ABZSO was significantly more active than (-)-(S)-ABZSO in suppressing the release of AP and antigen into the supernatant in a dose- and time-dependent manner, indicating that most of the activity of ABZSO resides in the (+)-(R) enantiomer. Use of this enantiomer alone may lead to increased efficacy and/or less toxicity compared to albendazole. PMID:23229490

Paredes, Adriana; de Campos Lourenço, Tiago; Marzal, Miguel; Rivera, Andrea; Dorny, Pierre; Mahanty, Siddhartha; Guerra-Giraldez, Cristina; García, Hector H; Nash, Theodore E; Cass, Quezia B

2012-12-10

189

Immune responses to a recombinant attenuated Salmonella typhimurium strain expressing a Taenia solium oncosphere antigen TSOL18.  

Science.gov (United States)

A tapeworm, Taenia solium, remains a great threat to human health, particularly in developing countries. The life cycle of T. solium is thought to be terminated via vaccination of intermediate hosts. In this study, we constructed a recombinant attenuated Salmonella typhimurium live vaccine strain ?4558 expressing a TSOL18 antigen. SDS-PAGE and Western blot confirmed the expression of the interest protein and its antigenic property. The recombinant strain stably propagated in vitro, of which the growth was not reversely influenced by TSOL18 protein expressed. It was also shown that mice survived 10(12) CFU of S. typhimurium ?4558, while all mice infected with 10(7) CFU of the wild-type died within five days. The mouse experiment indicated that vaccine strain ?4558 induced a high titer of specific antibody for a long time. In contrast to the controls, the vaccinated mice had an obvious augment of CD4(+) and CD8(+) T lymphocytes and the percentage of helper CD4(+)/CD8(+) T lymphocytes was significantly increased (psolium. PMID:23219684

Ding, Juntao; Zheng, Yadong; Wang, Ying; Dou, Yongxi; Chen, Xiaoyu; Zhu, Xueliang; Wang, Shuai; Zhang, Shaohua; Liu, Zhenyong; Hou, Junling; Zhai, Junjun; Yan, Hongbin; Luo, Xuenong; Cai, Xuepeng

2012-12-06

190

Comparative evaluation of different immunoassays for the detection of Taenia solium cysticercosis in swine with low parasite burden  

Directory of Open Access Journals (Sweden)

Full Text Available Seven swine were experimentally infected with Taenia solium eggs and blood samples from each animal were periodically collected. At the end of the experiment (t140) the animals did not show clinical aspects of cysticercosis or parasites in tongue inspection. All animals were slaughtered and cut into thin slices in searching for cysts. The number of cysts found in each animal varied from 1 to 85. Enzyme-linked immunosorbent assay (ELISA) tests for antibody (Ab) detection and for antigen (Ag) detection were performed, which presented respectively 71 and 57% of positivity. By immunoblot (IB), using 18/14(T. crassiceps Ag) or lentil-lectin-purified glycoproteins from T. solium Ag (LLGP) as Ag, five (71%) and six (86%) animals were positive, respectively. The association between Ag-ELISA with any IB (18/14 or LLGP) allowed the detection of all animals at 140 days post-experimental infection (days p.e.i.). The use of IB 18/14 combined to the Ag-ELISA allowed the detection of all animals since 70 days p.e.i., and the association between IB LLGP and Ag-ELISA allowed the detection of all animals since 112 days p.e.i. While all animals could be considered healthy by conventional screening tests, the use of immunoassays for detecting Ab and Ag showed better accuracy; therefore it would be more useful than usual clinical examination for screening cysticercosis in slightly infected pigs.

Andréia Bartachini Gomes; Killarney Ataíde Soares; Ednéia Casagrande Bueno; Noeli Maria Espindola; Alberto Hiroshi Iha; Antônio Augusto Mendes Maia; Regina Helena Saramargo Peralta; Adelaide José Vaz

2007-01-01

191

Production of monoclonal antibodies anti-Taenia crassiceps cysticerci with cross-reactivity with Taenia solium antigens Produção de anticorpos monoclonais anti-cisticercos de Taenia crassiceps com reatividade cruzada com antígenos de Taenia solium  

Directory of Open Access Journals (Sweden)

Full Text Available We describe the production of the potential monoclonal antibodies (MoAbs) using BALB/c mice immunized with vesicular fluid (VF)-Tcra (T. crassiceps) antigen. Immune sera presented anti-VF-Tcra (É descrita a produção de potenciais anticorpos monoclonais (MoAbs) usando camundongos BALB/c imunizados com antígenos de líquido vesicular de T. crassiceps (VF-Tcra). O soro imune apresentou anticorpos IgM e IgG anti-VF-Tcra para os peptídeos <20kDa, e com reatividade cruzada com peptídeos 8-12, 14 e 18kDa de T. solium (Tso). Após a fusão, foram selecionados 33 clones IgM com reatividade anti-Tcra e anti-Tso e 53 clones IgG com reatividade específica, sendo que destes, 5 apresentaram reatividade cruzada com antígeno de Tso. Dois clones identificaram os peptídeos 8-14 e 18kDa de VF-Tcra.

Noeli M. ESPÍNDOLA; Elizabeth N. DE GASPARI; Paulo M. NAKAMURA; Adelaide J. VAZ

2000-01-01

192

Immunolocalization of TSOL18 and TSOL45-1A, the successful protective peptides against porcine cysticercosis, in Taenia solium oncospheres  

Directory of Open Access Journals (Sweden)

Full Text Available Abstract Taenia solium life cycle includes humans as definitive hosts and pigs as intermediate hosts. One of the measures to stop the life cycle of this parasite is by vaccination of pigs. In experiments performed in pigs with TSOL18 and TSOL45-1A, two recombinant T. solium proteins, 99.5% and 97.0% protection was induced, respectively. The purpose of this paper was to localize these antigens in all stages of the parasite (adult worms, oncospheres and cysticerci) by immunofluorescence, with the use of antibodies against TSOL18 and TSOL45-1A that were obtained from the pigs used in the vaccination experiment. Results show that TSOL18 and TSOL45-1A are expressed on the surface of T. solium oncospheres and not in tapeworms or cysticerci, indicating that they are stage-specific antigens. This, therefore, might explain the high level of protection these antigens induce against pig cysticercosis.

Martinez-Ocaña Joel; Romero-Valdovinos Mirza; de Kaminsky Rina G; Maravilla Pablo; Flisser Ana

2011-01-01

193

Production of monoclonal antibodies anti-Taenia crassiceps cysticerci with cross-reactivity with Taenia solium antigens  

Directory of Open Access Journals (Sweden)

Full Text Available We describe the production of the potential monoclonal antibodies (MoAbs) using BALB/c mice immunized with vesicular fluid (VF)-Tcra (T. crassiceps) antigen. Immune sera presented anti-VF-Tcra (<20kD) IgG and IgM antibodies with cross-reactivity with T. solium (Tso) antigen (8-12, 14, and 18 kD). After cell fusion, we selected 33 anti-Tcra and anti-Tso reactive IgM-clones and 53 anti-Tcra specific IgG-clones, 5 of them also recognizing Tso antigens. Two clones identified the 8-14 and 18kD peptides of VF-Tcra.

ESPÍNDOLA Noeli M.; DE GASPARI Elizabeth N.; NAKAMURA Paulo M.; VAZ Adelaide J.

2000-01-01

194

Immunodiagnosis of human neurocysticercosis by using semi-purified scolex antigens from Taenia solium cysticerci/ Imunodiagnóstico da neurocisticercose humana usando antígenos semipurificados de escolex de cisticercos de Taenia solium  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Antígeno bruto e proteínas semipurificadas de escóleces de cisticercos de Taenia solium foram avaliados para o imunodiagnóstico da neurocisticercose humana neurocisticercose. As proteínas semipurificadas, obtidas por eletroforese em gel de poliacrilamida e eletroeluição, foram testadas na reação imunoenzimática contra soros de indivíduos normais e de pacientes com neurocisticercose ou outras parasitoses. A proteína de 100kDa proporcionou 100% de sensibilidade (more) e especificidade no imunodiagnóstico. Quando a proteína de 95 ou 26kDa foi empregada, foram obtidos 95 e 100% de sensibilidade e especificidade, respectivamente. Os ensaios envolvendo antígeno bruto e soros de indivíduos normais ou de pacientes com neurocisticercose, diluídos a 1:256, tiveram ótima concordância com aqueles onde a proteína de 100, 95 ou 25kDa foi testada contra os mesmas amostras de soro diluídas a 1:64 (Kappa: 0,95 a 1,00). O antígeno bruto de escolex poderá ser empregado na triagem sorológica enquanto a proteína de 100, 95 ou 26kDa nos testes confirmatórios dos casos positivos de NC. Abstract in english Crude antigen and semi-purified proteins from scolices of Taenia solium cysticerci were evaluated for the immunodiagnosis of human neurocysticercosis neurocysticercosis. Semi-purified proteins obtained by electrophoresis on polyacrylamide gel and by electroelution were tested by means of the immunoenzymatic reaction against sera from normal individuals and from patients with neurocysticercosis or other parasitic diseases. The 100kDa protein provided 100% sensitivity and s (more) pecificity in the immunodiagnosis. When 95 or 26kDa proteins were used, 95 and 100% sensitivity and specificity were obtained, respectively. The assays involving crude antigen and sera from normal individuals or from patients with neurocysticercosis, diluted to 1:256, gave excellent agreement with those in which 100, 95 or 26kDa proteins were tested against the same serum samples diluted to 1:64. (Kappa: 0.95 to 1.00). Crude scolex antigen may be useful for serological screening, while 100, 95 or 26kDa protein can be used in confirmatory tests on neurocysticercosis-positive cases.

Iudici Neto, Francesco; Pianetti-Filho, Geraldo; Araújo, Ricardo Nascimento; Nascimento, Evaldo

2007-04-01

195

Efecto de algunos agentes físicos y químicos sobre el metacéstodo de Taenia solium presente en carne adobada y chorizo/ Effects of some chemical and physical agents on the metacestode Taenia solium in spicy meat and sausage  

Scientific Electronic Library Online (English)

Full Text Available Abstract in spanish OBJETIVO: Evaluar el efecto de diferentes temperaturas y tiempos, así como de algunos condimentos sobre la viabilidad de metacéstodos de Taenia solium en chorizo y carne adobada. MATERIAL Y MÉTODOS: Este trabajo se llevó a cabo en la Universidad Autónoma de Guerrero, en 1999. En la comunidad de Atzacoaloya, en el municipio de Chilapa de Alvarez, Guerrero, se compró carne de cerdo infectada, con la que se preparó carne adobada y chorizo; sólo se empleó aquélla en (more) la cual se comprobó la viabilidad de los metacéstodos. Los productos obtenidos fueron sometidos a: a) temperatura ambiente durante 12 a 100 horas; b) temperaturas de -10 a 37 ºC por 24 horas, y c) ebullición (97 ºC) de 1 a 15 minutos. Para determinar el efecto de los condimentos se prepararon lotes con el doble de ingredientes de cada uno. Todas las evaluaciones se realizaron y evaluaron con tres repeticiones. Se establecieron diferencias de proporciones mediante c². RESULTADOS: A temperatura ambiente la menor evaginación fue a las 100 horas para ambos productos (p Abstract in english OBJECTIVE: To assess the effect of different cooking times and temperatures, as well as of some seasonings, on the viability of Taenia solium metacestodes in spicy meat and hot sausage. MATERIAL AND METHODS: This study was conducted by the Universidad Autónoma de Guerrero (Guerrero State Autonomous University), Mexico in 1999. Infected pork meat was bought in the community of Azacoaloya, in the municipality of Chilapa de Alvarez, Guerrero State. It was used to prepare sp (more) icy meat (adobada) and hot sausage (chorizo). Only the meat in which metacestode viability was proven was used. The products obtained underwent a) room temperature for 12 to 100 hours; b) temperatures of -10 to 37ºC for 24 hours; c) boiling (97ºC) from 1 to 15 minutes. To determine the effect of the seasonings, batches were prepared using twice the amount of a specific seasoning. Trials were done and assessed three times. Proportion differences were established using the chi-squared test. RESULTS: At room temperature the lowest evagination occurred after 100 hours for both products (p

Rivera-Guerrero, Ma Isabel; Sánchez-Rueda, Leticia; Rodríguez-Bataz, Elvia; Martínez-Villalobos, Ada Nelly; Martínez-Maya, José Juan

2004-10-01

196

Immunodiagnosis of human neurocysticercosis by using semi-purified scolex antigens from Taenia solium cysticerci Imunodiagnóstico da neurocisticercose humana usando antígenos semipurificados de escolex de cisticercos de Taenia solium  

Directory of Open Access Journals (Sweden)

Full Text Available Crude antigen and semi-purified proteins from scolices of Taenia solium cysticerci were evaluated for the immunodiagnosis of human neurocysticercosis neurocysticercosis. Semi-purified proteins obtained by electrophoresis on polyacrylamide gel and by electroelution were tested by means of the immunoenzymatic reaction against sera from normal individuals and from patients with neurocysticercosis or other parasitic diseases. The 100kDa protein provided 100% sensitivity and specificity in the immunodiagnosis. When 95 or 26kDa proteins were used, 95 and 100% sensitivity and specificity were obtained, respectively. The assays involving crude antigen and sera from normal individuals or from patients with neurocysticercosis, diluted to 1:256, gave excellent agreement with those in which 100, 95 or 26kDa proteins were tested against the same serum samples diluted to 1:64. (Kappa: 0.95 to 1.00). Crude scolex antigen may be useful for serological screening, while 100, 95 or 26kDa protein can be used in confirmatory tests on neurocysticercosis-positive cases.Antígeno bruto e proteínas semipurificadas de escóleces de cisticercos de Taenia solium foram avaliados para o imunodiagnóstico da neurocisticercose humana neurocisticercose. As proteínas semipurificadas, obtidas por eletroforese em gel de poliacrilamida e eletroeluição, foram testadas na reação imunoenzimática contra soros de indivíduos normais e de pacientes com neurocisticercose ou outras parasitoses. A proteína de 100kDa proporcionou 100% de sensibilidade e especificidade no imunodiagnóstico. Quando a proteína de 95 ou 26kDa foi empregada, foram obtidos 95 e 100% de sensibilidade e especificidade, respectivamente. Os ensaios envolvendo antígeno bruto e soros de indivíduos normais ou de pacientes com neurocisticercose, diluídos a 1:256, tiveram ótima concordância com aqueles onde a proteína de 100, 95 ou 25kDa foi testada contra os mesmas amostras de soro diluídas a 1:64 (Kappa: 0,95 a 1,00). O antígeno bruto de escolex poderá ser empregado na triagem sorológica enquanto a proteína de 100, 95 ou 26kDa nos testes confirmatórios dos casos positivos de NC.

Francesco Iudici Neto; Geraldo Pianetti-Filho; Ricardo Nascimento Araújo; Evaldo Nascimento

2007-01-01

197

Species-specific immunodiagnosis of Taenia solium cysticercosis by ELISA and immunoblotting.  

UK PubMed Central (United Kingdom)

A combination of ELISA and immunoblotting was evaluated for immunodiagnosis of human T. solium cysticercosis. The sensitivity of ELISA for diagnosis of European, Latin-American, Asian and South African patients with cysticercosis was 75% for serum and 55% for cerebrospinal fluid specimen. Antigens originating from cysticerci in pigs from Mexico and South Africa were of adequate applicability. A species-specific confirmation of T. solium cysticercosis by immunoblotting (detection of antibody activity to the 26 K and 8 K bands) was achieved in 92% (serum) and 100% (CSF) of samples positive in ELISA. No antibodies from 147 patients with other helminth infections reacted with the 26 K and the 8 K band in immunoblotting, resulting in a specificity of 100%.

Gottstein B; Zini D; Schantz PM

1987-12-01

198

Species-specific immunodiagnosis of Taenia solium cysticercosis by ELISA and immunoblotting.  

Science.gov (United States)

A combination of ELISA and immunoblotting was evaluated for immunodiagnosis of human T. solium cysticercosis. The sensitivity of ELISA for diagnosis of European, Latin-American, Asian and South African patients with cysticercosis was 75% for serum and 55% for cerebrospinal fluid specimen. Antigens originating from cysticerci in pigs from Mexico and South Africa were of adequate applicability. A species-specific confirmation of T. solium cysticercosis by immunoblotting (detection of antibody activity to the 26 K and 8 K bands) was achieved in 92% (serum) and 100% (CSF) of samples positive in ELISA. No antibodies from 147 patients with other helminth infections reacted with the 26 K and the 8 K band in immunoblotting, resulting in a specificity of 100%. PMID:3441736

Gottstein, B; Zini, D; Schantz, P M

1987-12-01

199

Taenia solium cysticercosis - an emerging foodborne zoonosis in sub-Saharan Africa  

DEFF Research Database (Denmark)

Pig-keeping and pork consumption have increased significantly in eastern and southern Africa (ESA) during the past decade. A high and increasing prevalence of epilepsy in ESA, without a clear etiology, and an increase in cases of porcine cysticercosis have been noted in the region. Two Danida-funded projects have addressed the problem, first by assessing the prevalence, risks and impacts of T. solium taeniosis/cysticercosis in both humans and pigs in Mozambique and Tanzania from 2006-2009, and, through an on-going project, by trying to develop sustainable solutions for control of the disease. The study areas include Tete province, western Mozambique and Mbeya region, southern Tanzania. The prevalence of T. solium cysticercosis in the area was found to be between 31-35% in pigs and 15-18% in humans based on an Ag-ELISA. In addition 45% of the human population was found to be Ab-positive for cysticercosis. Among a subgroup of the participants in Mozambique, 72% (77/107 Ag-positive) compared to 18% (8/44 Ag-negative) were having abnormal CT-scans suggestive of neurocysticercosis. Epilepsy was, in both countries, very common and strongly associated with stigmatization. Risk factors for T. solium infections included poor pig husbandry practices especially free ranging of pigs, open defecation, age of pigs, pork cooking practices, lack of meat inspection, and lack of knowledge regarding transmission of the disease. The on-going project focuses on health education and proper pig management as means to control not only T. solium cysticercosis, but also African swine fever, another serious constraint for improving the livelihood of smallholder pig producers in the region.

Johansen, Maria Vang; Lekule, Faustin

200

Prevalence of anti-Taenia solium antibodies in sera from outpatients in an Andean region of Ecuador  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english Sera from 9,254 individuals that presented at one of three outpatient clinics in Quito, Ecuador were assayed by indirect hemagglutination for the presence of antibodies reactive with antigens from Taenia solium cysts. Immunoblot anlysis of 81 selected sera with IHA titers ranging from 0 to 1,028 showed that a titer of maior ou igual a 32 was suggestive of exposure to the parasite. Nine percent (9 %) of the 9,254 patients had titers of 32 or greater. Of 3,503 sera from one (more) clinic, which included sera from food handlers undergoing yearly physicals, 390 (11 %) were positive. In addition, a correlation with age was seen in some, but not all, populations. In situations where age-related effects were noted, the highest incidence was seen in the youngest (0-20 years) and in the oldest (51-60 years) group. Thus, a resurgence of infection after a period of lower prevalence may be developing. Overall, this study shows that cysticercosis is relatively common and potentially a serious health problem in this region.

Escalante, Luis; Rowland, Edwin C.; Powell, Malcolm R.

1995-12-01

 
 
 
 
201

Prevalence of anti-Taenia solium antibodies in sera from outpatients in an Andean region of Ecuador  

Directory of Open Access Journals (Sweden)

Full Text Available Sera from 9,254 individuals that presented at one of three outpatient clinics in Quito, Ecuador were assayed by indirect hemagglutination for the presence of antibodies reactive with antigens from Taenia solium cysts. Immunoblot anlysis of 81 selected sera with IHA titers ranging from 0 to 1,028 showed that a titer of maior ou igual a 32 was suggestive of exposure to the parasite. Nine percent (9 %) of the 9,254 patients had titers of 32 or greater. Of 3,503 sera from one clinic, which included sera from food handlers undergoing yearly physicals, 390 (11 %) were positive. In addition, a correlation with age was seen in some, but not all, populations. In situations where age-related effects were noted, the highest incidence was seen in the youngest (0-20 years) and in the oldest (51-60 years) group. Thus, a resurgence of infection after a period of lower prevalence may be developing. Overall, this study shows that cysticercosis is relatively common and potentially a serious health problem in this region.

Luis Escalante; Edwin C. Rowland; Malcolm R. Powell

1995-01-01

202

Hygiene and restraint of pigs is associated with absence of Taenia solium cysticercosis in a rural community of Mexico/ La higiene y el confinamiento de cerdos están asociados con la ausencia de cisticercosis por Taenia solium en una comunidad rural de México  

Scientific Electronic Library Online (English)

Full Text Available Abstract in spanish Objetivo. Determinar la prevalencia y factores de riesgo asociados con cisticercosis porcina en una población rural de Veracruz, México. Material y métodos. Se diagnosticó cisticercosis porcina por medio de palpación lingual y anticuerpos circulantes en cerdos de traspatio en 178 casas. Se analizaron los factores de riesgo mediante una encuesta a los dueños respecto a las condiciones de crianza de los cerdos y sus características demográficas. Resultados. Los 53 c (more) erdos estudiados fueron negativos al metacéstodo de Taenia solium por palpación lingual y para la presencia de anticuerpos contra este agente por inmunoelectrotransferencia. El 91% de las casas contaban con letrinas y los cerdos estaban confinados en zonas restringidas. Conclusiones. Este estudio muestra que el confinamiento de cerdos puede explicar la ausencia de Taenia solium en comunidades rurales, y sugiere que es factible y práctico establecer medidas de intervención. El texto completo en inglés de este artículo también está disponible en: http://www.insp.mx/salud/index.html Abstract in english Objective. To determine the prevalence and risk factors associated to pig cysticercosis in a rural community of Veracruz, Mexico. Material and Methods. Swine cysticercosis was diagnosed by tongue palpation and circulating antibodies in pigs kept in 178 household backyards. Risk factors were assessed by interviewing owners to collect information on pig breeding conditions and demographic characteristics. Results. None of the 53 pigs studied showed cysts in the tongue, nor (more) antibodies against Taenia solium in Western blot assays. Latrines were available in 91% of the houses and pigs were kept in restrained areas. Conclusions. The present study shows that pig breeding under restraint with basic hygiene and sanitary conditions, may be effective and practical interventions to restrain Taenia solium in rural communities. The English version of this paper is available too at: http://www.insp.mx/salud/index.html

Vázquez-Flores, Sonia; Ballesteros-Rodea, Gilberto; Flisser, Ana; Schantz, Peter M.

2001-12-01

203

Hygiene and restraint of pigs is associated with absence of Taenia solium cysticercosis in a rural community of Mexico La higiene y el confinamiento de cerdos están asociados con la ausencia de cisticercosis por Taenia solium en una comunidad rural de México  

Directory of Open Access Journals (Sweden)

Full Text Available Objective. To determine the prevalence and risk factors associated to pig cysticercosis in a rural community of Veracruz, Mexico. Material and Methods. Swine cysticercosis was diagnosed by tongue palpation and circulating antibodies in pigs kept in 178 household backyards. Risk factors were assessed by interviewing owners to collect information on pig breeding conditions and demographic characteristics. Results. None of the 53 pigs studied showed cysts in the tongue, nor antibodies against Taenia solium in Western blot assays. Latrines were available in 91% of the houses and pigs were kept in restrained areas. Conclusions. The present study shows that pig breeding under restraint with basic hygiene and sanitary conditions, may be effective and practical interventions to restrain Taenia solium in rural communities. The English version of this paper is available too at: http://www.insp.mx/salud/index.html Objetivo. Determinar la prevalencia y factores de riesgo asociados con cisticercosis porcina en una población rural de Veracruz, México. Material y métodos. Se diagnosticó cisticercosis porcina por medio de palpación lingual y anticuerpos circulantes en cerdos de traspatio en 178 casas. Se analizaron los factores de riesgo mediante una encuesta a los dueños respecto a las condiciones de crianza de los cerdos y sus características demográficas. Resultados. Los 53 cerdos estudiados fueron negativos al metacéstodo de Taenia solium por palpación lingual y para la presencia de anticuerpos contra este agente por inmunoelectrotransferencia. El 91% de las casas contaban con letrinas y los cerdos estaban confinados en zonas restringidas. Conclusiones. Este estudio muestra que el confinamiento de cerdos puede explicar la ausencia de Taenia solium en comunidades rurales, y sugiere que es factible y práctico establecer medidas de intervención. El texto completo en inglés de este artículo también está disponible en: http://www.insp.mx/salud/index.html

Sonia Vázquez-Flores; Gilberto Ballesteros-Rodea; Ana Flisser; Peter M. Schantz

2001-01-01

204

[Cathepsin L Cysteine Protease from Taenia solium: Its biological role in the infection and potential use for the immunodiagnosis of neurocysticercosis.  

UK PubMed Central (United Kingdom)

Taenia solium is a plane helminth responsible for taeniasis and human cysticercosis, the latter being the result of the consumption of infective eggs. Cysticerci can develop in different human tissues, often in the central nervous system, causing neurocysticercosis (NCC). For the diagnosis of NCC, an adequate interpretation of clinical data, neuroimaging results and serological tests are required. However, serological tests could be improved by developing candidate antigens able to increase their sensibility and specificity. In the last years, a series of surface and secretory proteins of T. solium essential for the parasite-host interaction have been described. One of these families is cathepsin L cysteine proteases, which have a predominant role in the development and survival of the parasite. They take part in the tissue invasion, immune response evasion, excystation and encystment of cysticercus. They are considered potential antigens for the immunodiagnosis of neurocysticercosis.

León N; Padilla C; Pajuelo M; Sheen P; Zimic M

2013-09-01

205

Human and porcine Taenia solium infection in a village in the highlands of Cusco, Peru. The Cysticercosis Working Group in Peru.  

UK PubMed Central (United Kingdom)

A serological survey was performed using the enzyme-linked immunoelectrotransfer blot assay (EITB) in a village in the highlands of Peru where there are three distinct but close neighborhoods, to determine if there is a direct relationship between human and porcine Taenia solium infection. One hundred and eight out of 365 individuals were sampled, and 14 were seropositive (human seroprevalence 13%). Most seropositive individuals were neurologically asymptomatic. Thirty-eight out of 89 sampled pigs (43%) were seropositive. There was a clear geographical clustering of cases, and positive correlation between human and porcine seroprevalence found when comparing the three neighborhoods. Cysticercosis is an important cause of neurological morbidity in most developing countries, and control/eradication trials are now being increasingly applied. Porcine serology provides an appropriate indicator of T. solium environmental contamination and should be used to estimate the risk of infection when evaluating control measures.

Garcia HH; Gilman RH; Gonzalez AE; Pacheco R; Verastegui M; Tsang VC

1999-05-01

206

Mini review on chemotherapy of taeniasis and cysticercosis due to Taenia solium in Asia, and a case report with 20 tapeworms in China.  

Science.gov (United States)

A 43-year-old Tibetan woman living in northwest Sichuan, China, confirmed to be a taeniasis carrier of Taenia solium was treated with pumpkin seeds combined with Areca nut extract in October 2009. All 20 tapeworms except one without scolex were expelled under good conditions. She was free of secondary cysticercosis within one year follow up. Although the first choice for treatment of taeniasis is still praziquantel, it may often cause serious side effect on asymptomatic cysticercosis cases to suddenly become symptomatic within a half day of the treatment. Therefore, the problems in treatment of taeniasis and/or cysticercosis in Asia are briefly overviewed, since other platyhelminthic diseases including schistosomiasis, opisthorchiasis etc. are more common and praziquantel is strongly recommended for mass treatment of these trematodiases with no idea on the co-infection with eggs of T. solium which cause asymptomatic cysticercosis. PMID:23959481

Ito, A; Li, T; Chen, X; Long, C; Yanagida, T; Nakao, M; Sako, Y; Okamoto, M; Wu, Y; Raoul, F; Giraudoux, P; Craig, P S

2013-06-01

207

Mini review on chemotherapy of taeniasis and cysticercosis due to Taenia solium in Asia, and a case report with 20 tapeworms in China.  

UK PubMed Central (United Kingdom)

A 43-year-old Tibetan woman living in northwest Sichuan, China, confirmed to be a taeniasis carrier of Taenia solium was treated with pumpkin seeds combined with Areca nut extract in October 2009. All 20 tapeworms except one without scolex were expelled under good conditions. She was free of secondary cysticercosis within one year follow up. Although the first choice for treatment of taeniasis is still praziquantel, it may often cause serious side effect on asymptomatic cysticercosis cases to suddenly become symptomatic within a half day of the treatment. Therefore, the problems in treatment of taeniasis and/or cysticercosis in Asia are briefly overviewed, since other platyhelminthic diseases including schistosomiasis, opisthorchiasis etc. are more common and praziquantel is strongly recommended for mass treatment of these trematodiases with no idea on the co-infection with eggs of T. solium which cause asymptomatic cysticercosis.

Ito A; Li T; Chen X; Long C; Yanagida T; Nakao M; Sako Y; Okamoto M; Wu Y; Raoul F; Giraudoux P; Craig PS

2013-06-01

208

Efecto de algunos agentes físicos y químicos sobre el metacéstodo de Taenia solium presente en carne adobada y chorizo Effects of some chemical and physical agents on the metacestode Taenia solium in spicy meat and sausage  

Directory of Open Access Journals (Sweden)

Full Text Available OBJETIVO: Evaluar el efecto de diferentes temperaturas y tiempos, así como de algunos condimentos sobre la viabilidad de metacéstodos de Taenia solium en chorizo y carne adobada. MATERIAL Y MÉTODOS: Este trabajo se llevó a cabo en la Universidad Autónoma de Guerrero, en 1999. En la comunidad de Atzacoaloya, en el municipio de Chilapa de Alvarez, Guerrero, se compró carne de cerdo infectada, con la que se preparó carne adobada y chorizo; sólo se empleó aquélla en la cual se comprobó la viabilidad de los metacéstodos. Los productos obtenidos fueron sometidos a: a) temperatura ambiente durante 12 a 100 horas; b) temperaturas de -10 a 37 ºC por 24 horas, y c) ebullición (97 ºC) de 1 a 15 minutos. Para determinar el efecto de los condimentos se prepararon lotes con el doble de ingredientes de cada uno. Todas las evaluaciones se realizaron y evaluaron con tres repeticiones. Se establecieron diferencias de proporciones mediante c². RESULTADOS: A temperatura ambiente la menor evaginación fue a las 100 horas para ambos productos (pOBJECTIVE: To assess the effect of different cooking times and temperatures, as well as of some seasonings, on the viability of Taenia solium metacestodes in spicy meat and hot sausage. MATERIAL AND METHODS: This study was conducted by the Universidad Autónoma de Guerrero (Guerrero State Autonomous University), Mexico in 1999. Infected pork meat was bought in the community of Azacoaloya, in the municipality of Chilapa de Alvarez, Guerrero State. It was used to prepare spicy meat (adobada) and hot sausage (chorizo). Only the meat in which metacestode viability was proven was used. The products obtained underwent a) room temperature for 12 to 100 hours; b) temperatures of -10 to 37ºC for 24 hours; c) boiling (97ºC) from 1 to 15 minutes. To determine the effect of the seasonings, batches were prepared using twice the amount of a specific seasoning. Trials were done and assessed three times. Proportion differences were established using the chi-squared test. RESULTS: At room temperature the lowest evagination occurred after 100 hours for both products (p<0.05). After 24 hours, the lowest evagination occurred at -10ºC in spicy meat and at 37ºC in hot sausage (p<0.05). At boiling temperature there was no evagination after 10 minutes (p<0.05). In spicy meat, adding salt caused the most significant reduction; in hot sausage, thyme caused the most significant reduction (p<0.05). CONCLUSIONS: Meat with metacestodes should not be eaten, yet, it is being sold and used to prepare spicy meats. Adding spices can hide the metacestode, thus, adequate cooking of these meat products is necessary. These meats may be consumed at least four days after its preparation and spicy meat after a minimum of four days of refrigeration.

Ma Isabel Rivera-Guerrero; Leticia Sánchez-Rueda; Elvia Rodríguez-Bataz; Ada Nelly Martínez-Villalobos; José Juan Martínez-Maya

2004-01-01

209

Neurocysticercosis: detection of IgG, IgA and IgE antibodies in cerebrospinal fluid, serum and saliva samples by ELISA with Taenia solium and Taenia crassiceps antigens Neurocisticercose: detecção de anticorpos IgG, IgA e IgE em amostras de líquido cefalorraquidiano, soro e saliva por ELISA com antígenos de Taenia solium e Taenia crassiceps  

Directory of Open Access Journals (Sweden)

Full Text Available We assayed samples of cerebrospinal fluid (CSF), serum and saliva from patients with neurocysticercoses, control group and individuals with other parasitoses, by ELISA with Taenia crassiceps vesicular fluid antigen (Tcra) and Taenia solium total antigen (Tso) for the detection of antibodies. The sensitivity for IgG-Tcra was 100% for CSF and serum, and 32.0% for saliva; and for IgG-Tso 100% for CSF, 80.0% for serum and 24.% for saliva. Specificity was 100% for CSF and 80.0% for serum with both antigens, and 100% for saliva with Tcra and 87.5% with Tso. The sensitivity and specificity for IgA-Tcra was, respectively, 40.0% and 100% for CSF, 36.0% and 97.1% for serum, and 4.0% and 90.0% for saliva. IgE detection showed 24.0% sensitivity and 97.1% specificity for serum, with no detection in CSF samples. The search for antibodies revealed the presence of IgG > IgA > IgE in CSF, serum and saliva samples, with IgG being present in all phases of the disease, while IgA/IgE were more frequent in the inactive form.Analisamos amostras de líquido cefalorraquidiano (LCR), soro e saliva de pacientes com neurocisticercose, grupo de controle e indivíduos com outras parasitoses, por ELISA com antígenos de líquido vesicular de T. crassiceps (Tcra) e salino total de T. solium (Tso) para a pesquisa de anticorpos. A sensibilidade para IgG-Tcra foi 100% para LCR e soro e 32,0% para saliva, e para IgG-Tso 100% para LCR, 80,0% para soro e 24,0% para saliva. A especificidade foi de 100% para CSF e 80,0% para soro com ambos os antígenos, e 100% para saliva com Tcra e 87,5% com Tso. A sensibilidade e especificidade para IgA-Tcra foi, respectivamente: 40,0% e 100% para LCR, 36,0% e 97,1% para soro, e 4,0% e 90,0% para saliva. A pesquisa de IgE mostrou 24,0% de sensibilidade e 97,1% de especificidade para soro, sem detecção nas amostras de LCR. A pesquisa de anticorpos revelou a presença de IgG > IgA > IgE no LCR, soro e saliva, com presença de IgG em todas as fases evolutivas da doença, enquanto que IgA/IgE foram mais frequentes na forma inativa.

EDNÉIA CASAGRANDA BUENO; ADELAIDE JOSÉ VAZ; LUÍS DOS RAMOS MACHADO; JOSÉ ANTONIO LIVRAMENTO

2000-01-01

210

Neurocysticercosis: detection of IgG, IgA and IgE antibodies in cerebrospinal fluid, serum and saliva samples by ELISA with Taenia solium and Taenia crassiceps antigens/ Neurocisticercose: detecção de anticorpos IgG, IgA e IgE em amostras de líquido cefalorraquidiano, soro e saliva por ELISA com antígenos de Taenia solium e Taenia crassiceps  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Analisamos amostras de líquido cefalorraquidiano (LCR), soro e saliva de pacientes com neurocisticercose, grupo de controle e indivíduos com outras parasitoses, por ELISA com antígenos de líquido vesicular de T. crassiceps (Tcra) e salino total de T. solium (Tso) para a pesquisa de anticorpos. A sensibilidade para IgG-Tcra foi 100% para LCR e soro e 32,0% para saliva, e para IgG-Tso 100% para LCR, 80,0% para soro e 24,0% para saliva. A especificidade foi de 100% para (more) CSF e 80,0% para soro com ambos os antígenos, e 100% para saliva com Tcra e 87,5% com Tso. A sensibilidade e especificidade para IgA-Tcra foi, respectivamente: 40,0% e 100% para LCR, 36,0% e 97,1% para soro, e 4,0% e 90,0% para saliva. A pesquisa de IgE mostrou 24,0% de sensibilidade e 97,1% de especificidade para soro, sem detecção nas amostras de LCR. A pesquisa de anticorpos revelou a presença de IgG > IgA > IgE no LCR, soro e saliva, com presença de IgG em todas as fases evolutivas da doença, enquanto que IgA/IgE foram mais frequentes na forma inativa. Abstract in english We assayed samples of cerebrospinal fluid (CSF), serum and saliva from patients with neurocysticercoses, control group and individuals with other parasitoses, by ELISA with Taenia crassiceps vesicular fluid antigen (Tcra) and Taenia solium total antigen (Tso) for the detection of antibodies. The sensitivity for IgG-Tcra was 100% for CSF and serum, and 32.0% for saliva; and for IgG-Tso 100% for CSF, 80.0% for serum and 24.% for saliva. Specificity was 100% for CSF and 80.0 (more) % for serum with both antigens, and 100% for saliva with Tcra and 87.5% with Tso. The sensitivity and specificity for IgA-Tcra was, respectively, 40.0% and 100% for CSF, 36.0% and 97.1% for serum, and 4.0% and 90.0% for saliva. IgE detection showed 24.0% sensitivity and 97.1% specificity for serum, with no detection in CSF samples. The search for antibodies revealed the presence of IgG > IgA > IgE in CSF, serum and saliva samples, with IgG being present in all phases of the disease, while IgA/IgE were more frequent in the inactive form.

BUENO, EDNÉIA CASAGRANDA; VAZ, ADELAIDE JOSÉ; MACHADO, LUÍS DOS RAMOS; LIVRAMENTO, JOSÉ ANTONIO

2000-03-01

211

[Effects of some chemical and physical agents on the metacestode Taenia solium in spicy meat and sausage].  

UK PubMed Central (United Kingdom)

OBJECTIVE: To assess the effect of different cooking times and temperatures, as well as of some seasonings, on the viability of Taenia solium metacestodes in spicy meat and hot sausage. MATERIAL AND METHODS: This study was conducted by the Universidad Autónoma de Guerrero (Guerrero State Autonomous University), Mexico in 1999. Infected pork meat was bought in the community of Azacoaloya, in the municipality of Chilapa de Alvarez, Guerrero State. It was used to prepare spicy meat (adobada) and hot sausage (chorizo). Only the meat in which metacestode viability was proven was used. The products obtained underwent a) room temperature for 12 to 100 hours; b) temperatures of -10 to 37 degrees C for 24 hours; c) boiling (97 degrees C) from 1 to 15 minutes. To determine the effect of the seasonings, batches were prepared using twice the amount of a specific seasoning. Trials were done and assessed three times. Proportion differences were established using the chi-squared test. RESULTS: At room temperature the lowest evagination occurred after 100 hours for both products (p<0.05). After 24 hours, the lowest evagination occurred at -10 degrees C in spicy meat and at 37 degrees C in hot sausage (p<0.05). At boiling temperature there was no evagination after 10 minutes (p<0.05). In spicy meat, adding salt caused the most significant reduction; in hot sausage, thyme caused the most significant reduction (p<0.05). CONCLUSIONS: Meat with metacestodes should not be eaten, yet, it is being sold and used to prepare spicy meats. Adding spices can hide the metacestode, thus, adequate cooking of these meat products is necessary. These meats may be consumed at least four days after its preparation and spicy meat after a minimum of four days of refrigeration. The English version of this paper is available at: http://www.insp.mx/salud/index.html.

Rivera-Guerrero MI; Sánchez-Rueda L; Rodríguez-Bataz E; Martínez-Villalobos AN; Martínez-Maya JJ

2004-09-01

212

The highly antigenic 53/25 kDa Taenia solium protein fraction with cathepsin-L like activity is present in the oncosphere/cysticercus and induces non-protective IgG antibodies in pigs.  

UK PubMed Central (United Kingdom)

Cathepsin L-like proteases are secreted by several parasites including Taenia solium. The mechanism used by T. solium oncospheres to degrade and penetrate the intestine and infect the host is incompletely understood. It is assumed that intestinal degradation is driven by the proteolytic activity of enzymes secreted by the oncosphere. Blocking the proteolytic activity by an antibody response would prevent the oncosphere penetration and further infection. Serine and cysteine proteases including chymotrypsin, trypsin, elastase, and cathepsin L, are secreted by T. solium and Taenia saginata oncospheres when cultured in vitro, being potential vaccine candidates. However, the purification of a sufficient quantity of proteases secreted by oncospheres to conduct a vaccine trial is costly and lengthy. A 53/25 kDa cathepsin L-like fraction partially purified from T. solium cyst fluid was described previously as an important antigen for immunodiagnostics. In this study we found that this antigen is present in the T. solium oncosphere and is also secreted by the cysticercus. This protein fraction was tested for its ability to protect pigs against an oral challenge with T. solium oncospheres in a vaccine trial. IgG antibodies against the 53/25 kDa cathepsin L-like protein fraction were elicited in the vaccinated animals but did not confer protection.

Zimic M; Pajuelo M; Gilman RH; Gutiérrez AH; Rueda LD; Flores M; Chile N; Verástegui M; Gonzalez A; García HH; Sheen P

2012-01-01

213

Molecular approaches to Taenia asiatica.  

Science.gov (United States)

Taenia solium, T. saginata, and T. asiatica are taeniid tapeworms that cause taeniasis in humans and cysticercosis in intermediate host animals. Taeniases remain an important public health concerns in the world. Molecular diagnostic methods using PCR assays have been developed for rapid and accurate detection of human infecting taeniid tapeworms, including the use of sequence-specific DNA probes, PCR-RFLP, and multiplex PCR. More recently, DNA diagnosis using PCR based on histopathological specimens such as 10% formalin-fixed paraffin-embedded and stained sections mounted on slides has been applied to cestode infections. The mitochondrial gene sequence is believed to be a very useful molecular marker for not only studying evolutionary relationships among distantly related taxa, but also for investigating the phylo-biogeography of closely related species. The complete sequence of the human Taenia tapeworms mitochondrial genomes were determined, and its organization and structure were compared to other human-tropic Taenia tapeworms for which complete mitochondrial sequence data were available. The multiplex PCR assay with the Ta4978F, Ts5058F, Tso7421F, and Rev7915 primers will be useful for differential diagnosis, molecular characterization, and epidemiological surveys of human Taenia tapeworms. PMID:23467738

Jeon, Hyeong-Kyu; Eom, Keeseon S

2013-02-18

214

Molecular approaches to Taenia asiatica.  

UK PubMed Central (United Kingdom)

Taenia solium, T. saginata, and T. asiatica are taeniid tapeworms that cause taeniasis in humans and cysticercosis in intermediate host animals. Taeniases remain an important public health concerns in the world. Molecular diagnostic methods using PCR assays have been developed for rapid and accurate detection of human infecting taeniid tapeworms, including the use of sequence-specific DNA probes, PCR-RFLP, and multiplex PCR. More recently, DNA diagnosis using PCR based on histopathological specimens such as 10% formalin-fixed paraffin-embedded and stained sections mounted on slides has been applied to cestode infections. The mitochondrial gene sequence is believed to be a very useful molecular marker for not only studying evolutionary relationships among distantly related taxa, but also for investigating the phylo-biogeography of closely related species. The complete sequence of the human Taenia tapeworms mitochondrial genomes were determined, and its organization and structure were compared to other human-tropic Taenia tapeworms for which complete mitochondrial sequence data were available. The multiplex PCR assay with the Ta4978F, Ts5058F, Tso7421F, and Rev7915 primers will be useful for differential diagnosis, molecular characterization, and epidemiological surveys of human Taenia tapeworms.

Jeon HK; Eom KS

2013-02-01

215

Cisteínoproteasas Catepsinas L de Taenia solium: Rol biológico en la infección y potencial uso para el inmunodiagnóstico de la neurocisticercosis/ Cathepsin L Cysteine Protease from Taenia solium: Its biological role in the infection and potential use for the immunodiagnosis of neurocysticercosis  

Scientific Electronic Library Online (English)

Full Text Available Abstract in spanish Taenia solium es un helminto aplanado responsable de la teniosis y de la cisticercosis humana, siendo esta última producida por el consumo de huevos infectivos. Los cisticercos pueden desarrollarse en diferentes tejidos del hombre, frecuentemente en el sistema nervioso central causando la neurocisticercosis (NCC). Para el diagnóstico de la NCC se requiere de una adecuada interpretación de datos clínicos, resultados de neuroimagen y pruebas serológicas. Sin embargo, l (more) as pruebas serológicas podrían mejorarse con el desarrollo de antígenos candidatos capaces de incrementar su sensibilidad y especificidad. En los últimos años se han descrito una serie de proteínas de superficie y de secreción de T. solium esenciales para la interacción parásito-hospedero. Una de estas familias son las cisteínoproteasas catepsinas L, las cuales cumplen un rol preponderante para el desarrollo y supervivencia del parásito, participando en la invasión tisular, la evasión de la respuesta inmune, el desenquistamiento y enquistamiento del cisticerco. Son consideradas como antígenos potenciales para el inmunodiagnóstico de la neurocisticercosis. Abstract in english Taenia solium is a plane helminth responsible for taeniasis and human cysticercosis, the latter being the result of the consumption of infective eggs. Cysticerci can develop in different human tissues, often in the central nervous system, causing neurocysticercosis (NCC). For the diagnosis of NCC, an adequate interpretation of clinical data, neuroimaging results and serological tests are required. However, serological tests could be improved by developing candidate antige (more) ns able to increase their sensibility and specificity. In the last years, a series of surface and secretory proteins of T. solium essential for the parasite-host interaction have been described. One of these families is cathepsin L cysteine proteases, which have a predominant role in the development and survival of the parasite. They take part in the tissue invasion, immune response evasion, excystation and encystment of cysticercus. They are considered potential antigens for the immunodiagnosis of neurocysticercosis.

León, Nancy; Padilla, Carlos; Pajuelo, Mónica; Sheen, Patricia; Zimic, Mirko

2013-09-01

216

Anti-Taenia solium metacestodes antibodies in serum from blood donors from four cities of Triângulo Mineiro area, Minas Gerais, Brazil, 1995  

Directory of Open Access Journals (Sweden)

Full Text Available Serological survey was performed to detect IgG antibodies anti-Taenia solium metacestodes in blood donors of Hemocentro Regional de Uberlândia, Minas Gerais, Brazil. A total of 1133 sera from blood donors coming from four cities of Triângulo Mineiro area were analyzed by the indirect fluorescence antibody test (IFAT) and the enzyme linked immunosorbent assay (ELISA). Specific IgG antibodies were found in 5.6% of the studied population, showing differences in the positive rates according to their origin: Araguari (13.5%), Tupaciguara (5.0%), Monte Alegre de Minas (4.8%) and Uberlândia (4.7%). The results indicate the probable endemicity of cysticercosis in this population.

SILVEIRA-LACERDA Elisângela de Paula; MACHADO Eleuza Rodrigues; ARANTES Sílvio César de Freitas; COSTA-CRUZ Julia Maria

2002-01-01

217

Taenia solium metacestode immunodominant peptides recognized by IgG antibodies in cerebrospinal fluid and serum paired samples from patients with active and inactive neurocysticercosis  

Directory of Open Access Journals (Sweden)

Full Text Available The aim of this study was to test if serological distinction between patients with active and inactive neurocysticercosis (NCC), could be accomplished by the recognition of immunodominant peptides in total saline antigenic extract of Taenia solium metacestodes by IgG antibody in cerebrospinal fluid (CSF) and serum paired samples. CSF and serum samples of 10 each, active NCC patients, inactive NCC, and individuals with other neurological disorders, were used to recognize the antigenic peptides by western blot (WB). In the active NCC the 28-32 and 39-42 kDa peptides were more frequently detected in CSF than in sera (p 80 kDa) for diagnosis of NCC. The final conclusions were that the difference between active and inactive NCC may be done with the detection of peptides only in the CSF samples and that the 47-52, 64-68, and 70 kDa bands may be included as specific markers for active NCC when detected in CSF samples by WB using total saline extract of T. solium metacestode.

Ivanildes Solange da Costa Barcelos; Leandro Pajuaba de Moura; Vinicius Paulino da Costa; Marcelo Simão Ferreira; Julia Maria Costa-Cruz

2007-01-01

218

Taenia solium metacestode immunodominant peptides recognized by IgG antibodies in cerebrospinal fluid and serum paired samples from patients with active and inactive neurocysticercosis  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english The aim of this study was to test if serological distinction between patients with active and inactive neurocysticercosis (NCC), could be accomplished by the recognition of immunodominant peptides in total saline antigenic extract of Taenia solium metacestodes by IgG antibody in cerebrospinal fluid (CSF) and serum paired samples. CSF and serum samples of 10 each, active NCC patients, inactive NCC, and individuals with other neurological disorders, were used to recognize t (more) he antigenic peptides by western blot (WB). In the active NCC the 28-32 and 39-42 kDa peptides were more frequently detected in CSF than in sera (p 80 kDa) for diagnosis of NCC. The final conclusions were that the difference between active and inactive NCC may be done with the detection of peptides only in the CSF samples and that the 47-52, 64-68, and 70 kDa bands may be included as specific markers for active NCC when detected in CSF samples by WB using total saline extract of T. solium metacestode.

Barcelos, Ivanildes Solange da Costa; Moura, Leandro Pajuaba de; Costa, Vinicius Paulino da; Ferreira, Marcelo Simão; Costa-Cruz, Julia Maria

2007-09-01

219

Release of Glycoprotein (GP1) from the Tegumental Surface of Taenia solium by Phospholipase C from Clostridium perfringens Suggests a Novel Protein-Anchor to Membranes  

Directory of Open Access Journals (Sweden)

Full Text Available In order to explore how molecules are linked to the membrane surface in larval Taenia solium, whole cysticerci were incubated in the presence of phospholipase C from Clostridium perfringens (PLC). Released material was collected and analyzed in polyacrylamide gels with sodium dodecyl sulfate. Two major bands with apparent molecular weights of 180 and 43?kDa were observed. Western blot of released material and localization assays in cysticerci tissue sections using antibodies against five known surface glycoproteins of T. solium cysticerci indicated that only one, previously called GP1, was released. Similar localization studies using the lectins wheat-germ-agglutinin and Concanavalin A showed that N-acetyl-D-glucosamine, N-acetylneuraminic, sialic acid, ?methyl-D-mannoside, D-manose/glucose, and N-acetyl-D-glucosamine residues are abundantly present on the surface. On the other hand, we find that treatment with PLC releases molecules from the surface; they do not reveal Cross Reacting Determinant (CRD), suggesting a novel anchor to the membrane for the glycoprotein GP1.

Abraham Landa; Kaethe Willms; Juan Pedro Laclette

2010-01-01

220

Anti-Taenia solium metacestodes antibodies in serum from blood donors from four cities of Triângulo Mineiro area, Minas Gerais, Brazil, 1995 Anticorpos anti-formas metacestódeas de Taenia solium em amostras de soros de doadores de sangue de quatro cidades da região do Triângulo Mineiro, Minas Gerais, Brasil, 1995  

Directory of Open Access Journals (Sweden)

Full Text Available Serological survey was performed to detect IgG antibodies anti-Taenia solium metacestodes in blood donors of Hemocentro Regional de Uberlândia, Minas Gerais, Brazil. A total of 1133 sera from blood donors coming from four cities of Triângulo Mineiro area were analyzed by the indirect fluorescence antibody test (IFAT) and the enzyme linked immunosorbent assay (ELISA). Specific IgG antibodies were found in 5.6% of the studied population, showing differences in the positive rates according to their origin: Araguari (13.5%), Tupaciguara (5.0%), Monte Alegre de Minas (4.8%) and Uberlândia (4.7%). The results indicate the probable endemicity of cysticercosis in this population.Realizou-se pesquisa sorológica para detectar anticorpos IgG anti-formas metacestódeas de Taenia solium em doadores de sangue do Hemocentro Regional de Uberlândia, Minas Gerais, Brasil. O total de 1133 amostras de soros de doadores de sangue de quatro cidades do Triângulo Mineiro foi analisado pelo teste de imunofluorescência indireta (IFI) e o teste imunoenzimático (ELISA). Anticorpos IgG específicos foram detectados em 5,6% da população estudada, mostrando diferenças nas taxas de positividade de acordo com suas cidades de origens: Araguari (13,5%), Tupaciguara (5,0%), Monte Alegre de Minas (4,8%) e Uberlândia (4,7%). Os resultados indicam a provável endemicidade de cisticercose nesta população.

Elisângela de Paula SILVEIRA-LACERDA; Eleuza Rodrigues MACHADO; Sílvio César de Freitas ARANTES; Julia Maria COSTA-CRUZ

2002-01-01

 
 
 
 
221

Anti-Taenia solium metacestodes antibodies in serum from blood donors from four cities of Triângulo Mineiro area, Minas Gerais, Brazil, 1995/ Anticorpos anti-formas metacestódeas de Taenia solium em amostras de soros de doadores de sangue de quatro cidades da região do Triângulo Mineiro, Minas Gerais, Brasil, 1995  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Realizou-se pesquisa sorológica para detectar anticorpos IgG anti-formas metacestódeas de Taenia solium em doadores de sangue do Hemocentro Regional de Uberlândia, Minas Gerais, Brasil. O total de 1133 amostras de soros de doadores de sangue de quatro cidades do Triângulo Mineiro foi analisado pelo teste de imunofluorescência indireta (IFI) e o teste imunoenzimático (ELISA). Anticorpos IgG específicos foram detectados em 5,6% da população estudada, mostrando dife (more) renças nas taxas de positividade de acordo com suas cidades de origens: Araguari (13,5%), Tupaciguara (5,0%), Monte Alegre de Minas (4,8%) e Uberlândia (4,7%). Os resultados indicam a provável endemicidade de cisticercose nesta população. Abstract in english Serological survey was performed to detect IgG antibodies anti-Taenia solium metacestodes in blood donors of Hemocentro Regional de Uberlândia, Minas Gerais, Brazil. A total of 1133 sera from blood donors coming from four cities of Triângulo Mineiro area were analyzed by the indirect fluorescence antibody test (IFAT) and the enzyme linked immunosorbent assay (ELISA). Specific IgG antibodies were found in 5.6% of the studied population, showing differences in the positiv (more) e rates according to their origin: Araguari (13.5%), Tupaciguara (5.0%), Monte Alegre de Minas (4.8%) and Uberlândia (4.7%). The results indicate the probable endemicity of cysticercosis in this population.

SILVEIRA-LACERDA, Elisângela de Paula; MACHADO, Eleuza Rodrigues; ARANTES, Sílvio César de Freitas; COSTA-CRUZ, Julia Maria

2002-07-01

222

Neurocysticercosis: detection of IgG, IgA and IgE antibodies in cerebrospinal fluid, serum and saliva samples by ELISA with Taenia solium and Taenia crassiceps antigens  

Directory of Open Access Journals (Sweden)

Full Text Available We assayed samples of cerebrospinal fluid (CSF), serum and saliva from patients with neurocysticercoses, control group and individuals with other parasitoses, by ELISA with Taenia crassiceps vesicular fluid antigen (Tcra) and Taenia solium total antigen (Tso) for the detection of antibodies. The sensitivity for IgG-Tcra was 100% for CSF and serum, and 32.0% for saliva; and for IgG-Tso 100% for CSF, 80.0% for serum and 24.% for saliva. Specificity was 100% for CSF and 80.0% for serum with both antigens, and 100% for saliva with Tcra and 87.5% with Tso. The sensitivity and specificity for IgA-Tcra was, respectively, 40.0% and 100% for CSF, 36.0% and 97.1% for serum, and 4.0% and 90.0% for saliva. IgE detection showed 24.0% sensitivity and 97.1% specificity for serum, with no detection in CSF samples. The search for antibodies revealed the presence of IgG > IgA > IgE in CSF, serum and saliva samples, with IgG being present in all phases of the disease, while IgA/IgE were more frequent in the inactive form.

BUENO EDNÉIA CASAGRANDA; VAZ ADELAIDE JOSÉ; MACHADO LUÍS DOS RAMOS; LIVRAMENTO JOSÉ ANTONIO

2000-01-01

223

Evaluation of an IgG-ELISA strategy using Taenia solium metacestode somatic and excretory-secretory antigens for diagnosis of neurocysticercosis revealing biological stage of the larvae.  

UK PubMed Central (United Kingdom)

Diagnosis of neurocysticercosis (NCC) is complicated because of the variability in clinical presentations and course of the disease where viability of parasite is a major determinant. The present study describes evaluation of ELISAs using Taenia solium metacestode somatic and excretory-secretory (ES) antigens for detection of anti-T. solium metacestode IgG antibodies in serum and cerebrospinal fluid (CSF). And results of the ELISAs in cases with a definitive diagnosis of NCC are correlated with the biological stages of the parasite such as live vesicular or degenerated stage. The sensitivity of the IgG-ELISA using ES antigen is observed to be much higher in serum (88.2%) than in CSF (64.28%) although it is only marginally higher in serum (76.4%) than in CSF (75%) when somatic antigen is used in the ELISA. Whereas, the specificities of the ELISA using either somatic or ES antigen for detection of IgG antibodies in serum (97.97%; 96.96%) and CSF (96.42%; 97.61%) are comparable. A strong association is observed between live stage of the parasite and detection of antibodies in sera and CSF from more number of NCC patients by ELISA using ES antigens. Similarly, detection of antibodies by ELISA using somatic antigens could be associated with the dead or degenerated stage of the parasite in brain. The IgG-ELISA strategy developed in the present study opens up an avenue for diagnosis of NCC in hospitals or in population prevalence studies. The use of crude extracts of ES proteins might improve the serodiagnosis of the cases of NCC carrying live vesicular stage of the parasite larvae.

Sahu PS; Parija SC; Narayan SK; Kumar D

2009-04-01

224

Anti-Taenia solium metacestode IgG antibodies in serum samples from inhabitants of a central-western region of Brazil/ Anticorpos IgG anti-metacestódeo de Taenia solium em amostras de soro de habitantes da região centro-oeste do Brasil  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Um total de 354 amostras de soro de habitantes que freqüentaram o Laboratório Clínico em Catalão, Goiás, na região centro-oeste do Brasil, foram colhidas no período de junho a agosto de 2002. As amostras foram avaliadas pelo teste de imunofluorescência indireta e enzyme-linked immunosorbent assay (ELISA) com o objetivo de detectar anticorpos IgG anti-metacestódeo de Taenia solium. As amostras reativas e inconclusivas foram testadas pelo Western blotting (WB). Con (more) siderando WB como reação confirmatória, a freqüência de anticorpos nas amostras de soro da população estudada foi 11,3% (IC: 5,09 - 17,51). As bandas imunodominantes mais frequentemente reconhecidas no WB foram 64-68 kDa (97,5%) e 47-52 kDa (80%). A porcentagem de soropositividade para cisticercose foi significativamente maior nos indivíduos que residiam em áreas sem sistema de esgoto (p Abstract in english A total of 354 serum samples from inhabitants who frequent the Clinical Laboratory in Catalão, Goiás, in the central-western region of Brazil, were collected from June to August, 2002. The samples were evaluated by indirect immunofluorescence antibody tests and an enzyme linked immunosorbent assay in order to detect anti-Taenia solium metacestode IgG antibodies. Reactive and inconclusive samples were tested by Western blotting (WB). Considering WB as a confirmation, the (more) frequency of antibodies in the serum samples of the above population was 11.3% (CI 5.09 - 17.51). The immunodominant bands most frequently recognized in WB were 64-68 kDa (97.5%) and 47-52 kDa (80%). The percentage of seropositivity to cysticercosis was significantly higher for individuals residing in areas without sewage systems (p

Oliveira, Heliana B. de; Rodrigues, Rosângela M.; Barcelos, Ivanildes S. C.; Silva, Luciana P.; Costa-Cruz, Julia M.

2006-02-01

225

Anti-Taenia solium metacestode IgG antibodies in serum samples from inhabitants of a central-western region of Brazil Anticorpos IgG anti-metacestódeo de Taenia solium em amostras de soro de habitantes da região centro-oeste do Brasil  

Directory of Open Access Journals (Sweden)

Full Text Available A total of 354 serum samples from inhabitants who frequent the Clinical Laboratory in Catalão, Goiás, in the central-western region of Brazil, were collected from June to August, 2002. The samples were evaluated by indirect immunofluorescence antibody tests and an enzyme linked immunosorbent assay in order to detect anti-Taenia solium metacestode IgG antibodies. Reactive and inconclusive samples were tested by Western blotting (WB). Considering WB as a confirmation, the frequency of antibodies in the serum samples of the above population was 11.3% (CI 5.09 - 17.51). The immunodominant bands most frequently recognized in WB were 64-68 kDa (97.5%) and 47-52 kDa (80%). The percentage of seropositivity to cysticercosis was significantly higher for individuals residing in areas without sewage systems (p Um total de 354 amostras de soro de habitantes que freqüentaram o Laboratório Clínico em Catalão, Goiás, na região centro-oeste do Brasil, foram colhidas no período de junho a agosto de 2002. As amostras foram avaliadas pelo teste de imunofluorescência indireta e enzyme-linked immunosorbent assay (ELISA) com o objetivo de detectar anticorpos IgG anti-metacestódeo de Taenia solium. As amostras reativas e inconclusivas foram testadas pelo Western blotting (WB). Considerando WB como reação confirmatória, a freqüência de anticorpos nas amostras de soro da população estudada foi 11,3% (IC: 5,09 - 17,51). As bandas imunodominantes mais frequentemente reconhecidas no WB foram 64-68 kDa (97,5%) e 47-52 kDa (80%). A porcentagem de soropositividade para cisticercose foi significativamente maior nos indivíduos que residiam em áreas sem sistema de esgoto (p < 0,0001). Concluiu-se que os resultados indicam uma provável situação de endemicidade para cisticercose nesta população, reforçando a urgente necessidade de medidas de controle e prevenção que devem ser implantadas pelo serviço de saúde pública local.

Heliana B. de Oliveira; Rosângela M. Rodrigues; Ivanildes S. C. Barcelos; Luciana P. Silva; Julia M. Costa-Cruz

2006-01-01

226

Antibody specific to 43kDa excretory-secretory antigenic peptide of Taenia solium metacestode as a potential diagnostic marker in human neurocysticercosis.  

UK PubMed Central (United Kingdom)

Recent studies suggest excretory-secretory (ES) antigen specific antibody detection tests to be of promising utility in laboratory diagnosis of many parasitic diseases in human including neurocysticercosis (NCC). The objective of the present study was to characterize the ES antigens collected from in vitro culture of Taenia solium metacestode larvae, and to identify specific ES peptides as diagnostic markers. Three ES peptides viz., 67kDa, 43kDa and 32kDa, were found to be diagnostic for NCC based on high sensitivity and specificity of their reactivity to either serum or cerebrospinal fluid (CSF) specimens. More remarkably, the 43kDa ES peptide was found reactive with CSF and serum specimens from confirmed NCC patients with absolute specificity and a high sensitivity (88.23% in serum and 89.28% in CSF). This peptide was also detected by sera and CSF from clinically suspected NCC patients but with a decreased sensitivity correlating with the decreasing order of the certainty of diagnosis as per a criteria proposed earlier. The 43kDa ES peptide is suggested to be an important peptide of diagnostic utility in NCC.

Sahu PS; Parija SC; Jayachandran S

2010-09-01

227

Structural and biochemical studies of a recombinant 25.5 kDa glutathione transferase of Taenia solium metacestode (rTs25GST1-1).  

UK PubMed Central (United Kingdom)

In this work, we studied a recombinant mu-class glutathione transferase of 25.5 kDa from Taenia solium metacestode (rTs25GST1-1) that follows Michaelis-Menten kinetics with 1-chloro-2,4-dinitrobenzene (CDNB). The kinetic parameters obtained for rTs25GST1-1 with CDNB and GSH were V max ?=?12.04 ?mol/min/mg and Km?=?1.38 mM, and V max ?=?10.20 ?mol/min/mg and Km?=?0.90, respectively. The optimal activity was found at pH 8 in the 37-40 °C temperature range. Circular dichroism studies for rTs25GST1-1 at different pH showed that it maintains a typical ?-helix structure between pH 6.5-7.5, but loses it between pH 8 and 8.5. Thermal CD assays showed rTs25GST1-1 barely changed its secondary structure. Unfolding/refolding assays showed that rTs25GST1-1 retained its structure up to 40 °C without loss of its activity. Additionally, exposure of rTs25GST1-1 to cumene hydroperoxide did not produce significant changes in its structure and only affected 50 % of its activity.

Roldan A; Torres-Rivera A; Landa A

2013-08-01

228

Anti-Taenia solium metacestode IgG antibodies in serum samples from inhabitants of a central-western region of Brazil  

Directory of Open Access Journals (Sweden)

Full Text Available A total of 354 serum samples from inhabitants who frequent the Clinical Laboratory in Catalão, Goiás, in the central-western region of Brazil, were collected from June to August, 2002. The samples were evaluated by indirect immunofluorescence antibody tests and an enzyme linked immunosorbent assay in order to detect anti-Taenia solium metacestode IgG antibodies. Reactive and inconclusive samples were tested by Western blotting (WB). Considering WB as a confirmation, the frequency of antibodies in the serum samples of the above population was 11.3% (CI 5.09 - 17.51). The immunodominant bands most frequently recognized in WB were 64-68 kDa (97.5%) and 47-52 kDa (80%). The percentage of seropositivity to cysticercosis was significantly higher for individuals residing in areas without sewage systems (p < 0.0001). In conclusion, the results indicate a probable endemic situation of cysticercosis in this population. These results reinforce the urgent need for control and prevention measures to be taken by the local public health services.

Oliveira Heliana B. de; Rodrigues Rosângela M.; Barcelos Ivanildes S. C.; Silva Luciana P.; Costa-Cruz Julia M.

2006-01-01

229

Evaluation of two Taenia solium cysticercal antigenic preparations (vesicular fluid and a glycoprotein fraction with affinity for lentil lectin) for the immunodiagnosis of neurocysticercosis by enzyme-linked immunosorbent assay (ELISA) Avaliação de duas preparações antigênicas de cisticercos de Taenia solium (líquido vesicular e uma fração glicoprotéica com afinidade para lentil lectina) para o imunodiagnóstico da neurocisticercose usando uma técnica imunoenzimática (ELISA)  

Directory of Open Access Journals (Sweden)

Full Text Available OBJECTIVE: To evaluate the performance of two antigenic preparations (vesicular fluid - VF and a glycoprotein fraction, LLa-Gp fraction, purified from a whole parasite extract by lentil lectin affinity chromatography) from Taenia solium cysticerci for the immunodiagnosis of neurocysticercosis. METHOD: Fifty-six cerebrospinal fluid (CSF) samples (22 from patients with neurocysticercosis and 34 from patients with other neurological disorders) and 57 serum samples (22 from patients with neurocysticercosis, 18 from patients with other infections and 17 from presumably healthy persons) were assayed for anticysticercal IgG antibodies with an enzyme-linked immunosorbent assay (ELISA). RESULTS: The VF ELISA showed 100% sensitivity and specificity in CSF and serum samples, whereas the sensitivity and specificity of the LLa-Gp ELISA were, respectively, 90.9% and 97.1%, with the CSF samples and 95.5% and 100% with serum samples. There was no significant difference in the sensitivity and specificity of the two antigenic preparations used to screen CSF and serum samples. CONCLUSION: Considering the complexity and high cost of obtaining the LLa-Gp fraction, VF could be more suitable for screening specific antibodies by ELISA in CSF and serum samples from patients with neurocysticercosis.OBJETIVO: Avaliar o desempenho de duas preparações antigênicas (líquido vesicular - LV e uma fração glicoprotéica, fração LL a-Gp, purificada do extrato total dos parasitas por cromatografia de afinidade com lentil lectina) de cisticercos de Taenia solium para o imunodiagnóstico da neurocisticercose. MÉTODO: Cinquenta e seis amostras de líquido cefalorraquidiano (LCR) (22 de pacientes com neurocisticercose e 34 de pacientes com outras doenças neurológicas) e 57 amostras de soro (22 de pacientes com neurocisticercose, 18 de pacientes com outras infecções e 17 de pessoas presumivelmente sadias) foram analisadas quanto à presença de anticorpos IgG anti-cisticercos com uma reação imunoenzimática (ELISA). RESULTADOS: A reação ELISA LV apresentou 100% de sensibilidade e especificidade em amostras de LCR e soro, enquanto a sensibilidade e a especificidade da reação ELISA LLa-Gp em amostras de LCR e soro foram de 90,9% e 97,1% e 95,5% e 100%, respectivamente. Não foram encontradas diferenças significativas na sensibilidade e especificidade das duas preparações antigênicas utilizadas, tanto para amostras de LCR como para amostras de soro. CONCLUSÃO: Considerando a complexidade e o alto custo de obtenção da fração LLa-Gp, o LV pode ser mais adequado para a pesquisa de anticorpos específicos por ELISA em amostras de LCR e soro de pacientes com neurocisticercose.

Lisandra Akemi Suzuki; Cláudio Lúcio Rossi

2011-01-01

230

Evaluation of two Taenia solium cysticercal antigenic preparations (vesicular fluid and a glycoprotein fraction with affinity for lentil lectin) for the immunodiagnosis of neurocysticercosis by enzyme-linked immunosorbent assay (ELISA)/ Avaliação de duas preparações antigênicas de cisticercos de Taenia solium (líquido vesicular e uma fração glicoprotéica com afinidade para lentil lectina) para o imunodiagnóstico da neurocisticercose usando uma técnica imunoenzimática (ELISA)  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese OBJETIVO: Avaliar o desempenho de duas preparações antigênicas (líquido vesicular - LV e uma fração glicoprotéica, fração LL a-Gp, purificada do extrato total dos parasitas por cromatografia de afinidade com lentil lectina) de cisticercos de Taenia solium para o imunodiagnóstico da neurocisticercose. MÉTODO: Cinquenta e seis amostras de líquido cefalorraquidiano (LCR) (22 de pacientes com neurocisticercose e 34 de pacientes com outras doenças neurológicas) e (more) 57 amostras de soro (22 de pacientes com neurocisticercose, 18 de pacientes com outras infecções e 17 de pessoas presumivelmente sadias) foram analisadas quanto à presença de anticorpos IgG anti-cisticercos com uma reação imunoenzimática (ELISA). RESULTADOS: A reação ELISA LV apresentou 100% de sensibilidade e especificidade em amostras de LCR e soro, enquanto a sensibilidade e a especificidade da reação ELISA LLa-Gp em amostras de LCR e soro foram de 90,9% e 97,1% e 95,5% e 100%, respectivamente. Não foram encontradas diferenças significativas na sensibilidade e especificidade das duas preparações antigênicas utilizadas, tanto para amostras de LCR como para amostras de soro. CONCLUSÃO: Considerando a complexidade e o alto custo de obtenção da fração LLa-Gp, o LV pode ser mais adequado para a pesquisa de anticorpos específicos por ELISA em amostras de LCR e soro de pacientes com neurocisticercose. Abstract in english OBJECTIVE: To evaluate the performance of two antigenic preparations (vesicular fluid - VF and a glycoprotein fraction, LLa-Gp fraction, purified from a whole parasite extract by lentil lectin affinity chromatography) from Taenia solium cysticerci for the immunodiagnosis of neurocysticercosis. METHOD: Fifty-six cerebrospinal fluid (CSF) samples (22 from patients with neurocysticercosis and 34 from patients with other neurological disorders) and 57 serum samples (22 from p (more) atients with neurocysticercosis, 18 from patients with other infections and 17 from presumably healthy persons) were assayed for anticysticercal IgG antibodies with an enzyme-linked immunosorbent assay (ELISA). RESULTS: The VF ELISA showed 100% sensitivity and specificity in CSF and serum samples, whereas the sensitivity and specificity of the LLa-Gp ELISA were, respectively, 90.9% and 97.1%, with the CSF samples and 95.5% and 100% with serum samples. There was no significant difference in the sensitivity and specificity of the two antigenic preparations used to screen CSF and serum samples. CONCLUSION: Considering the complexity and high cost of obtaining the LLa-Gp fraction, VF could be more suitable for screening specific antibodies by ELISA in CSF and serum samples from patients with neurocysticercosis.

Suzuki, Lisandra Akemi; Rossi, Cláudio Lúcio

2011-06-01

231

Immunological variation in Taenia solium porcine cysticercosis: Measurement on the variation of the antibody immune response of naturally infected pigs against antigens extracted from their own cysticerci and from those of different pigs.  

UK PubMed Central (United Kingdom)

Although it is widely assumed that both antigen and host immunological variability are involved in the variable intensity of natural porcine infections by Taenia solium (T. solium) cysticercis and success of immunodiagnostic tests vaccines, the magnitude of such combined variability has not been studied or measured at all. In this paper we report statistical data on the variability of the antibody response of naturally infected pigs against the antigens extracted from the vesicular fluids of their own infecting cysts (variance within pigs) and against antigen samples extracted from cysts of other cysticercotic pigs (variance among pigs). The variation between pigs was greater than the inter-pigs variations, which suggests that a concomitant immunity process prevents the establishment of cysts coming from a subsequent challenge. In so doing, we found that there is not a single antigenic band that was recognized by all hosts and that antigens varied among the cysts within the same pigs as well as among pigs. Our results may be valuable for the improvement of immunodiagnostic tests and of effective vaccines against naturally acquired porcine T. solium cysticercosis.

Ostoa-Saloma P; Esquivel-Velázquez M; Larralde C

2013-10-01

232

Immunological variation in Taenia solium porcine cysticercosis: Measurement on the variation of the antibody immune response of naturally infected pigs against antigens extracted from their own cysticerci and from those of different pigs.  

Science.gov (United States)

Although it is widely assumed that both antigen and host immunological variability are involved in the variable intensity of natural porcine infections by Taenia solium (T. solium) cysticercis and success of immunodiagnostic tests vaccines, the magnitude of such combined variability has not been studied or measured at all. In this paper we report statistical data on the variability of the antibody response of naturally infected pigs against the antigens extracted from the vesicular fluids of their own infecting cysts (variance within pigs) and against antigen samples extracted from cysts of other cysticercotic pigs (variance among pigs). The variation between pigs was greater than the inter-pigs variations, which suggests that a concomitant immunity process prevents the establishment of cysts coming from a subsequent challenge. In so doing, we found that there is not a single antigenic band that was recognized by all hosts and that antigens varied among the cysts within the same pigs as well as among pigs. Our results may be valuable for the improvement of immunodiagnostic tests and of effective vaccines against naturally acquired porcine T. solium cysticercosis. PMID:23953147

Ostoa-Saloma, Pedro; Esquivel-Velázquez, Marcela; Larralde, Carlos

2013-07-19

233

Estudio de la respuesta inmune humoral en cerdos infectados con huevos y posoncosferas de Taeina solium/ Study on immune humoral response in pigs infected with eggs and posoncospheresof Taenia solium  

Scientific Electronic Library Online (English)

Full Text Available Abstract in english Due to the importance of cysticercosis in Mexico and Latin America and to the fact that in the last years another mechanism of infection for this disease has been proposed, i.e. through postoncospheres and immunosuppression of the host, we have considered relevant to perform the present work, which consisted in assessing the immune response induced by dexamethasone as well as that produced by parasites in pigs infected with T. solium eggs, or postoncosphere-infected, and (more) in postoncosphere-infected and dexamethasone-treated animals. We used 10 recently weaned pigs, three were used as controls, two of them without the drug and one with it; two were infected with T. solium eggs; five with postoncospheres receiving also dexamethasone three of them.We evaluated the humoral response against parasite antigen using indirect haemagglutination (IH) and ELISA methods Results of the immune humoral response revealed titres of up to 1:128 in T. solium eggs infected animals, of 1:16 in postoncosphere infected animals, and of 1:32 towards the end of the experiment in postoncosphere plus dexamethasone animals. Absorbance titres with ELISA confirmed these findings. Data obtained by IH show that the antibody titres of the pigs challenged with postoncospheres and postoncospheres plus dexamethasone are positive as compared to the titres obtained in the pigs infected with T. solium eggs. Results from the ELISA confirmed this finding, since, from weeks 14 to 17, the pigs became positive, behaving as those pigs that developed cysticercosis. This is relevant as it indicates that the antiposcosphere antibodies recognized antigens of T. solium larvae.

Rojas Wastavino, Gloria; Tato Zaldívar, Patricia; SolanoGalvez, Sandra; Herrera Montalvo, Luis; Gutiérrez Quiroz, Manuel; SalazarSchettino, Paz

1999-07-01

234

Estudio de la respuesta inmune humoral en cerdos infectados con huevos y posoncosferas de Taeina solium Study on immune humoral response in pigs infected with eggs and posoncospheresof Taenia solium  

Directory of Open Access Journals (Sweden)

Full Text Available Due to the importance of cysticercosis in Mexico and Latin America and to the fact that in the last years another mechanism of infection for this disease has been proposed, i.e. through postoncospheres and immunosuppression of the host, we have considered relevant to perform the present work, which consisted in assessing the immune response induced by dexamethasone as well as that produced by parasites in pigs infected with T. solium eggs, or postoncosphere-infected, and in postoncosphere-infected and dexamethasone-treated animals. We used 10 recently weaned pigs, three were used as controls, two of them without the drug and one with it; two were infected with T. solium eggs; five with postoncospheres receiving also dexamethasone three of them.We evaluated the humoral response against parasite antigen using indirect haemagglutination (IH) and ELISA methods Results of the immune humoral response revealed titres of up to 1:128 in T. solium eggs infected animals, of 1:16 in postoncosphere infected animals, and of 1:32 towards the end of the experiment in postoncosphere plus dexamethasone animals. Absorbance titres with ELISA confirmed these findings. Data obtained by IH show that the antibody titres of the pigs challenged with postoncospheres and postoncospheres plus dexamethasone are positive as compared to the titres obtained in the pigs infected with T. solium eggs. Results from the ELISA confirmed this finding, since, from weeks 14 to 17, the pigs became positive, behaving as those pigs that developed cysticercosis. This is relevant as it indicates that the antiposcosphere antibodies recognized antigens of T. solium larvae.

Gloria Rojas Wastavino; Patricia Tato Zaldívar; Sandra SolanoGalvez; Luis Herrera Montalvo; Manuel Gutiérrez Quiroz; Paz SalazarSchettino

1999-01-01

235

A New Parasiticidal Compound in T. solium Cysticercosis  

Digital Repository Infrastructure Vision for European Research (DRIVER)

The effect of 16?-bromoepiandrosterone (EpiBr), a dehydroepiandrosterone (DHEA) analogue, was tested on the cysticerci of Taenia solium, both in vitro and in vivo. In vitro treatment of T. solium cultures with EpiBr reduced scolex evagination, growth, motility, and viability in dose- and time-depend...

Hernández-Bello, Romel; Escobedo, Galileo; Carrero, Julio Cesar; Cervantes-Rebolledo, Claudia; Dowding, Charles

236

Molecular Approaches to Taenia asiatica  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taenia solium, T. saginata, and T. asiatica are taeniid tapeworms that cause taeniasis in humans and cysticercosis in intermediate host animals. Taeniases remain an important public health concerns in the world. Molecular diagnostic methods using PCR assays have been developed for rapid and accurate...

Jeon, Hyeong-Kyu; Eom, Keeseon S.

237

2D-PAGE analysis of Taenia solium metacestode 10-30 kDa antigens for the serodiagnosis of neurocysticercosis in children.  

UK PubMed Central (United Kingdom)

Neurocysticercosis (NCC) caused by T. solium metacestode is an increasingly important health issue in Indian children. The sensitivity and specificity of available serological techniques were low in case of single cysticercus granuloma cases which is a more common feature in Indian patients who are children. Serum samples were collected from 13 clinically and radiologically suggestive NCC children and seropositive by ELISA, 25 clinically and radiologically suggestive NCC children and seronegative by ELISA and 25 control subjects. The 10-30 kDa antigens of T. solium metacestode were subjected to 2-dimensional gel electrophoresis (2D-PAGE) followed by enzyme-linked immunoelectrotransfer blot (EITB) assay to detect antibody in serum. Analysis of 10-30 kDa antigenic fraction 2D-PAGE map showed 31 proteins between 10 and ?28 kDa and innumerable proteins between >28 and 30 kDa with the Isoelectric point of 3-10. All the 13 (100%) NCC seropositive and 15 (60%) out of 25 NCC seronegative samples were reactive with 2D fraction antigens. In the control group, none of the serum was reactive except 2 hydatid samples (92% specificity). The sensitivity and specificity of 2D-PAGE EITB assay were significantly higher than the ELISA which is the routine diagnostic method used in the endemic countries for the serodiagnosis of neurocysticercosis.

Atluri VS; Singhi PD; Khandelwal N; Malla N

2011-05-01

238

Taenia asiatica: the most neglected human Taenia and the possibility of cysticercosis.  

Science.gov (United States)

Not only Taenia solium and Taenia saginata, but also Taenia asiatica infects humans. The last species is not included in the evaluation of the specificity of the immunodiagnostic techniques for taeniasis/cysticercosis. There is currently no specific immunodiagnostic method for T. asiatica available. Therefore, due to the fact that molecular techniques (the only tool to distinguish the 3 Taenia species) are normally not employed in routine diagnostic methods, the 2 questions concerning T. asiatica (its definite geographic distribution and its ability to cause human cysticercosis), remain open, turning T. asiatica into the most neglected agent of human taeniasis-cysticercosis. PMID:23467406

Galán-Puchades, M Teresa; Fuentes, Mario V

2013-02-18

239

Taenia asiatica: the most neglected human Taenia and the possibility of cysticercosis.  

UK PubMed Central (United Kingdom)

Not only Taenia solium and Taenia saginata, but also Taenia asiatica infects humans. The last species is not included in the evaluation of the specificity of the immunodiagnostic techniques for taeniasis/cysticercosis. There is currently no specific immunodiagnostic method for T. asiatica available. Therefore, due to the fact that molecular techniques (the only tool to distinguish the 3 Taenia species) are normally not employed in routine diagnostic methods, the 2 questions concerning T. asiatica (its definite geographic distribution and its ability to cause human cysticercosis), remain open, turning T. asiatica into the most neglected agent of human taeniasis-cysticercosis.

Galán-Puchades MT; Fuentes MV

2013-02-01

240

Annotation of the transcriptome from Taenia pisiformis and its comparative analysis with three Taeniidae species.  

UK PubMed Central (United Kingdom)

BACKGROUND: Taenia pisiformis is one of the most common intestinal tapeworms and can cause infections in canines. Adult T. pisiformis (canines as definitive hosts) and Cysticercus pisiformis (rabbits as intermediate hosts) cause significant health problems to the host and considerable socio-economic losses as a consequence. No complete genomic data regarding T. pisiformis are currently available in public databases. RNA-seq provides an effective approach to analyze the eukaryotic transcriptome to generate large functional gene datasets that can be used for further studies. METHODOLOGY/PRINCIPAL FINDINGS: In this study, 2.67 million sequencing clean reads and 72,957 unigenes were generated using the RNA-seq technique. Based on a sequence similarity search with known proteins, a total of 26,012 unigenes (no redundancy) were identified after quality control procedures via the alignment of four databases. Overall, 15,920 unigenes were mapped to 203 Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways. Through analyzing the glycolysis/gluconeogenesis and axonal guidance pathways, we achieved an in-depth understanding of the biochemistry of T. pisiformis. Here, we selected four unigenes at random and obtained their full-length cDNA clones using RACE PCR. Functional distribution characteristics were gained through comparing four cestode species (72,957 unigenes of T. pisiformis, 30,700 ESTs of T. solium, 1,058 ESTs of Eg+Em [conserved ESTs between Echinococcus granulosus and Echinococcus multilocularis]), with the cluster of orthologous groups (COG) and gene ontology (GO) functional classification systems. Furthermore, the conserved common genes in these four cestode species were obtained and aligned by the KEGG database. CONCLUSION: This study provides an extensive transcriptome dataset obtained from the deep sequencing of T. pisiformis in a non-model whole genome. The identification of conserved genes may provide novel approaches for potential drug targets and vaccinations against cestode infections. Research can now accelerate into the functional genomics, immunity and gene expression profiles of cestode species.

Yang D; Fu Y; Wu X; Xie Y; Nie H; Chen L; Nong X; Gu X; Wang S; Peng X; Yan N; Zhang R; Zheng W; Yang G

2012-01-01

 
 
 
 
241

The nuclear 18S ribosomal RNA gene as a source of phylogenetic information in the genus Taenia.  

UK PubMed Central (United Kingdom)

Most species of the genus Taenia are of considerable medical and veterinary significance. In this study, complete nuclear 18S rRNA gene sequences were obtained from seven members of genus Taenia [Taenia multiceps, Taenia saginata, Taenia asiatica, Taenia solium, Taenia pisiformis, Taenia hydatigena, and Taenia taeniaeformis] and a phylogeny inferred using these sequences. Most of the variable sites fall within the variable regions, V1-V5. We show that sequences from the nuclear 18S ribosomal RNA gene have considerable promise as sources of phylogenetic information within the genus Taenia. Furthermore, given that almost all the variable sites lie within defined variable portions of that gene, it will be appropriate and economical to sequence only those regions for additional species of Taenia.

Yan H; Lou Z; Li L; Ni X; Guo A; Li H; Zheng Y; Dyachenko V; Jia W

2013-03-01

242

The nuclear 18S ribosomal RNA gene as a source of phylogenetic information in the genus Taenia.  

Science.gov (United States)

Most species of the genus Taenia are of considerable medical and veterinary significance. In this study, complete nuclear 18S rRNA gene sequences were obtained from seven members of genus Taenia [Taenia multiceps, Taenia saginata, Taenia asiatica, Taenia solium, Taenia pisiformis, Taenia hydatigena, and Taenia taeniaeformis] and a phylogeny inferred using these sequences. Most of the variable sites fall within the variable regions, V1-V5. We show that sequences from the nuclear 18S ribosomal RNA gene have considerable promise as sources of phylogenetic information within the genus Taenia. Furthermore, given that almost all the variable sites lie within defined variable portions of that gene, it will be appropriate and economical to sequence only those regions for additional species of Taenia. PMID:23183704

Yan, Hongbin; Lou, Zhongzi; Li, Li; Ni, Xingwei; Guo, Aijiang; Li, Hongmin; Zheng, Yadong; Dyachenko, Viktor; Jia, Wanzhong

2012-11-25

243

Epidemiological understanding of Taenia tapeworm infections with special reference to Taenia asiatica in Korea  

Digital Repository Infrastructure Vision for European Research (DRIVER)

In endemic areas of Taenia tapeworms in Korea, most of the reports showed that T. saginata was dominant over T. solium, but eating pigs is the dominant habit over eating cattle. Why do they have more T. saginata despite lower consumption of beef? This problem actually has long been recognized but un...

Eom, Keeseon S.; Rim, Han-Jong

244

A New Parasiticidal Compound in T. solium Cysticercosis  

Science.gov (United States)

The effect of 16?-bromoepiandrosterone (EpiBr), a dehydroepiandrosterone (DHEA) analogue, was tested on the cysticerci of Taenia solium, both in vitro and in vivo. In vitro treatment of T. solium cultures with EpiBr reduced scolex evagination, growth, motility, and viability in dose- and time-dependent fashions. Administration of EpiBr prior to infection with T. solium cysticerci in hamsters reduced the number and size of developed taenias in the intestine, compared with controls. These effects were associated to an increase in splenocyte proliferation in infected hamsters. These results leave open the possibility of assessing the potential of this hormonal analogue as a possible antiparasite drug, particularly in cysticercosis and taeniosis.

Hernandez-Bello, Romel; Escobedo, Galileo; Carrero, Julio Cesar; Cervantes-Rebolledo, Claudia; Dowding, Charles; Frincke, James; Reading, Chris; Morales-Montor, Jorge

2013-01-01

245

A new parasiticidal compound in T. solium cysticercosis.  

UK PubMed Central (United Kingdom)

The effect of 16?-bromoepiandrosterone (EpiBr), a dehydroepiandrosterone (DHEA) analogue, was tested on the cysticerci of Taenia solium, both in vitro and in vivo. In vitro treatment of T. solium cultures with EpiBr reduced scolex evagination, growth, motility, and viability in dose- and time-dependent fashions. Administration of EpiBr prior to infection with T. solium cysticerci in hamsters reduced the number and size of developed taenias in the intestine, compared with controls. These effects were associated to an increase in splenocyte proliferation in infected hamsters. These results leave open the possibility of assessing the potential of this hormonal analogue as a possible antiparasite drug, particularly in cysticercosis and taeniosis.

Hernández-Bello R; Escobedo G; Carrero JC; Cervantes-Rebolledo C; Dowding C; Frincke J; Reading C; Morales-Montor J

2013-01-01

246

A new parasiticidal compound in T. solium cysticercosis.  

Science.gov (United States)

The effect of 16?-bromoepiandrosterone (EpiBr), a dehydroepiandrosterone (DHEA) analogue, was tested on the cysticerci of Taenia solium, both in vitro and in vivo. In vitro treatment of T. solium cultures with EpiBr reduced scolex evagination, growth, motility, and viability in dose- and time-dependent fashions. Administration of EpiBr prior to infection with T. solium cysticerci in hamsters reduced the number and size of developed taenias in the intestine, compared with controls. These effects were associated to an increase in splenocyte proliferation in infected hamsters. These results leave open the possibility of assessing the potential of this hormonal analogue as a possible antiparasite drug, particularly in cysticercosis and taeniosis. PMID:23509732

Hernández-Bello, Romel; Escobedo, Galileo; Carrero, Julio Cesar; Cervantes-Rebolledo, Claudia; Dowding, Charles; Frincke, James; Reading, Chris; Morales-Montor, Jorge

2012-12-20

247

Taenia Antigens for Use as Immunodiagnostic Reagents for Bovine or Swine Cysticercosis.  

Science.gov (United States)

Cysticercosis is a parasitic disease of cattle and swine caused by the larval (cyst) stage of the tapeworm Taenia saginata in cattle and Taenia solium in swine. Ingestion by man of viable larvae in undercooked meat results in intestinal tapeworm infection...

D. S. Zarlenga M. L. Rhoads

1991-01-01

248

Molecular identification of Taenia tapeworms by Cox1 gene in Koh Kong, Cambodia.  

UK PubMed Central (United Kingdom)

We collected fecal samples from 21 individuals infected with Taenia tapeworms in Koh Kong Province, Cambodia, and performed nucleotide sequencing of the cox1 gene and multiplex PCR on the eggs for DNA differential diagnosis of human Taenia tapeworms. Genomic DNA was extracted from the eggs of a minimum number of 10 isolated from fecal samples. Using oligonucleotide primers Ta7126F, Ts7313F, Tso7466F, and Rev7915, the multiplex PCR assay proved useful for differentially diagnosing Taenia solium, Taenia saginata, and Taenia asiatica based on 706, 629, and 474 bp bands, respectively. All of the Taenia specimens from Kho Kong, Cambodia, were identified as either T. saginata (n=19) or T. solium (n=2) by cox1 sequencing and multiplex PCR.

Jeon HK; Yong TS; Sohn WM; Chai JY; Hong SJ; Han ET; Jeong HG; Chhakda T; Sinuon M; Socheat D; Eom KS

2011-06-01

249

Mixed cestode infection: an incidental association in an immunocompetent person.  

UK PubMed Central (United Kingdom)

Echinococcus and Taenia infection are the two most relevant forms of cestode infection in humans. These infections occur worldwide, but with higher prevalence in developing countries like India, where poor hygiene facilitates their transmission. We report a case of a middle-aged man who presented with seizures and was found to have dual worm infection including Taenia and Echinococcus. The patient was treated with steroids and albendazole followed by PAIR (puncture, aspiration, injection of scolicidal agent and reaspiration). After 6 months of follow-up, the patient is asymptomatic and seizure-free without any relapse.

Aggarwal P; Kumar G; Dev N; Jain S

2012-01-01

250

Molecular identification of species of Taenia causing bovine cysticercosis in Ethiopia.  

UK PubMed Central (United Kingdom)

Bovine cysticercosis causing damage to the beef industry is closely linked to human taeniasis due to Taenia saginata. In African countries, Taenia spp. from wildlife are also involved as possible sources of infections in livestock. To identify the aetiological agents of bovine cysticercosis in Ethiopia, cysticerci were collected from 41 cattle slaughtered in the eastern and central areas during 2010-2012. A single cysticercus per animal was subjected to the polymerase chain reaction (PCR)-based DNA sequencing of mitochondrial cytochrome c oxidase subunit 1 gene, and the resultant sequence was compared with those of members of the genus Taenia. Although 38 out of 41 cysticerci (92.7%) were identified as T. saginata, three samples (7.3%) showed the hitherto unknown sequences of Taenia sp., which is distantly related to Taenia solium, Taenia arctos and Taenia ovis. Old literatures suggest it to be Taenia hyaenae, but morphological identification of species could not be completed by observing only the larval samples.

Hailemariam Z; Nakao M; Menkir S; Lavikainen A; Iwaki T; Yanagida T; Okamoto M; Ito A

2013-03-01

251

First report of Taenia acinonyxi (Ortlopp, 1938) in Acinonyx jubatus venaticus from Iran.  

UK PubMed Central (United Kingdom)

The Asian cheetah is known as Iranian panther. A four years old female cheetah was killed in a road accident by a truck in Abbas Abad (Biarjamand) County around Shahrood City in Semnan Province, central part of Iran. Two days after the accident the carcass of animal was autopsied and only five cestodes were obtained from its intestine. In inspection of other organs no other helminth was observed. Cestod samples were fixed and stained by carmine acid. Characterization of the cestodes using morphological standard key, identified the cestodes as Taenia acinonyxi.

Hosseini Sh; Youssefi M; Mobedi I; Hosseini S; Zaheri B

2011-12-01

252

First Report of Taenia Acinonyxi (Ortlopp, 1938) in Acinonyx Jubatus Venaticus from Iran  

Directory of Open Access Journals (Sweden)

Full Text Available The Asian cheetah is known as Iranian panther. A four years old female cheetah was killed in a road accident by a truck in Abbas Abad (Biarjamand) County around Shahrood City in Sem­nan Province, central part of Iran. Two days after the accident the carcass of animal was autopsied and only five cestodes were obtained from its intestine. In inspection of other or­gans no other helminth was observed. Cestod samples were fixed and stained by carmine acid. Characterization of the cestodes using morphological standard key, identified the ces­todes as Taenia acinonyxi.

SH Hosseini; MR Youssefi; I Mobedi; SM Hosseini; BA Zaheri

2011-01-01

253

A loop-mediated isothermal amplification method for a differential identification of Taenia tapeworms from human: application to a field survey.  

UK PubMed Central (United Kingdom)

In this study, we applied a loop-mediated isothermal amplification method for identification of human Taenia tapeworms in Tibetan communities in Sichuan, China. Out of 51 proglottids recovered from 35 carriers, 9, 1, and 41 samples were identified as Taenia solium, Taenia asiatica and Taenia saginata, respectively. Same results were obtained afterwards in the laboratory, except one sample. These results demonstrated that the LAMP method enabled rapid identification of parasites in the field surveys, which suggested that this method would contribute to the control of Taenia infections in endemic areas.

Nkouawa A; Sako Y; Li T; Chen X; Nakao M; Yanagida T; Okamoto M; Giraudoux P; Raoul F; Nakaya K; Xiao N; Qiu J; Qiu D; Craig PS; Ito A

2012-12-01

254

A loop-mediated isothermal amplification method for a differential identification of Taenia tapeworms from human: application to a field survey.  

Science.gov (United States)

In this study, we applied a loop-mediated isothermal amplification method for identification of human Taenia tapeworms in Tibetan communities in Sichuan, China. Out of 51 proglottids recovered from 35 carriers, 9, 1, and 41 samples were identified as Taenia solium, Taenia asiatica and Taenia saginata, respectively. Same results were obtained afterwards in the laboratory, except one sample. These results demonstrated that the LAMP method enabled rapid identification of parasites in the field surveys, which suggested that this method would contribute to the control of Taenia infections in endemic areas. PMID:22698671

Nkouawa, Agathe; Sako, Yasuhito; Li, Tiaoying; Chen, Xingwang; Nakao, Minoru; Yanagida, Tetsuya; Okamoto, Munehiro; Giraudoux, Patrick; Raoul, Francis; Nakaya, Kazuhiro; Xiao, Ning; Qiu, Jiamin; Qiu, Dongchuan; Craig, Philip S; Ito, Akira

2012-06-11

255

Genes encoding homologous antigens in taeniid cestode parasites: Implications for development of recombinant vaccines produced in Escherichia coli.  

Science.gov (United States)

Recombinant vaccine antigens are being evaluated for their ability to protect livestock animals against cysticercosis and related parasitic infections. Practical use of some of these vaccines is expected to reduce parasite transmission, leading to a reduction in the incidence of neurocysticercosis and hydatid disease in humans. We recently showed that an antigen (TSOL16), expressed in Escherichia coli, confers high levels of protection against Taenia solium cysticercosis in pigs, which provides a strategy for control of T. solium parasite transmission. Here, we discuss the characteristics of this antigen that may affect the utility of TSOL16 and related antigens for development as recombinant vaccines. We also report that genes encoding antigens closely related to TSOL16 from T. solium also occur in other related species of parasites. These highly homologous antigens have the potential to be used as vaccines and may provide protection against related species of Taenia that cause infection in other hosts. PMID:23090389

Gauci, Charles; Lightowlers, Marshall W

2012-05-01

256

Historical overview of Taenia asiatica in Taiwan.  

Science.gov (United States)

An overview of the epidemiological, biological, and clinical studies of Taenia and taeniasis in Taiwan for the past century is presented. The phenomenal observations that led to the discovery of Taenia asiatica as a new species, which differ from Taenia solium and Taenia saginata, are described. Parasitological surveys of the aborigines in Taiwan revealed a high prevalence of taeniasis, which might be due to the culture of eating raw liver of hunted wild boars. Chemotherapeutic deworming trials involving many patients with taeniasis were discussed. Praziquantel was found to be very effective, but sometimes complete worms could not be recovered from the feces after treatment, probably due to the dissolution of the proglottids. Atabrine, despite some side effects, can still be used, in properly controlled dosages, as the drug of choice for human T. asiatica infection if we need to recover the expelled worms for morphological examinations. Research results on the infection of T. asiatica eggs from Taiwan aborigines in experimental animals were also noted. Since the pig serve as the natural intermediate host of T. asiatica and the predilection site is the liver, a differential comparison of other parasitic pathogens that might cause apparently similar lesions is also presented. PMID:23467308

Ooi, Hong Kean; Ho, Chau-Mei; Chung, Wen-Cheng

2013-02-18

257

Historical overview of Taenia asiatica in Taiwan.  

UK PubMed Central (United Kingdom)

An overview of the epidemiological, biological, and clinical studies of Taenia and taeniasis in Taiwan for the past century is presented. The phenomenal observations that led to the discovery of Taenia asiatica as a new species, which differ from Taenia solium and Taenia saginata, are described. Parasitological surveys of the aborigines in Taiwan revealed a high prevalence of taeniasis, which might be due to the culture of eating raw liver of hunted wild boars. Chemotherapeutic deworming trials involving many patients with taeniasis were discussed. Praziquantel was found to be very effective, but sometimes complete worms could not be recovered from the feces after treatment, probably due to the dissolution of the proglottids. Atabrine, despite some side effects, can still be used, in properly controlled dosages, as the drug of choice for human T. asiatica infection if we need to recover the expelled worms for morphological examinations. Research results on the infection of T. asiatica eggs from Taiwan aborigines in experimental animals were also noted. Since the pig serve as the natural intermediate host of T. asiatica and the predilection site is the liver, a differential comparison of other parasitic pathogens that might cause apparently similar lesions is also presented.

Ooi HK; Ho CM; Chung WC

2013-02-01

258

Intestinal obstruction caused by Taenia taeniaeformis infection in a cat.  

UK PubMed Central (United Kingdom)

An adult domestic shorthair (DSH) cat was presented with acute vomiting, anorexia, lethargy, and dyspnea. The cat's clinical status worsened over 24 hours with conservative medical management. An exploratory celiotomy was performed. Acute intestinal obstruction resulting from infection with Taenia (T.) taeniaeformis was diagnosed. Surgical removal of the cestodes via multiple enterotomies resolved the obstruction. This paper reports, for the first time, small intestinal obstruction caused by T. taeniaeformis infection in a cat.

Wilcox RS; Bowman DD; Barr SC; Euclid JM

2009-03-01

259

Identification of Loci Controlling Restriction of Parasite Growth in Experimental Taenia crassiceps Cysticercosis  

Science.gov (United States)

Human neurocysticercosis (NC) caused by Taenia solium is a parasitic disease of the central nervous system that is endemic in many developing countries. In this study, a genetic approach using the murine intraperitoneal cysticercosis caused by the related cestode Taenia crassiceps was employed to identify host factors that regulate the establishment and proliferation of the parasite. A/J mice are permissive to T. crassiceps infection while C57BL/6J mice (B6) are comparatively restrictive, with a 10-fold difference in numbers of peritoneal cysticerci recovered 30 days after infection. The genetic basis of this inter-strain difference was explored using 34 AcB/BcA recombinant congenic strains derived from A/J and B6 progenitors, that were phenotyped for T. crassiceps replication. In agreement with their genetic background, most AcB strains (A/J-derived) were found to be permissive to infection while most BcA strains (B6-derived) were restrictive with the exception of a few discordant strains, together suggesting a possible simple genetic control. Initial haplotype association mapping using >1200 informative SNPs pointed to linkages on chromosomes 2 (proximal) and 6 as controlling parasite replication in the AcB/BcA panel. Additional linkage analysis by genome scan in informative [AcB55xDBA/2]F1 and F2 mice (derived from the discordant AcB55 strain), confirmed the effect of chromosome 2 on parasite replication, and further delineated a major locus (LOD?=?4.76, p<0.01; peak marker D2Mit295, 29.7 Mb) that we designate Tccr1 (T. crassiceps cysticercosis restrictive locus 1). Resistance alleles at Tccr1 are derived from AcB55 and are inherited in a dominant fashion. Scrutiny of the minimal genetic interval reveals overlap of Tccr1 with other host resistance loci mapped to this region, most notably the defective Hc/C5 allele which segregates both in the AcB/BcA set and in the AcB55xDBA/2 cross. These results strongly suggest that the complement component 5 (C5) plays a critical role in early protective inflammatory response to infection with T. crassiceps.

Fortin, Anny; Sciutto-Conde, Edda; Fragoso-Gonzalez, Gladis; Gros, Philippe; Aguilar-Delfin, Irma

2011-01-01

260

Identification of loci controlling restriction of parasite growth in experimental Taenia crassiceps cysticercosis.  

Science.gov (United States)

Human neurocysticercosis (NC) caused by Taenia solium is a parasitic disease of the central nervous system that is endemic in many developing countries. In this study, a genetic approach using the murine intraperitoneal cysticercosis caused by the related cestode Taenia crassiceps was employed to identify host factors that regulate the establishment and proliferation of the parasite. A/J mice are permissive to T. crassiceps infection while C57BL/6J mice (B6) are comparatively restrictive, with a 10-fold difference in numbers of peritoneal cysticerci recovered 30 days after infection. The genetic basis of this inter-strain difference was explored using 34 AcB/BcA recombinant congenic strains derived from A/J and B6 progenitors, that were phenotyped for T. crassiceps replication. In agreement with their genetic background, most AcB strains (A/J-derived) were found to be permissive to infection while most BcA strains (B6-derived) were restrictive with the exception of a few discordant strains, together suggesting a possible simple genetic control. Initial haplotype association mapping using >1200 informative SNPs pointed to linkages on chromosomes 2 (proximal) and 6 as controlling parasite replication in the AcB/BcA panel. Additional linkage analysis by genome scan in informative [AcB55xDBA/2]F1 and F2 mice (derived from the discordant AcB55 strain), confirmed the effect of chromosome 2 on parasite replication, and further delineated a major locus (LOD = 4.76, p<0.01; peak marker D2Mit295, 29.7 Mb) that we designate Tccr1 (T. crassiceps cysticercosis restrictive locus 1). Resistance alleles at Tccr1 are derived from AcB55 and are inherited in a dominant fashion. Scrutiny of the minimal genetic interval reveals overlap of Tccr1 with other host resistance loci mapped to this region, most notably the defective Hc/C5 allele which segregates both in the AcB/BcA set and in the AcB55xDBA/2 cross. These results strongly suggest that the complement component 5 (C5) plays a critical role in early protective inflammatory response to infection with T. crassiceps. PMID:22206032

Ramirez-Aquino, Ruben; Radovanovic, Irena; Fortin, Anny; Sciutto-Conde, Edda; Fragoso-González, Gladis; Gros, Philippe; Aguilar-Delfin, Irma

2011-12-20

 
 
 
 
261

Identification of loci controlling restriction of parasite growth in experimental Taenia crassiceps cysticercosis.  

UK PubMed Central (United Kingdom)

Human neurocysticercosis (NC) caused by Taenia solium is a parasitic disease of the central nervous system that is endemic in many developing countries. In this study, a genetic approach using the murine intraperitoneal cysticercosis caused by the related cestode Taenia crassiceps was employed to identify host factors that regulate the establishment and proliferation of the parasite. A/J mice are permissive to T. crassiceps infection while C57BL/6J mice (B6) are comparatively restrictive, with a 10-fold difference in numbers of peritoneal cysticerci recovered 30 days after infection. The genetic basis of this inter-strain difference was explored using 34 AcB/BcA recombinant congenic strains derived from A/J and B6 progenitors, that were phenotyped for T. crassiceps replication. In agreement with their genetic background, most AcB strains (A/J-derived) were found to be permissive to infection while most BcA strains (B6-derived) were restrictive with the exception of a few discordant strains, together suggesting a possible simple genetic control. Initial haplotype association mapping using >1200 informative SNPs pointed to linkages on chromosomes 2 (proximal) and 6 as controlling parasite replication in the AcB/BcA panel. Additional linkage analysis by genome scan in informative [AcB55xDBA/2]F1 and F2 mice (derived from the discordant AcB55 strain), confirmed the effect of chromosome 2 on parasite replication, and further delineated a major locus (LOD = 4.76, p<0.01; peak marker D2Mit295, 29.7 Mb) that we designate Tccr1 (T. crassiceps cysticercosis restrictive locus 1). Resistance alleles at Tccr1 are derived from AcB55 and are inherited in a dominant fashion. Scrutiny of the minimal genetic interval reveals overlap of Tccr1 with other host resistance loci mapped to this region, most notably the defective Hc/C5 allele which segregates both in the AcB/BcA set and in the AcB55xDBA/2 cross. These results strongly suggest that the complement component 5 (C5) plays a critical role in early protective inflammatory response to infection with T. crassiceps.

Ramirez-Aquino R; Radovanovic I; Fortin A; Sciutto-Conde E; Fragoso-González G; Gros P; Aguilar-Delfin I

2011-12-01

262

Distribution of Parasitic Cestod  

Directory of Open Access Journals (Sweden)

Full Text Available Background: Ligulae intestinalis is a parasitic cestode, which has the economic-health importance in fishery industries. The aim of this study was to determine the prevalence of this parasite in Mazandaran. The effects of habitat temperature and kind of pool (sandy-cement) were considered as well. Methods: In this study, 103 fish samples were obtained in all stages; the samples (male and female) were divided into 3 groups based on length of fish, temperature, origin of cultured fish, kind of pool, height from sea and sex. Macroscopic and microscopic observations were carried out in all stages of the parasite (procercoid, plerocercoid and adult). Chi-square and Pearson's double square tests (P<0.05) were conducted in order to evaluate the prevalence and determination of reliability in six sampling areas, respectively. Results: Total rate of the parasites were 9.7% in all groups. There was significant difference between parasitism rate and height of sea level, kind of pool (maximum in sandy pools) and high temperature. The multi analyses regarding to above-mentioned three criteria also indicated meaningful difference between these criteria and parasitism rate. Seasonal conditions enhance the prevalence of ligulae intestinalis. Conclusion: Flexibility in parasite's life cycle and choosing different hosts makes it challenging case in fishery industry; moreover its prevalence could be predicted according to environmental conditions so choosing the minimal at risk place for salmonids farming. Further studies are recommended for evaluating the problems in fish fertility and probable risk for infected fish consumers.

S Shargh; M Shamsaii; S Karimi

2008-01-01

263

Molecular identification of species of Taenia causing bovine cysticercosis in Ethiopia.  

Science.gov (United States)

Bovine cysticercosis causing damage to the beef industry is closely linked to human taeniasis due to Taenia saginata. In African countries, Taenia spp. from wildlife are also involved as possible sources of infections in livestock. To identify the aetiological agents of bovine cysticercosis in Ethiopia, cysticerci were collected from 41 cattle slaughtered in the eastern and central areas during 2010-2012. A single cysticercus per animal was subjected to the polymerase chain reaction (PCR)-based DNA sequencing of mitochondrial cytochrome c oxidase subunit 1 gene, and the resultant sequence was compared with those of members of the genus Taenia. Although 38 out of 41 cysticerci (92.7%) were identified as T. saginata, three samples (7.3%) showed the hitherto unknown sequences of Taenia sp., which is distantly related to Taenia solium, Taenia arctos and Taenia ovis. Old literatures suggest it to be Taenia hyaenae, but morphological identification of species could not be completed by observing only the larval samples. PMID:23452760

Hailemariam, Z; Nakao, M; Menkir, S; Lavikainen, A; Iwaki, T; Yanagida, T; Okamoto, M; Ito, A

2013-03-01

264

Molecular identification of Taenia spp. in the Eurasian lynx (Lynx lynx) from Finland.  

Science.gov (United States)

Cestodes of the genus Taenia are parasites of mammals, with mainly carnivores as definitive and herbivores as intermediate hosts. Various medium-sized cats, Lynx spp., are involved in the life cycles of several species of Taenia. The aim of the present study was to identify Taenia tapeworms in the Eurasian lynx (Lynx lynx) from Finland. In total, 135 tapeworms from 72 lynx were subjected to molecular identification based on sequences of 2 mtDNA regions, the cytochrome c oxidase subunit 1 and the NADH dehydrogenase subunit 1 genes. Available morphological characters of the rostellar hooks and strobila were compared. Two species of Taenia were found: T. laticollis (127 samples) and an unknown Taenia sp. (5 samples). The latter could not be identified to species based on mtDNA, and the rostellar hooks were short relative to those described among other Taenia spp. recorded in felids from the Holarctic region. In the phylogenetic analyses of mtDNA sequences, T. laticollis was placed as a sister species of T. macrocystis, and the unknown Taenia sp. was closely related to T. hydatigena and T. regis. Our analyses suggest that these distinct taeniid tapeworms represent a putative new species of Taenia. The only currently recognized definitive host is L. lynx and the intermediate host is unknown. PMID:23347590

Lavikainen, A; Haukisalmi, V; Deksne, G; Holmala, K; Lejeune, M; Isomursu, M; Jokelainen, P; Näreaho, A; Laakkonen, J; Hoberg, E P; Sukura, A

2013-01-25

265

Molecular identification of Taenia spp. in the Eurasian lynx (Lynx lynx) from Finland.  

UK PubMed Central (United Kingdom)

Cestodes of the genus Taenia are parasites of mammals, with mainly carnivores as definitive and herbivores as intermediate hosts. Various medium-sized cats, Lynx spp., are involved in the life cycles of several species of Taenia. The aim of the present study was to identify Taenia tapeworms in the Eurasian lynx (Lynx lynx) from Finland. In total, 135 tapeworms from 72 lynx were subjected to molecular identification based on sequences of 2 mtDNA regions, the cytochrome c oxidase subunit 1 and the NADH dehydrogenase subunit 1 genes. Available morphological characters of the rostellar hooks and strobila were compared. Two species of Taenia were found: T. laticollis (127 samples) and an unknown Taenia sp. (5 samples). The latter could not be identified to species based on mtDNA, and the rostellar hooks were short relative to those described among other Taenia spp. recorded in felids from the Holarctic region. In the phylogenetic analyses of mtDNA sequences, T. laticollis was placed as a sister species of T. macrocystis, and the unknown Taenia sp. was closely related to T. hydatigena and T. regis. Our analyses suggest that these distinct taeniid tapeworms represent a putative new species of Taenia. The only currently recognized definitive host is L. lynx and the intermediate host is unknown.

Lavikainen A; Haukisalmi V; Deksne G; Holmala K; Lejeune M; Isomursu M; Jokelainen P; Näreaho A; Laakkonen J; Hoberg EP; Sukura A

2013-04-01

266

Loop-mediated isothermal amplification method for a differential identification of human taenia tapeworms.  

UK PubMed Central (United Kingdom)

Loop-mediated isothermal amplification (LAMP), which employs a Bst DNA polymerase with strand-displacement activity and four primers (two inner primers and two outer primers) recognizing six distinct regions on the target DNA, is a highly sensitive, specific, simple, and rapid nucleotide amplification method. Moreover, because the Bst DNA polymerase resists much DNA polymerase inhibitors present in biological specimens, the LAMP method is suitable for the detection of infectious agents from clinical material such as fecal samples. Here, we describe the LAMP method which can differentially detect and identify human Taenia tapeworms, Taenia solium, T. saginata, and T. asiatica, using DNA specimens prepared from parasite tissue and human fecal sample.

Sako Y; Nkouawa A; Yanagida T; Ito A

2013-01-01

267

Molecular phylogeny of the genus Taenia (Cestoda: Taeniidae): proposals for the resurrection of Hydatigera Lamarck, 1816 and the creation of a new genus Versteria.  

UK PubMed Central (United Kingdom)

The cestode family Taeniidae generally consists of two valid genera, Taenia and Echinococcus. The genus Echinococcus is monophyletic due to a remarkable similarity in morphology, features of development and genetic makeup. By contrast, Taenia is a highly diverse group formerly made up of different genera. Recent molecular phylogenetic analyses strongly suggest the paraphyly of Taenia. To clarify the genetic relationships among the representative members of Taenia, molecular phylogenies were constructed using nuclear and mitochondrial genes. The nuclear phylogenetic trees of 18S ribosomal DNA and concatenated exon regions of protein-coding genes (phosphoenolpyruvate carboxykinase and DNA polymerase delta) demonstrated that both Taenia mustelae and a clade formed by Taenia parva, Taenia krepkogorski and Taenia taeniaeformis are only distantly related to the other members of Taenia. Similar topologies were recovered in mitochondrial genomic analyses using 12 complete protein-coding genes. A sister relationship between T. mustelae and Echinococcus spp. was supported, especially in protein-coding gene trees inferred from both nuclear and mitochondrial data sets. Based on these results, we propose the resurrection of Hydatigera Lamarck, 1816 for T. parva, T. krepkogorski and T. taeniaeformis and the creation of a new genus, Versteria, for T. mustelae. Due to obvious morphological and ecological similarities, Taenia brachyacantha is also included in Versteria gen. nov., although molecular evidence is not available. Taenia taeniaeformis has been historically regarded as a single species but the present data clearly demonstrate that it consists of two cryptic species.

Nakao M; Lavikainen A; Iwaki T; Haukisalmi V; Konyaev S; Oku Y; Okamoto M; Ito A

2013-05-01

268

[Immunodiagnosis of neurocysticercosis: comparative study of antigenic extracts from Cysticercus cellulosae and Taenia crassiceps  

UK PubMed Central (United Kingdom)

Different antigenic extracts of Taenia solium and Taenia crassiceps were evaluated in connection with the detection of antibodies in patients with neurocysticercosis aimed at selecting immunorelevant antigens for the diagnosis of neurocysticercosis by means of the immunoenzymatic assay and immunoblotting. The vesicular fluid of T. crassiceps proved to be more sensitive (100%) and specific (86%). On using the immunoblotting technique it was also observed that this extract was the most sensitive and specific. Within the protein profile of the antigen the band of 18 kDa was mostly recognized by the serum and cerebrospinal fluid of patients with neurocysticercosis. The vesicular fluid of T. crassiceps represents an alternative in the optimization of the diagnosis of neurocysticercosis in the serum and cerebrospinal fluid and in the substitution of T. solium antigens due to its high sensitivity and specificity and to its easy obtention under controlled laboratory conditions.

Rossi N; Rivas I; Hernández M; Urdaneta H

2000-09-01

269

Inmunodiagnóstico de la neurocisticercosis: estudio comparativo de extractos antigénicos de Cysticercus cellulosae y Taenia crassiceps  

Directory of Open Access Journals (Sweden)

Full Text Available Se evaluaron diferentes extractos antigénicos de Taenia solium y de Taenia crassiceps en la detección de anticuerpos en pacientes con neurocisticercosis, con el objetivo de seleccionar antígenos inmunorrelevantes para el diagnóstico de la neurocisticercosis por medio del ensayo inmunoenzimático e immunoblotting. El fluido vesicular de T. crassiceps mostró ser más sensible (100 %) y específico (86 %). Por medio del immunoblotting se observó también, que este extracto fue el más sensible y específico. Dentro del perfil proteico del antígeno, la banda mayormente reconocida por el suero y líquido cefalorraquídeo de pacientes con neurocisticercosis fue la de 18 kDa. El fluido vesicular de la T. crassiceps por su alta sensibilidad y especificidad y por su facilidad de obtención en condiciones controladas de laboratorio, representa una alternativa en la optimización del diagnóstico de la neurocisticercosis en el suero y líquido cefalorraquídeo y en la sustitución de los antígenos de T. solium.Different antigenic extracts of Taenia solium and Taenia crassiceps were evaluated in connection with the detection of antibodies in patients with neurocysticercosis aimed at selecting immunorelevant antigens for the diagnosis of neurocysticercosis by means of the immunoenzimatic assay and immunoblotting. The vesicular fluid of T. crassiceps proved to be more sensitive (100%) and specific (86%). On using the immunoblotting technique it was also observed that this extract was the most sensitive and specific. Within the protein profile of the antigen the band of 18 kDa was mostly recognized by the serum and cerebrospinal fluid of patients with neurocysticercosis. The vesicular fluid of T. crassiceps represents an alternative in the optimization of the diagnosis of neurocysticercosis in the serum and cerebrospinal fluid and in the substitution of T. solium antigens due to its high sensitivity and specificity and to its easy obtention under controlled laboratory conditions.

Nineth Rossi; Ivan Rivas; Manuel Hernández; Haideé Urdaneta

2000-01-01

270

Inmunodiagnóstico de la neurocisticercosis: estudio comparativo de extractos antigénicos de Cysticercus cellulosae y Taenia crassiceps  

Scientific Electronic Library Online (English)

Full Text Available Abstract in spanish Se evaluaron diferentes extractos antigénicos de Taenia solium y de Taenia crassiceps en la detección de anticuerpos en pacientes con neurocisticercosis, con el objetivo de seleccionar antígenos inmunorrelevantes para el diagnóstico de la neurocisticercosis por medio del ensayo inmunoenzimático e immunoblotting. El fluido vesicular de T. crassiceps mostró ser más sensible (100 %) y específico (86 %). Por medio del immunoblotting se observó también, que este extr (more) acto fue el más sensible y específico. Dentro del perfil proteico del antígeno, la banda mayormente reconocida por el suero y líquido cefalorraquídeo de pacientes con neurocisticercosis fue la de 18 kDa. El fluido vesicular de la T. crassiceps por su alta sensibilidad y especificidad y por su facilidad de obtención en condiciones controladas de laboratorio, representa una alternativa en la optimización del diagnóstico de la neurocisticercosis en el suero y líquido cefalorraquídeo y en la sustitución de los antígenos de T. solium. Abstract in english Different antigenic extracts of Taenia solium and Taenia crassiceps were evaluated in connection with the detection of antibodies in patients with neurocysticercosis aimed at selecting immunorelevant antigens for the diagnosis of neurocysticercosis by means of the immunoenzimatic assay and immunoblotting. The vesicular fluid of T. crassiceps proved to be more sensitive (100%) and specific (86%). On using the immunoblotting technique it was also observed that this extract (more) was the most sensitive and specific. Within the protein profile of the antigen the band of 18 kDa was mostly recognized by the serum and cerebrospinal fluid of patients with neurocysticercosis. The vesicular fluid of T. crassiceps represents an alternative in the optimization of the diagnosis of neurocysticercosis in the serum and cerebrospinal fluid and in the substitution of T. solium antigens due to its high sensitivity and specificity and to its easy obtention under controlled laboratory conditions.

Rossi, Nineth; Rivas, Ivan; Hernández, Manuel; Urdaneta, Haideé

2000-12-01

271

The effects of different plant extracts on intestinal cestodes and on trematodes.  

UK PubMed Central (United Kingdom)

In the present study, chloroform, aqueous, (polyethylene glycol/propylene carbonate) PEG/PC extracts were made from coconut, onion, garlic, fig, date tree, chicory, ananas, and cistrose. These extracts were tested in vivo and in vitro on their anthelmintic activity against cestodes (Hymenolepis diminuta, H. microstoma, Taenia taeniaeformis) and trematodes (Fasciola hepatica, Echinostoma caproni). In all in vitro tests, the target parasites died. It turned out that the treatment of mice and rats with a combination of onion and coconut extracts (with PEG/PC) eliminated all cestodes from their final hosts. In addition, the same composition was effective against the intestinal fluke E. caproni, but not against the liver fluke F. hepatica in the final host, while both worms were killed in vitro. Inoculation of fluids of coconut eliminated T. taeniaeformis tapeworms from naturally infected cats. This goal was not reached with oil of cistrose.

Abdel-Ghaffar F; Semmler M; Al-Rasheid KA; Strassen B; Fischer K; Aksu G; Klimpel S; Mehlhorn H

2011-04-01

272

Ovicidal effect of nematophagous fungi on Taenia taeniaeformis eggs  

UK PubMed Central (United Kingdom)

This work evaluated the ovicidal effect of the nematophagous fungi Monacrosporium sinense (SF53), Monacrosporium thaumasium (NF34) and Pochonia chlamydosporia (VC1) on Taenia taeniaeformis eggs in laboratory conditions. T. taeniaeformis eggs were plated on 2% water-agar with the grown isolates and control without fungus and examined at seven and fourteen days post-inoculation. At the end of the experiment, P. chlamydosporia showed ovicidal activity (P < 0.01) on T. taeniaeformis eggs unlike the other two species, mainly for internal egg colonization with percentage results of 32.2-54.0% at 7th and 14th day, respectively. The other fungi only showed lytic effect without morphological damage to eggshell. Results demonstrated that P. chlamydosporia was in vitro effective against Taenia taeniaeformis eggs unlike the other fungi. In this way, the use of P. chlamydosporia is suggested as a potential biological control agent for eggs of this cestode.

Braga FR; Araújo JV; Carvalho RO; Silva AR; Araujo JM; Tavela AO; Costa PRS; Campos AK

2009-03-01

273

Tapeworm - beef or pork  

Science.gov (United States)

... Pork tapeworm; Beef tapeworm; Tapeworm; Taenia saginata; Taenia solium; Taeniasis ... carry Taenia saginata ( T. saginata ). Pigs carry Taenia solium (T. solium) . In the human intestine, the young ...

274

Taenia taeniaeformis in Rat Favors Protracted Skin Lesions Caused by Sporothrix schenckii Infection: Dectin-1 and IL-17 Are Dispensable for Clearance of This Fungus  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We occasionally found that cestode Taenia taeniaeformis in rats favored Sporothrix schenckii infection and survival, causing protracted cutaneous lesions. In this study, we compared the pathology and cytokines profile of rats co-infected with the two pathogens and infected with S. schenckii alone to...

Zhang, Xiaohui; Zhang, Jing; Huang, Huaiqiu; Xue, Ruzeng; Hu, Xuchu; Li, Meirong; Zhong, Yi; Yuan, Liyan

275

Development of Taenia pisiformis in golden hamster (Mesocricetus auratus)  

Directory of Open Access Journals (Sweden)

Full Text Available Abstract The life cycle of Taenia pisiformis includes canines as definitive hosts and rabbits as intermediate hosts. Golden hamster (Mesocricetus auratus) is a rodent that has been successfully used as experimental model of Taenia solium taeniosis. In the present study we describe the course of T. pisiformis infection in experimentally infected golden hamsters. Ten females, treated with methyl-prednisolone acetate were infected with three T. pisiformis cysticerci each one excised from one rabbit. Proglottids released in faeces and adults recovered during necropsy showed that all animals were infected. Eggs obtained from the hamsters' tapeworms, were assessed for viability using trypan blue or propidium iodide stains. Afterwards, some rabbits were inoculated with eggs, necropsy was performed after seven weeks and viable cysticerci were obtained. Our results demonstrate that the experimental model of adult Taenia pisiformis in golden hamster can replace the use of canines in order to study this parasite and to provide eggs and adult tapeworms to be used in different types of experiments.

Toral-Bastida Elizabeth; Garza-Rodriguez Adriana; Jimenez-Gonzalez Diego E; Garcia-Cortes Ramon; Avila-Ramirez Guillermina; Maravilla Pablo; Flisser Ana

2011-01-01

276

Development of Taenia pisiformis in golden hamster (Mesocricetus auratus).  

UK PubMed Central (United Kingdom)

The life cycle of Taenia pisiformis includes canines as definitive hosts and rabbits as intermediate hosts. Golden hamster (Mesocricetus auratus) is a rodent that has been successfully used as experimental model of Taenia solium taeniosis. In the present study we describe the course of T. pisiformis infection in experimentally infected golden hamsters. Ten females, treated with methyl-prednisolone acetate were infected with three T. pisiformis cysticerci each one excised from one rabbit. Proglottids released in faeces and adults recovered during necropsy showed that all animals were infected. Eggs obtained from the hamsters' tapeworms, were assessed for viability using trypan blue or propidium iodide stains. Afterwards, some rabbits were inoculated with eggs, necropsy was performed after seven weeks and viable cysticerci were obtained. Our results demonstrate that the experimental model of adult Taenia pisiformis in golden hamster can replace the use of canines in order to study this parasite and to provide eggs and adult tapeworms to be used in different types of experiments.

Toral-Bastida E; Garza-Rodriguez A; Jimenez-Gonzalez DE; Garcia-Cortes R; Avila-Ramirez G; Maravilla P; Flisser A

2011-01-01

277

Generalized Taenia crassiceps cysticercosis in a chinchilla (Chinchilla lanigera).  

UK PubMed Central (United Kingdom)

Taenia crassiceps is a cestode parasite that uses carnivores as definitive hosts and rodents and rabbits as main intermediate hosts, but other animal species and humans may also get infected. One adult male chinchilla (Chinchilla lanigera) from an animal shelter in Switzerland presented widespread subcutaneous fluctuant swellings extended over the forehead, nose, face and thoracic regions with a progressive growth over 3 months. The thoracic swelling was surgically resected, and it consisted of numerous 3-4mm small transparent vesicles, mainly confined to the subcutaneous tissue, which were morphologically identified as cysticerci of T. crassiceps. The diagnosis was confirmed by PCR and DNA sequence analysis of fragments of the mitochondrial small subunit rRNA and NADH dehydrogenase subunit 1 genes. After 1.5 months, due to enlargement of the swollen areas and deterioration of the general health condition, the chinchilla was euthanized and a necropsy was performed. Thousands of small cysticerci were observed widespread in the subcutis, involving underlying musculature of the whole body, in the thoracic cavity, larynx, pharynx and in the retropharyngeal region. Additionally, three larger metacestodes were detected in the liver and morphologically and molecularly identified as Taenia taeniaeformis strobilocerci. The present case represents an indicator of the environmental contamination with Taenia eggs, highlighting the risk of infection for susceptible animals and humans. Besides the clinical relevance for pets, T. crassiceps is a zoonotic parasite and can be also cause of severe cysticercosis in humans.

Basso W; Rütten M; Deplazes P; Grimm F

2013-09-01

278

Characterization of the Taenia spp HDP2 sequence and development of a novel PCR-based assay for discrimination of Taenia saginata from Taenia asiatica  

Directory of Open Access Journals (Sweden)

Full Text Available Abstract A previously described Taenia saginata HDP2 DNA sequence, a 4-kb polymorphic fragment, was previously used as the basis for developing PCR diagnostic protocols for the species-specific discrimination of T. saginata from T. solium and for the differentiation of T. saginata from T. asiatica. The latter was shown subsequently to lack the required specificity, so we undertook genetic studies of the HDP2 sequence from T. saginata and T. asiatica to determine why, and to develop a novel HDP2-PCR protocol for the simultaneous unambiguous identification of human taeniids. Sequencing and further analysis of the HDP2 DNA fragments of 19 Asiatic isolates of T. saginata and T. asiatica indicated that the HDP2 sequences of both species exhibited clear genomic variability, due to polymorphic variable fragments, that could correspond to the non-transcribed region of ribosomal DNA. This newly observed polymorphism allowed us to develop a novel, reproducible and reliable HDP2-PCR protocol which permitted the simultaneous discrimination of all T. saginata and T. asiatica isolates examined. This species-specific identification was based on, and facilitated by, the clear size difference in amplicon profiles generated: fragments of 1300 bp, 600 bp and 300 bp were produced for T. asiatica, amplicons of 1300 bp and 300 bp being obtained for T. saginata. Control T. solium samples produced one amplicon of 600 bp with the HDP2-PCR protocol. The assay has the potential to prove useful as a diagnostic tool in areas such as South East Asia where T. saginata, T. asiatica and T. solium coexist.

González Luis M; Bailo Begoña; Ferrer Elizabeth; García Maria; Harrison Leslie JS; Parkhouse Michael RE; McManus Donald P; Gárate Teresa

2010-01-01

279

Relative seroprevalence of cysticercus antigens and antibodies and antibodies to Taenia ova in a population sample in south India suggests immunity against neurocysticercosis.  

UK PubMed Central (United Kingdom)

We evaluated the exposure of a community in Vellore district of south India to Taenia solium infection and its relationship to the prevalence of neurocysticercosis (NCC) causing active epilepsy. Seroprevalence of Taenia cysticercus antigens and antibodies were determined in 1064 randomly chosen asymptomatic individuals, antibodies to T. solium ova in 197 selected sera, and prevalence of taeniasis by a coproantigen test in 729 stool samples. The prevalence of NCC causing active epilepsy in Vellore district was determined in a population of 50 617. Coproantigens were detected in 0.8% (6 samples), Taenia cysticercus antigens in 4.5% (48 sera) and cysticercus IgG antibodies in 15.9% (169 sera) of the population. Cysticercus antibodies were directed against relatively low molecular weight cyst glycoprotein antigens in 14.9% (158 sera) of the population. IgG antibodies to Taenia ova were found in 81 (41.1%) of the selected samples. Prevalence of NCC causing active epilepsy was 1.3 per 1000 population. These results show high exposure of the population to the parasite and a relatively high prevalence of active infections (4.5% antigen positives) but a low prevalence of NCC causing active epilepsy (0.13%). These findings may indicate that the population is protected against developing neurocysticercosis. IgG antibodies directed against Taenia ova and low molecular weight cyst antigens may contribute to protection.

Jayaraman T; Prabhakaran V; Babu P; Raghava MV; Rajshekhar V; Dorny P; Muliyil J; Oommen A

2011-03-01

280

Postoncospheral development and cycle of Taenia polyacantha Leuckart, 1856 (Cestoda: Taeniidae). First part.  

Science.gov (United States)

The postoncospheral development and cycle of Taenia polyacantha Leuckart, 1856, an holarctic species of cestode, were investigated in the laboratory as well as in the tundra of northern Alaska. Foxes, Alopex lapogus (L.) and Vulpes vulpes (L.), serve as final host of T. polyacantha; the northern vole, Microtus oeconomus (Pallas), and the brown lemming, Lemmus sibiricus (Kerr), are important as the intermediate host. As determined in experimentally infected voles and lemmings, the oncosphere of T. polyacantha transformed to a primary vesicle in the liver. On the 6th day postexposure, coinciding with its migration to the peritoneal cavity, the larval cestode consisted of a minute aggregation of secondary vesicles. By 9-10 days postexposure, the secondary vesicles dissociated, thereafter developing independently to infective cysticerci by 30-40 days postexposure. At an age of about 60 days, the infective larvae began to undergo further growth and morphological modification, which led to acquisition of some strobilar characteristics by the forebody. Such late transformation of a cysticercus to a more advanced form of larva is known otherwise only in Taenia martis (Zeder, 1803). Differences in numbers and sizes of rostellar hooks provided the basis for recognition of two taxa at the infraspecific level: Taenia p. polyacantha Leuckart, 1856, distributed in Eurasia to the south of the zone of tundra, and T. p. arctica ssp. nov., present throughout the holarctic tundra. Observations concerning interactions of T. polyacantha and its hosts are discussed. PMID:3059953

Rausch, R L; Fay, F H

1988-01-01

 
 
 
 
281

Evaluación de cisticerco de taenia crassiceps como antígeno sustituto para el diagnóstico de la neurocisticercosis  

Directory of Open Access Journals (Sweden)

Full Text Available Para el diagnóstico de la neurocisticercosis (NCC) se requiere de extractos antigénicos obtenidos de los cisticercos de Taenia solium (T.so), lo cual presenta dificultades técnicas por la difícil consecución de cerdos naturalmente infectados (1). Sin embargo, los extractos antigénicos obtenidos de Taenia crassiceps (T.cra) muestran una alta homología con los de T.so, brindando ventajas en la producción de antígenos para implementar en técnicas serológicas (2,3). Nuestro grupo ha venido trabajando en la búsqueda de alternativas para el diagnóstico serológico de cisticercosis humana y porcina enColombia y en el establecimiento de un modelo animal de fácil mantenimiento que permita la obtención de cisticercos a gran escala.  

Luz Elena Botero; Sonia Agudelo

2004-01-01

282

Loop-mediated isothermal amplification method for a differential identification of human taenia tapeworms.  

Science.gov (United States)

Loop-mediated isothermal amplification (LAMP), which employs a Bst DNA polymerase with strand-displacement activity and four primers (two inner primers and two outer primers) recognizing six distinct regions on the target DNA, is a highly sensitive, specific, simple, and rapid nucleotide amplification method. Moreover, because the Bst DNA polymerase resists much DNA polymerase inhibitors present in biological specimens, the LAMP method is suitable for the detection of infectious agents from clinical material such as fecal samples. Here, we describe the LAMP method which can differentially detect and identify human Taenia tapeworms, Taenia solium, T. saginata, and T. asiatica, using DNA specimens prepared from parasite tissue and human fecal sample. PMID:24026690

Sako, Yasuhito; Nkouawa, Agathe; Yanagida, Tetsuya; Ito, Akira

2013-01-01

283

Echinococcus and Taenia spp. from captive mammals in the United Kingdom.  

Science.gov (United States)

Taeniid tapeworms which include Echinococcus and Taenia spp. are obligatory parasites of mammals with pathogenicity usually related to the larval stages of the life cycle. Two species (or genotypes) of Echinococcus, E. granulosus sensu stricto and E. equinus, as well as several Taenia spp. are endemic in the UK. Here we report on the occurrence of larval cystic stages of Echinococcus and Taenia spp. in captive mammals in the UK. Using molecular techniques we have identified E. granulosus (G1 genotype) in a guenon monkey and a Philippine spotted deer; E. equinus in a zebra and a lemur; E. ortleppi in a Philippine spotted deer; E. multilocularis in a macaque monkey and Taenia polyacantha in jumping rats. To the best of our knowledge this is the first report of E. multilocularis in a captive primate translocated to the UK. As far as we know these are the first reports of E. equinus in a primate (lemur) and in a zebra; as well as E. granulosus (G1 genotype) and E. ortleppi in a cervid translocated to the UK. These infections and implications of the potential establishment of exotic species of cestodes are discussed. PMID:22763348

Boufana, B; Stidworthy, M F; Bell, S; Chantrey, J; Masters, N; Unwin, S; Wood, R; Lawrence, R P; Potter, A; McGarry, J; Redrobe, S; Killick, R; Foster, A P; Mitchell, S; Greenwood, A G; Sako, Y; Nakao, M; Ito, A; Wyatt, K; Lord, B; Craig, P S

2012-06-01

284

Echinococcus and Taenia spp. from captive mammals in the United Kingdom.  

UK PubMed Central (United Kingdom)

Taeniid tapeworms which include Echinococcus and Taenia spp. are obligatory parasites of mammals with pathogenicity usually related to the larval stages of the life cycle. Two species (or genotypes) of Echinococcus, E. granulosus sensu stricto and E. equinus, as well as several Taenia spp. are endemic in the UK. Here we report on the occurrence of larval cystic stages of Echinococcus and Taenia spp. in captive mammals in the UK. Using molecular techniques we have identified E. granulosus (G1 genotype) in a guenon monkey and a Philippine spotted deer; E. equinus in a zebra and a lemur; E. ortleppi in a Philippine spotted deer; E. multilocularis in a macaque monkey and Taenia polyacantha in jumping rats. To the best of our knowledge this is the first report of E. multilocularis in a captive primate translocated to the UK. As far as we know these are the first reports of E. equinus in a primate (lemur) and in a zebra; as well as E. granulosus (G1 genotype) and E. ortleppi in a cervid translocated to the UK. These infections and implications of the potential establishment of exotic species of cestodes are discussed.

Boufana B; Stidworthy MF; Bell S; Chantrey J; Masters N; Unwin S; Wood R; Lawrence RP; Potter A; McGarry J; Redrobe S; Killick R; Foster AP; Mitchell S; Greenwood AG; Sako Y; Nakao M; Ito A; Wyatt K; Lord B; Craig PS

2012-11-01

285

Development of the S3Pvac vaccine against murine Taenia crassiceps cysticercosis: a historical review.  

Science.gov (United States)

Our work of the last 25 yr was concerned with the development of a vaccine aimed to prevent porcine Taenia solium cysticercosis and was based on cross-reacting Taenia crassiceps antigens that had proved protective against experimental intraperitoneal murine T. crassiceps cysticercosis (EIMTcC). In recent times the efficacy of the vaccine has been considered in need of confirmation, and the use of EIMTcC has been questioned as a valid tool in screening for vaccine candidates among the many antigens possibly involved. A review of our work divided in 2 parts is presented at this point, the first dealing with EIMTcC and the second with porcine T. solium cysticercosis (presented in this issue). Herein, we revise our results using EIMTcC as a measure of the protective capacity of T. crassiceps complex antigen mixtures, of purified native antigens, and of S3Pvac anti-cysticercosis vaccine composed by 3 protective peptides: GK-1, KETc1, and KETc12 either synthetic or recombinantly expressed and collectively or separately, by diverse delivery systems when administered at different doses and by different routes. Statistical analyses of the data lead confidently to the strong inference that S3Pvac is indeed an effective vaccine against EIMTcC via specific and non-specific mechanisms of protection. PMID:23409920

Sciutto, Edda; Fragoso, Gladis; Hernández, Marisela; Rosas, Gabriela; Martínez, José J; Fleury, Agnès; Cervantes, Jacquelynne; Aluja, Aline; Larralde, Carlos

2013-02-14

286

Development of the S3Pvac vaccine against murine Taenia crassiceps cysticercosis: a historical review.  

UK PubMed Central (United Kingdom)

Our work of the last 25 yr was concerned with the development of a vaccine aimed to prevent porcine Taenia solium cysticercosis and was based on cross-reacting Taenia crassiceps antigens that had proved protective against experimental intraperitoneal murine T. crassiceps cysticercosis (EIMTcC). In recent times the efficacy of the vaccine has been considered in need of confirmation, and the use of EIMTcC has been questioned as a valid tool in screening for vaccine candidates among the many antigens possibly involved. A review of our work divided in 2 parts is presented at this point, the first dealing with EIMTcC and the second with porcine T. solium cysticercosis (presented in this issue). Herein, we revise our results using EIMTcC as a measure of the protective capacity of T. crassiceps complex antigen mixtures, of purified native antigens, and of S3Pvac anti-cysticercosis vaccine composed by 3 protective peptides: GK-1, KETc1, and KETc12 either synthetic or recombinantly expressed and collectively or separately, by diverse delivery systems when administered at different doses and by different routes. Statistical analyses of the data lead confidently to the strong inference that S3Pvac is indeed an effective vaccine against EIMTcC via specific and non-specific mechanisms of protection.

Sciutto E; Fragoso G; Hernández M; Rosas G; Martínez JJ; Fleury A; Cervantes J; Aluja A; Larralde C

2013-08-01

287

Cestode regulation of inflammation and inflammatory diseases.  

UK PubMed Central (United Kingdom)

Helminth parasites are masters of immune regulation; a likely prerequisite for long-term survival by circumventing their hosts' attempt to eradicate them. From a translational perspective, knowledge of immune events as a response to infection with a helminth parasite could be used to reduce the intensity of unwanted inflammatory reactions. Substantial data have accumulated showing that inflammatory reactions that promote a variety of auto-inflammatory diseases are dampened as a consequence of infection with helminth parasites, via either the mobilization of an anti-worm spectrum of immune events or by the direct effect of secretory/excretory bioactive immunomodulatory molecules released from the parasite. However, many issues are outstanding in the definition of the mechanism(s) by which infection with helminth parasites can affect the outcome, positively or negatively, of concomitant disease. We focus on a subgroup of this complex group of metazoan parasites, the cestodes, summarizing studies from rodent models that illustrate if, and by what mechanisms, infection with tapeworms ameliorate or exaggerate disease in their host. The ability of infection with cestodes, or other classes of helminth, to worsen a disease course or confer susceptibility to intracellular pathogens should be carefully considered in the context of 'helminth therapy'. In addition, poorly characterised cestode extracts can regulate murine and human immunocyte function, yet the impact of these in the context of autoimmune or allergic diseases is poorly understood. Thus, studies with cestodes, as representative helminths, have helped cement the concept that infection with parasitic helminths can inhibit concomitant disease; however, issues relating to long-term effects, potential side-effects, mixed pathogen infections and purification of immunomodulatory molecules from the parasite remain as challenges that need to be addressed in order to achieve the use of helminths as anti-inflammatory agents for human diseases.

Hernandez JL; Leung G; McKay DM

2013-03-01

288

Cestode regulation of inflammation and inflammatory diseases.  

Science.gov (United States)

Helminth parasites are masters of immune regulation; a likely prerequisite for long-term survival by circumventing their hosts' attempt to eradicate them. From a translational perspective, knowledge of immune events as a response to infection with a helminth parasite could be used to reduce the intensity of unwanted inflammatory reactions. Substantial data have accumulated showing that inflammatory reactions that promote a variety of auto-inflammatory diseases are dampened as a consequence of infection with helminth parasites, via either the mobilization of an anti-worm spectrum of immune events or by the direct effect of secretory/excretory bioactive immunomodulatory molecules released from the parasite. However, many issues are outstanding in the definition of the mechanism(s) by which infection with helminth parasites can affect the outcome, positively or negatively, of concomitant disease. We focus on a subgroup of this complex group of metazoan parasites, the cestodes, summarizing studies from rodent models that illustrate if, and by what mechanisms, infection with tapeworms ameliorate or exaggerate disease in their host. The ability of infection with cestodes, or other classes of helminth, to worsen a disease course or confer susceptibility to intracellular pathogens should be carefully considered in the context of 'helminth therapy'. In addition, poorly characterised cestode extracts can regulate murine and human immunocyte function, yet the impact of these in the context of autoimmune or allergic diseases is poorly understood. Thus, studies with cestodes, as representative helminths, have helped cement the concept that infection with parasitic helminths can inhibit concomitant disease; however, issues relating to long-term effects, potential side-effects, mixed pathogen infections and purification of immunomodulatory molecules from the parasite remain as challenges that need to be addressed in order to achieve the use of helminths as anti-inflammatory agents for human diseases. PMID:23058631

Hernandez, Jose-Luis Reyes; Leung, Gabriella; McKay, Derek M

2012-10-08

289

Production of monoclonal antibodies anti-Taenia crassiceps cysticerci with cross-reactivity with Taenia solium antigens/ Produção de anticorpos monoclonais anti-cisticercos de Taenia crassiceps com reatividade cruzada com antígenos de Taenia solium  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese É descrita a produção de potenciais anticorpos monoclonais (MoAbs) usando camundongos BALB/c imunizados com antígenos de líquido vesicular de T. crassiceps (VF-Tcra). O soro imune apresentou anticorpos IgM e IgG anti-VF-Tcra para os peptídeos (more) destes, 5 apresentaram reatividade cruzada com antígeno de Tso. Dois clones identificaram os peptídeos 8-14 e 18kDa de VF-Tcra. Abstract in english We describe the production of the potential monoclonal antibodies (MoAbs) using BALB/c mice immunized with vesicular fluid (VF)-Tcra (T. crassiceps) antigen. Immune sera presented anti-VF-Tcra (

ESPÍNDOLA, Noeli M.; DE GASPARI, Elizabeth N.; NAKAMURA, Paulo M.; VAZ, Adelaide J.

2000-06-01

290

Quantitative screening for anticestode drugs based on changes in baseline enzyme secretion by Taenia crassiceps.  

UK PubMed Central (United Kingdom)

Neurocysticercosis (NCC), an infection of the brain with the larval stage of the Taenia solium tapeworm, is responsible for an estimated one-third of adult-onset epilepsy cases in regions of the world where it is endemic. Currently, anthelmintic drugs used for treatment of NCC are only partially effective, and there is, therefore, a pressing need for new therapeutic agents. Discovery of new anthelmintics with activity against T. solium has been limited by the lack of suitable sensitive assays that allow high-throughput screening. Using an in vitro culture system with Taenia crassiceps metacestodes, we demonstrate that changes in secretion of parasite-associated alkaline phosphatase (AP) and phosphoglucose isomerase (PGI) can be used to detect and quantify anthelmintic effects of praziquantel (PZQ), a drug with activity against T. solium. We applied two enzyme release assays to screen for anti-T. crassiceps activity in nonconventional antiparasitic drugs and demonstrate that nitazoxanide and artesunate induced release of both AP and PGI in differing time- and dose-related patterns. Furthermore, imatinib, a tyrosine kinase inhibitor previously reported to have parasiticidal activity against Schistosoma mansoni, also induced release of both AP and PGI in a dose-dependent manner, similar in pattern to that observed with the other anthelmintics. We also evaluated release of ATP into cyst supernatants as an indicator of drug effects but did not see any differences between treated and untreated cysts. These data provide the basis for rapid and quantitative screening assays for testing for anthelmintic activity in candidate anticestode agents.

Mahanty S; Madrid EM; Nash TE

2013-02-01

291

Quantitative screening for anticestode drugs based on changes in baseline enzyme secretion by Taenia crassiceps.  

Science.gov (United States)

Neurocysticercosis (NCC), an infection of the brain with the larval stage of the Taenia solium tapeworm, is responsible for an estimated one-third of adult-onset epilepsy cases in regions of the world where it is endemic. Currently, anthelmintic drugs used for treatment of NCC are only partially effective, and there is, therefore, a pressing need for new therapeutic agents. Discovery of new anthelmintics with activity against T. solium has been limited by the lack of suitable sensitive assays that allow high-throughput screening. Using an in vitro culture system with Taenia crassiceps metacestodes, we demonstrate that changes in secretion of parasite-associated alkaline phosphatase (AP) and phosphoglucose isomerase (PGI) can be used to detect and quantify anthelmintic effects of praziquantel (PZQ), a drug with activity against T. solium. We applied two enzyme release assays to screen for anti-T. crassiceps activity in nonconventional antiparasitic drugs and demonstrate that nitazoxanide and artesunate induced release of both AP and PGI in differing time- and dose-related patterns. Furthermore, imatinib, a tyrosine kinase inhibitor previously reported to have parasiticidal activity against Schistosoma mansoni, also induced release of both AP and PGI in a dose-dependent manner, similar in pattern to that observed with the other anthelmintics. We also evaluated release of ATP into cyst supernatants as an indicator of drug effects but did not see any differences between treated and untreated cysts. These data provide the basis for rapid and quantitative screening assays for testing for anthelmintic activity in candidate anticestode agents. PMID:23229489

Mahanty, Siddhartha; Madrid, Elise M; Nash, Theodore E

2012-12-10

292

Recent hybridization between Taenia asiatica and Taenia saginata.  

UK PubMed Central (United Kingdom)

Five Taenia tapeworms collected from humans in Tibetan Plateau, Sichuan, China, where three species of human Taenia are sympatrically endemic, were examined for the mitochondrial cox1 gene and two nuclear genes, ef1 and elp. Phylogenetic analyses of these genes revealed that two adult worms showed nuclear-mitochondrial discordance, suggesting that they originated from hybridization between Taenia saginata and Taenia asiatica. One of two worms had T. asiatica-type mtDNA, whereas another worm had T. saginata-type mtDNA, indicating that reciprocal hybridization between T. saginata and T. asiatica could occur. The worm having T. asiatica-type mtDNA was heterozygous at both nuclear loci with T. saginata-type alleles and T. asiatica-type alleles. In another worm, the ef1 locus was heterozygous with a T. saginata-type alleles and T. asiatica-type alleles, while the elp locus was homozygous with T. saginata-type alleles. Self-fertilization is the main reproductive method of the genus Taenia. Since self-fertilization represents a type of inbreeding, each locus in the offspring would become homozygous over generations with genetic drift. The fact that some nuclear loci are still heterozygous means that hybridization might have occurred recently. Hybridization between T. asiatica and T. saginata is probably an ongoing event in many areas in which they are sympatrically endemic.

Yamane K; Suzuki Y; Tachi E; Li T; Chen X; Nakao M; Nkouawa A; Yanagida T; Sako Y; Ito A; Sato H; Okamoto M

2012-06-01

293

Recent hybridization between Taenia asiatica and Taenia saginata.  

Science.gov (United States)

Five Taenia tapeworms collected from humans in Tibetan Plateau, Sichuan, China, where three species of human Taenia are sympatrically endemic, were examined for the mitochondrial cox1 gene and two nuclear genes, ef1 and elp. Phylogenetic analyses of these genes revealed that two adult worms showed nuclear-mitochondrial discordance, suggesting that they originated from hybridization between Taenia saginata and Taenia asiatica. One of two worms had T. asiatica-type mtDNA, whereas another worm had T. saginata-type mtDNA, indicating that reciprocal hybridization between T. saginata and T. asiatica could occur. The worm having T. asiatica-type mtDNA was heterozygous at both nuclear loci with T. saginata-type alleles and T. asiatica-type alleles. In another worm, the ef1 locus was heterozygous with a T. saginata-type alleles and T. asiatica-type alleles, while the elp locus was homozygous with T. saginata-type alleles. Self-fertilization is the main reproductive method of the genus Taenia. Since self-fertilization represents a type of inbreeding, each locus in the offspring would become homozygous over generations with genetic drift. The fact that some nuclear loci are still heterozygous means that hybridization might have occurred recently. Hybridization between T. asiatica and T. saginata is probably an ongoing event in many areas in which they are sympatrically endemic. PMID:22301089

Yamane, Kanako; Suzuki, Yumi; Tachi, Eiko; Li, Tiaoying; Chen, Xingwang; Nakao, Minoru; Nkouawa, Agathe; Yanagida, Testuya; Sako, Yasuhito; Ito, Akira; Sato, Hiroshi; Okamoto, Munehiro

2012-01-25

294

PET Reveals Inflammation around Calcified Taenia solium Granulomas with Perilesional Edema.  

UK PubMed Central (United Kingdom)

OBJECTIVE: Neurocysticercosis, an infection with the larval form of the tapeworm, Taeniasolium, is the cause of 29% of epilepsy in endemic regions. Epilepsy in this population is mostly associated with calcified granulomas; at the time of seizure recurrence 50% of those with calcifications demonstrate transient surrounding perilesional edema. Whether edema is consequence of the seizure, or a result of host inflammation directed against parasite antigens or other processes is unknown. To investigate whether perilesional edema is due to inflammation, we imaged a marker of neuroinflammation, translocater protein (TSPO), using positron emission tomography (PET) and the selective ligand (11)C-PBR28. METHODS: In nine patients with perilesional edema, degenerating cyst or both, PET findings were compared to the corresponding magnetic resonance images. Degenerating cysts were also studied because unlike perilesional edema, degenerating cysts are known to have inflammation. In three of the nine patients, changes in (11)C-PBR28 binding were also studied over time. (11)C-PBR28 binding was compared to the contralateral un-affected region. RESULTS: (11)C-PBR28 binding increased by a mean of 13% in perilesional edema or degenerating cysts (P = 0·0005, n = 13 in nine patients). Among these 13 lesions, perilesional edema (n=10) showed a slightly smaller increase of 10% compared to the contralateral side (P = 0·005) than the three degenerating cysts. In five lesions with perilesional edema in which repeated measurements of (11)C-PBR28 binding were done, increased binding lasted for 2-9 months. CONCLUSIONS: Increased TSPO in perilesional edema indicates an inflammatory etiology. The long duration of increased TSPO binding after resolution of the original perilesional edema and the pattern of periodic episodes is consistent with intermittent exacerbation from a continued baseline presence of low level inflammation. Novel anti-inflammatory measures may be useful in the prevention or treatment of seizures in this population.

Fujita M; Mahanty S; Zoghbi SS; Ferraris Araneta MD; Hong J; Pike VW; Innis RB; Nash TE

2013-01-01

295

Ocorrência de Taenia sp. na população atendida no laboratório central do Instituto Adolfo Lutz, São Paulo, SP, Brasil (1960/1989) Occurrence of Taenia sp. in the population attended in the central laboratory of "Instituto Adolfo Lutz", São Paulo, SP, Brazil (1960/1989)  

Directory of Open Access Journals (Sweden)

Full Text Available Foram examinados retrospectivamente os relatórios mensais e anuais da Seção de Enteroparasitoses do Laboratório Central do Instituto Adolfo Lutz, São Paulo, SP, do período de 1960 a 1989, perfazendo uma série histórica de 30 anos, com 1.519.730 exames protoparasitológicos e 355 identificações de proglotes de Taenia. Pelo método da sedimentação espontânea foram diagnosticados 7.663 (0,5%) casos de presença de ovos de Taenia sp. nas fezes. Das 355 proglotes enviadas para identificação, 311 (87,60%) estavam em condições de serem especificadas, e dessas, 273 (87,80%) eram proglotes de Taenia saginata e 38 (12,22%) de T. solium.Monthly and yearly reports of the Seção de Enteroparasitoses of the Instituto Adolfo Lutz (São Paulo, SP, Brazil) from 1960 to 1989 with 1,519,730 parasitological stool examinations were studied. There were also 355 identifications of Taenia sp. proglottids. Using HOFFMAN, PONS & JANER's method, 7,663 (0.5%) cases of taeniasis were diagnosed, and 311 (87.60%) of the 355 proglottids were on easy terms to be specified, 273 (87.80%) of them were from Taenia saginata.

Rosa Maria Donini Souza Dias; Maria Ivani P. Gonçalves da Silva; Ana Célia Steffen Mangini; Sylvia A. Gurgel Vellosa; Domingas M. A. G. Vieira Torres; Rita Maria da Silva; Adelaide José Vaz

1991-01-01

296

Ocorrência de Taenia sp. na população atendida no laboratório central do Instituto Adolfo Lutz, São Paulo, SP, Brasil (1960/1989)/ Occurrence of Taenia sp. in the population attended in the central laboratory of "Instituto Adolfo Lutz", São Paulo, SP, Brazil (1960/1989)  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Foram examinados retrospectivamente os relatórios mensais e anuais da Seção de Enteroparasitoses do Laboratório Central do Instituto Adolfo Lutz, São Paulo, SP, do período de 1960 a 1989, perfazendo uma série histórica de 30 anos, com 1.519.730 exames protoparasitológicos e 355 identificações de proglotes de Taenia. Pelo método da sedimentação espontânea foram diagnosticados 7.663 (0,5%) casos de presença de ovos de Taenia sp. nas fezes. Das 355 proglotes (more) enviadas para identificação, 311 (87,60%) estavam em condições de serem especificadas, e dessas, 273 (87,80%) eram proglotes de Taenia saginata e 38 (12,22%) de T. solium. Abstract in english Monthly and yearly reports of the Seção de Enteroparasitoses of the Instituto Adolfo Lutz (São Paulo, SP, Brazil) from 1960 to 1989 with 1,519,730 parasitological stool examinations were studied. There were also 355 identifications of Taenia sp. proglottids. Using HOFFMAN, PONS & JANER's method, 7,663 (0.5%) cases of taeniasis were diagnosed, and 311 (87.60%) of the 355 proglottids were on easy terms to be specified, 273 (87.80%) of them were from Taenia saginata.

Dias, Rosa Maria Donini Souza; Silva, Maria Ivani P. Gonçalves da; Mangini, Ana Célia Steffen; Vellosa, Sylvia A. Gurgel; Torres, Domingas M. A. G. Vieira; Silva, Rita Maria da; Vaz, Adelaide José

1991-04-01

297

Influence of geographical scale on the detection of density dependence in the host-parasite system, Arvicola terrestris and Taenia taeniaeformis.  

Science.gov (United States)

Infection by the cestode Taenia taeniaeformis was investigated within numerous cyclic populations of the fossorial water vole Arvicola terrestris sampled during 4 years in Franche-Comté (France). The relative influence of different rodent demographic parameters on the presence of this cestode was assessed by considering (1) the demographic phase of the cycle; (2) density at the local geographical scale (10 km2). The local scale corresponded to the rodent population (intermediate host), while the large scale corresponded to the definitive host population (wild and feral cats). General linear models based on analyses of 1804 voles revealed the importance of local density but also of year, rodent age, season and interactions between year and season and between age and season. Prevalence was significantly higher in low vole densities than during local outbreaks. By contrast, the large geographical scale density and the demographic phase had less influence on infection by the cestode. The potential impacts of the cestode on the fitness of the host were assessed and infection had no effect on the host body mass, litter size or sexual activity of voles. PMID:16329763

Deter, J; Berthier, K; Chaval, Y; Cosson, J F; Morand, S; Charbonnel, N

2005-12-05

298

Trypanorhynch Cestodes of Commercial Fishes from Northeast Brazilian Coastal Waters  

Directory of Open Access Journals (Sweden)

Full Text Available A large scale investigation on trypanorhynch cestode infestation of tropical marine fishes was carried out along the Northeast Brazilian coast in the summer of 1991 and 1993. A total of 798 fish specimens belonging to 57 species and 30 families were examined. Metacestodes of 11 different trypanorhynchs were found: Callitetrarhynchus gracilis, Dasyrhynchus giganteus, Grillotia sp., Nybelinia edwinlintoni, N. indica, N. senegalensis, Nybelinia c.f. lingualis, Otobothrium cysticum, Pseudolacistorhynchus noodti, Pseudotobothrium dipsacum and Pterobothrium kingstoni. Scanning electron microscopy was used to clarify details of the tentacular armature of some species. Rose-thorn shaped hooklets, regularly arranged like microtriches, are described from the bothridial surface of N. edwinlintoni. Of the 57 fish species, 15 harboured trypanorhynch cestodes. Of these the mullid Pseudupeneus maculatus was the most heavily infested fish species, harbouring 5 different trypanorhynch species. P. noodti in P. maculatus had the highest prevalence (87%) and intensity (maximum = 63) of infestation. C. gracilis was the parasite with the lowest host-specificity. It could be isolated from 10 fish species. The cestode fauna of the Northeast Brazilian coast appears to be similar to that of the West African coast. Five of the trypanorhynch cestodes found during this study are common to both localities. The two single cases of intra musculature infestation in Citharichthys spilopterus and Haemulon aurolineatum by trypanorhynch cestodes indicate that marketability of the investigated commercially exploited fish species is inconsequential.

Palm Harry W

1997-01-01

299

Priorities for research and control of cestode zoonoses in Asia.  

UK PubMed Central (United Kingdom)

Globally, cestode zoonoses cause serious public health problems, particularly in Asia. Among all neglected zoonotic diseases, cestode zoonoses account for over 75% of global disability adjusted life years (DALYs) lost. An international symposium on cestode zoonoses research and control was held in Shanghai, China between 28th and 30th October 2012 in order to establish joint efforts to study and research effective approaches to control these zoonoses. It brought together 96 scientists from the Asian region and beyond to exchange ideas, report on progress, make a gap analysis, and distill prioritizing settings with a focus on the Asian region. Key objectives of this international symposium were to agree on solutions to accelerate progress towards decreasing transmission, and human mortality and morbidity caused by the three major cestode zoonoses (cystic echinococcosis, alveolar echinococcosis, and cysticercosis); to critically assess the potential to control these diseases; to establish a research and validation agenda on existing and new approaches; and to report on novel tools for the study and control of cestode zoonoses.

Xiao N; Yao JW; Ding W; Giraudoux P; Craig PS; Ito A

2013-01-01

300

Taenia crassiceps WFU cysticerci synthesize corticosteroids in vitro: metyrapone regulates the production.  

UK PubMed Central (United Kingdom)

Taenia solium and Taenia crassiceps WFU cysticerci and tapeworms have the ability to synthesize sex steroid hormones and have a functional 3?-hydroxisteroid dehydrogenase. Corticosteroids (CS) like corticosterone and dexamethasone have been shown to stimulate in vitro estrogen production by Taenia crassiceps WFU cysticerci. The aim of this work was to study the ability of T. crassiceps WFU cysticerci to synthesize corticosteroids, and the effect of the inhibitor metyrapone on the CS synthesis. For this purpose T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, thoroughly washed and pre-incubated in multiwells for 24 h in DMEM plus antibiotics/antimycotics. The tritiated CS precursor progesterone ((3)H-P4) was added to the culture media and parasites cultured for different periods. Blanks containing the culture media plus the (3)H-P4 were simultaneously incubated. Blanks and parasite culture media were ether extracted and analyzed by thin layer chromatography (TLC) in two different solvent systems. Corticosterone production was measured in the culture media by RIA. In some experiments metyrapone (0.1-0.5 mM) was added for 24, 48 or 72 h. Results showed that cysticerci mainly synthesized tritiated 11-deoxy corticosterone (DOC) and small amounts of corticosterone that was also detected by RIA. Small amounts of (3)H-11-deoxy cortisol were also found. Corticosteroid synthesis was time dependent. The addition of metyrapone significantly inhibited tritiated DOC, deoxycortisol and corticosterone synthesis. These results show for the first time that parasites have the capacity to synthesize CS that is modulated by metyrapone. Data suggest that DOC is the main corticosteroid in the parasites.

Valdez RA; Hinojosa L; Gómez Y; Willms K; Romano MC

2012-05-01

 
 
 
 
301

Taenia crassiceps WFU cysticerci synthesize corticosteroids in vitro: metyrapone regulates the production.  

Science.gov (United States)

Taenia solium and Taenia crassiceps WFU cysticerci and tapeworms have the ability to synthesize sex steroid hormones and have a functional 3?-hydroxisteroid dehydrogenase. Corticosteroids (CS) like corticosterone and dexamethasone have been shown to stimulate in vitro estrogen production by Taenia crassiceps WFU cysticerci. The aim of this work was to study the ability of T. crassiceps WFU cysticerci to synthesize corticosteroids, and the effect of the inhibitor metyrapone on the CS synthesis. For this purpose T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, thoroughly washed and pre-incubated in multiwells for 24 h in DMEM plus antibiotics/antimycotics. The tritiated CS precursor progesterone ((3)H-P4) was added to the culture media and parasites cultured for different periods. Blanks containing the culture media plus the (3)H-P4 were simultaneously incubated. Blanks and parasite culture media were ether extracted and analyzed by thin layer chromatography (TLC) in two different solvent systems. Corticosterone production was measured in the culture media by RIA. In some experiments metyrapone (0.1-0.5 mM) was added for 24, 48 or 72 h. Results showed that cysticerci mainly synthesized tritiated 11-deoxy corticosterone (DOC) and small amounts of corticosterone that was also detected by RIA. Small amounts of (3)H-11-deoxy cortisol were also found. Corticosteroid synthesis was time dependent. The addition of metyrapone significantly inhibited tritiated DOC, deoxycortisol and corticosterone synthesis. These results show for the first time that parasites have the capacity to synthesize CS that is modulated by metyrapone. Data suggest that DOC is the main corticosteroid in the parasites. PMID:22321721

Valdez, R A; Hinojosa, L; Gómez, Y; Willms, K; Romano, M C

2012-02-02

302

Hydrophobic fraction of Taenia saginata metacestodes, rather than hydrophilic fraction, contains immunodominant markers for diagnosing human neurocysticercosis Fração hidrofóbica de metacestódeos de Taenia saginata, ao contrário da fração hidrofílica, contém marcadores imunodominantes para o diagnóstico de neurocisticercose humana  

Directory of Open Access Journals (Sweden)

Full Text Available INTRODUCTION: Considering that alternative antigens for diagnosing neurocysticercosis continue to be a challenge because of the increasing difficulty in obtaining parasites from naturally infected pigs for preparation of Taenia solium homologous antigen, the aim of the present study was to evaluate the detergent (D) and aqueous (A) fractions from saline extract of Taenia saginata metacestodes for diagnosing neurocysticercosis. METHODS: Taenia saginata was obtained from naturally infected bovines in the Triângulo Mineiro region, State of Minas Gerais, Brazil. The carcasses came from cold storage units and had been slaughtered in accordance with the inspection technique recommended by the Federal Inspection Service. The D and A fractions were obtained by using Triton X-114 (TX-114). Serum samples were obtained from 40 patients with a diagnosis of neurocysticercosis, 45 with other parasitic diseases and 30 from apparently normal individuals. IgG antibody levels were evaluated using the ELISA and immunoblotting assays. RESULTS: The ELISA sensitivity and specificity were 95% and 73.3%, when using saline extract; 95% and 82.6% for the D fraction; and 65% and 61.3% for the A fraction, respectively. The immunoblotting assay confirmed the ELISA results, such that the D fraction was more efficient than the other extracts, and the 70-68kDa component was immunodominant among neurocysticercosis patients. CONCLUSIONS: These results demonstrated that the D fraction from Taenia saginata metacestodes obtained using TX-114 can be used as a heterologous antigenic fraction in the immunoblotting assay for serologically diagnosing human neurocysticercosis, given its ability to select immunodominant antigens.INTRODUÇÃO: Considerando que antígenos alternativos para o diagnóstico da neurocisticercose (NC) continua sendo um desafio devido ao aumento da dificuldade em se obter parasitas de suínos naturalmente infectados, para a preparação do antígeno homólogo de Taenia solium, o objetivo do presente estudo foi avaliar frações detergente (D) e aquosa (A), do extrato salino de metacestódeo de Taenia saginata para diagnóstico da NC. MÉTODOS: Bovinos, naturalmente infectados com Taenia saginata, procedentes da região do Triângulo Mineiro, Estado de Minas Gerais, Brasil, foram obtidos de frigoríficos e abatidos de acordo com a técnica de inspeção recomendada pelo Serviço de Inspeção Federal. As frações D e A foram obtidas utilizando Triton X-114 (TX-114). Amostras de soro foram obtidas de 40 pacientes com diagnóstico de NC, 45 com diagnóstico de outras doenças parasitárias e 30 de indivíduos aparentemente normais. Níveis de IgG foram avaliados pelos testes ELISA e Imunoblotting. RESULTADOS: A sensibilidade e especificidade do teste ELISA foram 95% e 73,3%, quando utilizado o extrato salino, 95% e 82,6% para fração D, e 65% e 61,3% para a fração A, respectivamente. O ensaio Imunoblotting confirmou os resultados do teste ELISA, sendo a fração D mais eficiente que os outros extratos, observando-se que o componente 70-68kDa se comportou como imunodominante para os pacientes com NC. CONCLUSÕES: Estes resultados demonstraram que a fração D de metacestódeo de Taenia saginata obtida com TX-114 pode ser utilizada como fração antigênica heteróloga pelo Imunoblotting para o diagnóstico sorológico da NC humana, considerando sua habilidade para selecionar antígenos imunodominantes.

Flávia de Assunção Gonçalves; Gleyce Alves Machado; Heliana Batista Oliveira; Maria Teresa Nunes Pacheco Rezende; José Roberto Mineo; Julia Maria Costa-Cruz

2010-01-01

303

Ovicidal activity of different concentrations of Pochonia chlamydosporia chlamydospores on Taenia taeniaeformis eggs.  

UK PubMed Central (United Kingdom)

Three concentrations of chlamydospores of the nematophagous fungus Pochonia chlamydosporia (1000, 10,000 and 20,000 per Petri dish) were evaluated in vitro on Taenia taeniaeformis eggs. Chlamydospores at each concentration were cultured in two different media: 2% water-agar (2%WA) and 2% corn-meal-agar (2%CMA). Taenia taeniaeformis eggs were plated in each chlamydospore concentration in 2%WA and 2%CMA (treated groups) and without fungus (control group). Eggs were removed from each Petri dish at intervals of 7, 14 and 21 days and classified according to ovicidal activity (type 1, type 2 and type 3 effects). Plates containing 2%CMA showed the highest percentages for type 3 effect (81.3%) on the 21st day of observation. A difference (P < 0.01) between the media 2%WA and 2%CMA for type 1 effect was observed only at a concentration of 1000 chlamydospores on the 7th day. There were differences (P < 0.01) between 2%WA and 2%CMA on the 14th and 21st days, at the concentration of 20,000 chlamydospores, for type 1 and type 3 effects. Regression curves for type 3 effect in 2%WA and 2%CMA at the tested concentrations showed higher ovicidal activity with increasing chlamydospore concentrations. Results indicate that, at concentrations of 1000, 10,000 and 20,000 per Petri dish, chlamydospores of P. chlamydosporia effectively destroyed T. taeniaeformis eggs and can be considered a potential biological control agent for this cestode.

Braga FR; Silva AR; Carvalho RO; Araújo JV; Pinto PS

2011-03-01

304

Polycystic echinococcosis in Colombia: the larval cestodes in infected rodents.  

UK PubMed Central (United Kingdom)

Described are the characteristics of the polycystic larval cestodes found in an endemic area of echinococcosis in the Easter Plains of Colombia and the tissue reaction evoked in infected rodents. Of 848 free-ranging animals examined, polycystic hydatids were found in 44/93 Cuniculus paca and 1/369 Proechimys sp. None of 20 Dasyprocta fuliginosa examined was infected, but hunters provided a heart with hydatid cysts and information about two additional animals with infected livers. Recognition of an endemic area of polycystic echinococcosis provides a means to investigate the life cycle of the parasites and to study the histogenesis of the larval cestodes in susceptible laboratory animals.

Morales GA; Guzman VH; Wells EA; Angel D

1979-07-01

305

Polycystic echinococcosis in Colombia: the larval cestodes in infected rodents.  

Science.gov (United States)

Described are the characteristics of the polycystic larval cestodes found in an endemic area of echinococcosis in the Easter Plains of Colombia and the tissue reaction evoked in infected rodents. Of 848 free-ranging animals examined, polycystic hydatids were found in 44/93 Cuniculus paca and 1/369 Proechimys sp. None of 20 Dasyprocta fuliginosa examined was infected, but hunters provided a heart with hydatid cysts and information about two additional animals with infected livers. Recognition of an endemic area of polycystic echinococcosis provides a means to investigate the life cycle of the parasites and to study the histogenesis of the larval cestodes in susceptible laboratory animals. PMID:501848

Morales, G A; Guzman, V H; Wells, E A; Angel, D

1979-07-01

306

Usefulness of serological ELISA assay for Taenia saginata to detect naturally infected bovines Utilização de teste sorológico ELISA para a detecção de bovinos naturalmente infectados por Taenia saginata  

Directory of Open Access Journals (Sweden)

Full Text Available Bovine cysticercosis, a cosmopolitan disease caused by Taenia saginata, leads to economic losses due to carcass devaluation at slaughter. Sanitary inspection at slaughterhouses, the routine diagnostic method in Brazil, lacks the necessary sensitivity to detect the mildly infected cattle that are typically encoutered in Brazil. In this study we have tested cattle sera from animals diagnosed as positive and negative by veterianry inspection for (1) anti-parasite antibodies using metacestodes antigens (T. solium vesicular fluid and T. saginata secretions) and (2) the HP10 secreted antigen of viable metacestodes. The cut-off values were calculated by ROC curve for intense and mild infections conditions, and by the classical method ( for negative samples). The sensitivity and specificity of these diagnostic tests were different depending on the assumed cut-off value and, importantly, whether the infection was mild or intense. In spite of these observations, however, such ELISA assays for serum antibodies and parasite antigens constitute an important tool for epidemiological porposes, and in establishing priorities for the control of bovine cysticercosis.A cisticercose bovina, uma doença cosmopolita causada pela Taenia saginata, resulta em perdas econômias devido à desvalorização de carcaças durante o abate. A inspeção sanitária nos frigoríficos, método de diagnóstico de rotina no Brasil, não possui sensibilidade necessária para detectar animais levemente infectados, os quais são tipicamente encontrados no Brasil. Neste estudo testou-se soro de animais diagnosticados positivos e negativos pela inspeção veterinária por (1) anticorpos anti-parasita usando antígenos de metacestóides (fluido vesicular de T. solium e secreções de T. saginata) e (2) antígeno secretado de metacestóides viáveis. Os pontos de corte foram calculados pela curva ROC, considerando condições de intensa e leve infeção, e pelo método clássico ( das amostras negativas). A sensibilidade e a especificidade dos testes diagnósticos foram diferentes dependendo do valor de ponto de corte assumido e, sobretudo, se a infecção era intensa ou leve. Apesar destas observações, no entanto, tanto o ensaio ELISA para anticorpos séricos quanto para antígeno de parasita constituem importante ferramenta para propósitos epidemiológicos e no estabelecimento de prioridades no controle da cisticercose bovina.

Silvana de Cássia Paulan; Rutilia Marisela Hernándes Gonzáles; Laura Adalid Peralta; Josy Campanhã Vicentini-Oliveira; Germano Francisco Biondi; Edda Sciuto Conde; Robert Michael Evans Parkhouse; Cáris Maroni Nunes

2013-01-01

307

Usefulness of serological ELISA assay for Taenia saginata to detect naturally infected bovines/ Utilização de teste sorológico ELISA para a detecção de bovinos naturalmente infectados por Taenia saginata  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese A cisticercose bovina, uma doença cosmopolita causada pela Taenia saginata, resulta em perdas econômias devido à desvalorização de carcaças durante o abate. A inspeção sanitária nos frigoríficos, método de diagnóstico de rotina no Brasil, não possui sensibilidade necessária para detectar animais levemente infectados, os quais são tipicamente encontrados no Brasil. Neste estudo testou-se soro de ani (more) mais diagnosticados positivos e negativos pela inspeção veterinária por (1) anticorpos anti-parasita usando antígenos de metacestóides (fluido vesicular de T. solium e secreções de T. saginata) e (2) antígeno secretado de metacestóides viáveis. Os pontos de corte foram calculados pela curva ROC, considerando condições de intensa e leve infeção, e pelo método clássico ( das amostras negativas). A sensibilidade e a especificidade dos testes diagnósticos foram diferentes dependendo do valor de ponto de corte assumido e, sobretudo, se a infecção era intensa ou leve. Apesar destas observações, no entanto, tanto o ensaio ELISA para anticorpos séricos quanto para antígeno de parasita constituem importante ferramenta para propósitos epidemiológicos e no estabelecimento de prioridades no controle da cisticercose bovina. Abstract in english Bovine cysticercosis, a cosmopolitan disease caused by Taenia saginata, leads to economic losses due to carcass devaluation at slaughter. Sanitary inspection at slaughterhouses, the routine diagnostic method in Brazil, lacks the necessary sensitivity to detect the mildly infected cattle that are typically encoutered in Brazil. In this study we have tested cattle sera from animals diagnosed as positive and negative by veterianry inspection for (1) anti-parasite antibodies (more) using metacestodes antigens (T. solium vesicular fluid and T. saginata secretions) and (2) the HP10 secreted antigen of viable metacestodes. The cut-off values were calculated by ROC curve for intense and mild infections conditions, and by the classical method ( for negative samples). The sensitivity and specificity of these diagnostic tests were different depending on the assumed cut-off value and, importantly, whether the infection was mild or intense. In spite of these observations, however, such ELISA assays for serum antibodies and parasite antigens constitute an important tool for epidemiological porposes, and in establishing priorities for the control of bovine cysticercosis.

Paulan, Silvana de Cássia; Gonzáles, Rutilia Marisela Hernándes; Peralta, Laura Adalid; Vicentini-Oliveira, Josy Campanhã; Biondi, Germano Francisco; Conde, Edda Sciuto; Parkhouse, Robert Michael Evans; Nunes, Cáris Maroni

2013-06-01

308

Usefulness of serological ELISA assay for Taenia saginata to detect naturally infected bovines/ Utilização de teste sorológico ELISA para a detecção de bovinos naturalmente infectados por Taenia saginata  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese A cisticercose bovina, uma doença cosmopolita causada pela Taenia saginata, resulta em perdas econômias devido á desvalorização de carcaças durante o abate. A inspeção sanitária nos frigoríficos, método de diagnóstico de rotina no Brasil, não possui sensibilidade necessária para detectar animais levemente infectados, os quais são tipicamente encontrados no Brasil. Neste estudo testou-se soro de ani (more) mais diagnosticados positivos e negativos pela inspeção veterinária por (1) anticorpos anti-parasita usando antígenos de metacestóides (fluido vesicular de T. solium e secreções de T. saginata) e (2) antígeno secretado de metacestóides viáveis. Os pontos de corte foram calculados pela curva ROC, considerando condições de intensa e leve infeção, e pelo método clássico ( das amostras negativas). A sensibilidade e a especificidade dos testes diagnósticos foram diferentes dependendo do valor de ponto de corte assumido e, sobretudo, se a infecção era intensa ou leve. Apesar destas observações, no entanto, tanto o ensaio ELISA para anticorpos séricos quanto para antígeno de parasita constituem importante ferramenta para propósitos epidemiológicos e no estabelecimento de prioridades no controle da cisticercose bovina. Abstract in english Bovine cysticercosis, a cosmopolitan disease caused by Taenia saginata, leads to economic losses due to carcass devaluation at slaughter. Sanitary inspection at slaughterhouses, the routine diagnostic method in Brazil, lacks the necessary sensitivity to detect the mildly infected cattle that are typically encoutered in Brazil. In this study we have tested cattle sera from animals diagnosed as positive and negative by veterianry inspection for (1) anti-parasite antibodies (more) using metacestodes antigens (T. solium vesicular fluid and T. saginata secretions) and (2) the HP10 secreted antigen of viable metacestodes. The cut-off values were calculated by ROC curve for intense and mild infections conditions, and by the classical method ( for negative samples). The sensitivity and specificity of these diagnostic tests were different depending on the assumed cut-off value and, importantly, whether the infection was mild or intense. In spite of these observations, however, such ELISA assays for serum antibodies and parasite antigens constitute an important tool for epidemiological porposes, and in establishing priorities for the control of bovine cysticercosis.

Paulan, Silvana de Cassia; Gonzales, Rutilia Marisela Hernandes; Peralta, Laura Adalid; Vicentini-Oliveira, Josy Campanha; Biondi, Germano Francisco; Conde, Edda Sciuto; Parkhouse, Robert Michael Evans; Nunes, Caris Maroni

2013-06-01

309

Use of cestodes as indicator of heavy-metal pollution.  

UK PubMed Central (United Kingdom)

Thirty snakehead fish, Channa micropeltes (Cuvier, 1831) were collected at Lake Kenyir, Malaysia. Muscle, liver, intestine and kidney tissues were removed from each fish and the intestine was opened to reveal cestodes. In order to assess the concentration of heavy metal in the environment, samples of water in the surface layer and sediment were also collected. Tissues were digested and the concentrations of manganese (Mn), zinc (Zn), copper (Cu), cadmium (Cd) and lead (Pb) were analysed by using inductively-coupled plasma mass-spectrometry (ICP-MS) equipment. The results demonstrated that the cestode Senga parva (Fernando and Furtado, 1964) from fish hosts accumulated some heavy metals to a greater extent than the water and some fish tissues, but less than the sediment. In three (Pb, Zn and Mn) of the five elements measured, cestodes accumulated the highest metal concentrations, and in remaining two (Cu and Cd), the second highest metal accumulation was recorded in the cestodes when compared to host tissues. Therefore, the present study indicated that Senga parva accumulated metals and might have potential as a bioindicator of heavy-metal pollution.

Yen Nhi TT; Mohd Shazili NA; Shaharom-Harrison F

2013-01-01

310

Use of cestodes as indicator of heavy-metal pollution.  

Science.gov (United States)

Thirty snakehead fish, Channa micropeltes (Cuvier, 1831) were collected at Lake Kenyir, Malaysia. Muscle, liver, intestine and kidney tissues were removed from each fish and the intestine was opened to reveal cestodes. In order to assess the concentration of heavy metal in the environment, samples of water in the surface layer and sediment were also collected. Tissues were digested and the concentrations of manganese (Mn), zinc (Zn), copper (Cu), cadmium (Cd) and lead (Pb) were analysed by using inductively-coupled plasma mass-spectrometry (ICP-MS) equipment. The results demonstrated that the cestode Senga parva (Fernando and Furtado, 1964) from fish hosts accumulated some heavy metals to a greater extent than the water and some fish tissues, but less than the sediment. In three (Pb, Zn and Mn) of the five elements measured, cestodes accumulated the highest metal concentrations, and in remaining two (Cu and Cd), the second highest metal accumulation was recorded in the cestodes when compared to host tissues. Therefore, the present study indicated that Senga parva accumulated metals and might have potential as a bioindicator of heavy-metal pollution. PMID:23146722

Yen Nhi, Tran Thi; Mohd Shazili, Noor Azhar; Shaharom-Harrison, Faizah

2012-11-09

311

The effect of glucocorticoids on sex steroid synthesis in cultured Taenia crassiceps Wake Forest University (WFU) cysticerci.  

UK PubMed Central (United Kingdom)

We have shown previously that cultured Taenia crassiceps Wake Forest University (WFU) and Taenia solium cysticerci, as well as the adult worms, synthesize sex steroid hormones from [3H]steroid precursors and that androgens and oestrogens influence the in vitro development of the parasites. Glucocorticoids (GCs) are used to control the inflammation caused by T. solium cysticerci in the brain. These steroids stimulate oestrogen synthesis in several tissues. Since there is no information on the effect of GC on the endocrine function of cysticerci, we investigated the effect of natural and synthetic GCs on the synthesis of oestrogens in cultured T. crassiceps WFU cysticerci. The cysticerci were obtained from the peritoneal cavity of infected female BALB/c mice; the cysts were washed extensively and pre-cultured in Dulbecco's Modified Eagle's Medium (DMEM) plus antibiotics for 5 days. The parasites were further cultured with different doses of corticosterone, dexamethasone or the vehicle for 5 days. [3H]Dehydroepiandrosterone (3H-DHEA) was added to the media and the cysticerci were further incubated for 6 or 24 h. Media were then removed and the steroids ether-extracted. Aliquots of the media were seeded on silica gel plates and developed in solvent systems. Parasites incubated in the presence of 3H-DHEA synthesized [3H]androstenediol, [3H]testosterone and [3H]17?-oestradiol ([3H]17?-E2). The addition of 100 nm or higher corticosterone doses to the media increased [3H]17?-E2 synthesis fourfold after 24 h. Dexamethasone also increased [3H]17?-E2 synthesis. The experiments presented here show for the first time that corticosterone and the synthetic GC dexamethasone modulate the synthesis of oestrogens by cysticerci.

Hinojosa L; Valdez RA; Salvador V; Rodríguez AG; Willms K; Romano MC

2012-12-01

312

The effect of glucocorticoids on sex steroid synthesis in cultured Taenia crassiceps Wake Forest University (WFU) cysticerci.  

Science.gov (United States)

We have shown previously that cultured Taenia crassiceps Wake Forest University (WFU) and Taenia solium cysticerci, as well as the adult worms, synthesize sex steroid hormones from [3H]steroid precursors and that androgens and oestrogens influence the in vitro development of the parasites. Glucocorticoids (GCs) are used to control the inflammation caused by T. solium cysticerci in the brain. These steroids stimulate oestrogen synthesis in several tissues. Since there is no information on the effect of GC on the endocrine function of cysticerci, we investigated the effect of natural and synthetic GCs on the synthesis of oestrogens in cultured T. crassiceps WFU cysticerci. The cysticerci were obtained from the peritoneal cavity of infected female BALB/c mice; the cysts were washed extensively and pre-cultured in Dulbecco's Modified Eagle's Medium (DMEM) plus antibiotics for 5 days. The parasites were further cultured with different doses of corticosterone, dexamethasone or the vehicle for 5 days. [3H]Dehydroepiandrosterone (3H-DHEA) was added to the media and the cysticerci were further incubated for 6 or 24 h. Media were then removed and the steroids ether-extracted. Aliquots of the media were seeded on silica gel plates and developed in solvent systems. Parasites incubated in the presence of 3H-DHEA synthesized [3H]androstenediol, [3H]testosterone and [3H]17?-oestradiol ([3H]17?-E2). The addition of 100 nm or higher corticosterone doses to the media increased [3H]17?-E2 synthesis fourfold after 24 h. Dexamethasone also increased [3H]17?-E2 synthesis. The experiments presented here show for the first time that corticosterone and the synthetic GC dexamethasone modulate the synthesis of oestrogens by cysticerci. PMID:22152276

Hinojosa, L; Valdez, R A; Salvador, V; Rodríguez, A G; Willms, K; Romano, M C

2011-12-12

313

Crude antigen from Taenia crassiceps cysticercus used as heterologous antigen in ELISA and in EITB for neurocysticercosis diagnosis of patients from Paraná-Brazil  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Neurocisticercose (NCC), causada pela presença do metacestódeo do parasito Taenia solium (Cysticercus cellulosae) no sistema nervoso central, é uma doença mundialmente conhecida como responsável por distúrbios neurológicos. Com o objetivo de validar um imunodiagnóstico para pacientes da rede pública do estado do Paraná-Brasil, o extrato bruto do metacestódeo de T. crassiceps (C. longicollis) foi produzido e utilizado como antígeno heterólogo para o diagnósti (more) co de NCC ativa e inativa utilizando-se ELISA e eletroimunotransferência (EITB). O ensaio de ELISA indireto foi capaz de discriminar a forma ativa e inativa da NCC, apresentando alta especificidade e sensibilidade. Ao se utilizar EITB, nenhuma proteína foi imunodominante de forma a distinguir os diferentes estágios da NCC, embora o ensaio tenha tido 100% de especificidade. Os resultados mostram que os ensaios imunológicos podem ser uma ferramenta auxiliar importante para o diagnóstico da NCC, principalmente para o sistema público de saúde, cujo diagnóstico por imagem não é acessível ou cujos recursos financeiros são escassos. Abstract in english Neurocysticercosis (NCC), the cerebral presence of Taenia solium metacestode (Cysticercus cellulosae), is responsible for neurological disorders worldwide. In order to validate an immunodiagnosis for public-health patients in the State of Parana-Brazil, crude antigen of Taenia crassicepsmetacestode (Cysticercus longicollis) was used as an alternative heterologous antigen to be used in ELISA and in electroimmunotransfer blotting (EITB) for active and inactive NCC diagnosis (more) . Indirect ELISA was able to discriminate between active and inactive samples and presented high specificity and sensitivity. Any immunodominant band was able to distinguish the NCC stages, although the EITB showed 100% specificity. The immunological results proved to be an important auxiliary toll for NCC diagnosis, mainly for public-health systems in developing countries, where either the neuroimage techniques are not accessible or the resources are scarce.

Minozzo, João Carlos; Moura, Juliana de; Almeida, Sérgio Monteiro; Thomaz-Soccol, Vanete

2008-12-01

314

Crude antigen from Taenia crassiceps cysticercus used as heterologous antigen in ELISA and in EITB for neurocysticercosis diagnosis of patients from Paraná-Brazil  

Directory of Open Access Journals (Sweden)

Full Text Available Neurocysticercosis (NCC), the cerebral presence of Taenia solium metacestode (Cysticercus cellulosae), is responsible for neurological disorders worldwide. In order to validate an immunodiagnosis for public-health patients in the State of Parana-Brazil, crude antigen of Taenia crassicepsmetacestode (Cysticercus longicollis) was used as an alternative heterologous antigen to be used in ELISA and in electroimmunotransfer blotting (EITB) for active and inactive NCC diagnosis. Indirect ELISA was able to discriminate between active and inactive samples and presented high specificity and sensitivity. Any immunodominant band was able to distinguish the NCC stages, although the EITB showed 100% specificity. The immunological results proved to be an important auxiliary toll for NCC diagnosis, mainly for public-health systems in developing countries, where either the neuroimage techniques are not accessible or the resources are scarce.Neurocisticercose (NCC), causada pela presença do metacestódeo do parasito Taenia solium (Cysticercus cellulosae) no sistema nervoso central, é uma doença mundialmente conhecida como responsável por distúrbios neurológicos. Com o objetivo de validar um imunodiagnóstico para pacientes da rede pública do estado do Paraná-Brasil, o extrato bruto do metacestódeo de T. crassiceps (C. longicollis) foi produzido e utilizado como antígeno heterólogo para o diagnóstico de NCC ativa e inativa utilizando-se ELISA e eletroimunotransferência (EITB). O ensaio de ELISA indireto foi capaz de discriminar a forma ativa e inativa da NCC, apresentando alta especificidade e sensibilidade. Ao se utilizar EITB, nenhuma proteína foi imunodominante de forma a distinguir os diferentes estágios da NCC, embora o ensaio tenha tido 100% de especificidade. Os resultados mostram que os ensaios imunológicos podem ser uma ferramenta auxiliar importante para o diagnóstico da NCC, principalmente para o sistema público de saúde, cujo diagnóstico por imagem não é acessível ou cujos recursos financeiros são escassos.

João Carlos Minozzo; Juliana de Moura; Sérgio Monteiro Almeida; Vanete Thomaz-Soccol

2008-01-01

315

A monoclonal antibody-based ELISA for the detection of circulating excretory-secretory antigens in Taenia saginata cysticercosis.  

UK PubMed Central (United Kingdom)

A series of monoclonal antibodies (MoAb) produced against excretory and secretory products from 10- and 20-week-old Taenia saginata cysticerci were tested for their ability to detect circulating antigen in a double antibody sandwich enzyme-linked immunosorbent assay (ELISA). Two MoAb, 12G5 and 2H8, proved to be highly reactive with the tegument of viable T. saginata cysticerci and recognized antigenic components of 65, 87 and 100 kDa in immunoblotting. The detection limit of the assay using 12G5 as trapping antibody and 2H8 as a biotinylated indicator antibody was 0.1 ng protein per ml. Although the sensitivity of the test varied from one animal to another, the minimum number of living cysticerci, which could be detected by the ELISA, was 88. Animals harbouring only dead cysticerci gave similar reactions as non-infected control animals. Cross-reactions were only observed with taeniid parasites. The test was able to detect circulating antigen also in sheep and pigs, respectively infected with T. ovis and T. solium and in the serum samples of confirmed cases of human T. solium cysticercosis.

Brandt JR; Geerts S; De Deken R; Kumar V; Ceulemans F; Brijs L; Falla N

1992-07-01

316

A monoclonal antibody-based ELISA for the detection of circulating excretory-secretory antigens in Taenia saginata cysticercosis.  

Science.gov (United States)

A series of monoclonal antibodies (MoAb) produced against excretory and secretory products from 10- and 20-week-old Taenia saginata cysticerci were tested for their ability to detect circulating antigen in a double antibody sandwich enzyme-linked immunosorbent assay (ELISA). Two MoAb, 12G5 and 2H8, proved to be highly reactive with the tegument of viable T. saginata cysticerci and recognized antigenic components of 65, 87 and 100 kDa in immunoblotting. The detection limit of the assay using 12G5 as trapping antibody and 2H8 as a biotinylated indicator antibody was 0.1 ng protein per ml. Although the sensitivity of the test varied from one animal to another, the minimum number of living cysticerci, which could be detected by the ELISA, was 88. Animals harbouring only dead cysticerci gave similar reactions as non-infected control animals. Cross-reactions were only observed with taeniid parasites. The test was able to detect circulating antigen also in sheep and pigs, respectively infected with T. ovis and T. solium and in the serum samples of confirmed cases of human T. solium cysticercosis. PMID:1644522

Brandt, J R; Geerts, S; De Deken, R; Kumar, V; Ceulemans, F; Brijs, L; Falla, N

1992-07-01

317

Cloning and characterization of the fatty acid-binding protein gene from the protoscolex of Taenia multiceps.  

Science.gov (United States)

Taenia multiceps (Cestoda: Taeniidae), a worldwide cestode parasite, is emerging as an important helminthic zoonosis due to serious or fatal central nervous system disease commonly known as coenurosis in domestic and wild ruminants including humans. Herein, a fatty acid-binding protein (FABP) gene was identified from transcriptomic data in T. multiceps. This gene, which contains a complete coding sequence, was amplified by reverse-transcriptase polymerase chain reaction. The corresponding protein, which was named TmFABP, had a molecular weight of 14 kDa, and subsequently was recombinantly expressed in Escherichia coli. The fusion protein was purified on Ni-NTA beads (Bio-Rad). Sodium dodecyl sulfate-polyacrylamide gel electrophoresis and Western blot analyses showed that the purified recombinant protein caused immunogenicity. Immunohistochemical studies showed that TmFABP was expressed at the tegumental level in the protoscolices and in the cells between the body wall and parenchyma layer of the cestode. In sections from gravid proglottids, intense staining was detected in the uterus and eggs. Based on this, TmFABP could be switched on during differentiation of germinative layers to protoscoleces and from metacestodes to adult worms. Taken together, our results already reported for T. multiceps suggest the possibility of TmFABP developing a vaccine to control and prevent coenurosis. PMID:23474657

Nie, Hua-Ming; Xie, Yue; Fu, Yan; Yang, Ying-Dong; Gu, Xiao-Bin; Wang, Shu-Xian; Peng, Xi; Lai, Wei-Ming; Peng, Xue-Rong; Yang, Guang-You

2013-03-09

318

Cloning and characterization of the fatty acid-binding protein gene from the protoscolex of Taenia multiceps.  

UK PubMed Central (United Kingdom)

Taenia multiceps (Cestoda: Taeniidae), a worldwide cestode parasite, is emerging as an important helminthic zoonosis due to serious or fatal central nervous system disease commonly known as coenurosis in domestic and wild ruminants including humans. Herein, a fatty acid-binding protein (FABP) gene was identified from transcriptomic data in T. multiceps. This gene, which contains a complete coding sequence, was amplified by reverse-transcriptase polymerase chain reaction. The corresponding protein, which was named TmFABP, had a molecular weight of 14 kDa, and subsequently was recombinantly expressed in Escherichia coli. The fusion protein was purified on Ni-NTA beads (Bio-Rad). Sodium dodecyl sulfate-polyacrylamide gel electrophoresis and Western blot analyses showed that the purified recombinant protein caused immunogenicity. Immunohistochemical studies showed that TmFABP was expressed at the tegumental level in the protoscolices and in the cells between the body wall and parenchyma layer of the cestode. In sections from gravid proglottids, intense staining was detected in the uterus and eggs. Based on this, TmFABP could be switched on during differentiation of germinative layers to protoscoleces and from metacestodes to adult worms. Taken together, our results already reported for T. multiceps suggest the possibility of TmFABP developing a vaccine to control and prevent coenurosis.

Nie HM; Xie Y; Fu Y; Yang YD; Gu XB; Wang SX; Peng X; Lai WM; Peng XR; Yang GY

2013-05-01

319

[Ostracod, Eucypris infiata, the intermediate host of avian cestodes in the biocenosis of Lake Tengiz  

UK PubMed Central (United Kingdom)

In the biocoenosis of the Lake Tengiz (Central Kazakhstan) Eucypris inflata (0.3--11%) was found to be spontaneously infected with the larvae of cestodes-hymenolepidids (6 species) and dilepidids (1 species). The nesting flamingos and moulting grebes from the same water body were also infected to a great extent with these cestodes. Figures and morphological description of cysticercoids (7 species) and skolex of mature cestodes of Parabiglandatrium phoenicopteri are given.

Gvozdev EV; Maksimova AP

1978-07-01

320

Ovicidal activity of different concentrations of Pochonia chlamydosporia chlamydospores on Taenia taeniaeformis eggs.  

Science.gov (United States)

Three concentrations of chlamydospores of the nematophagous fungus Pochonia chlamydosporia (1000, 10,000 and 20,000 per Petri dish) were evaluated in vitro on Taenia taeniaeformis eggs. Chlamydospores at each concentration were cultured in two different media: 2% water-agar (2%WA) and 2% corn-meal-agar (2%CMA). Taenia taeniaeformis eggs were plated in each chlamydospore concentration in 2%WA and 2%CMA (treated groups) and without fungus (control group). Eggs were removed from each Petri dish at intervals of 7, 14 and 21 days and classified according to ovicidal activity (type 1, type 2 and type 3 effects). Plates containing 2%CMA showed the highest percentages for type 3 effect (81.3%) on the 21st day of observation. A difference (P < 0.01) between the media 2%WA and 2%CMA for type 1 effect was observed only at a concentration of 1000 chlamydospores on the 7th day. There were differences (P < 0.01) between 2%WA and 2%CMA on the 14th and 21st days, at the concentration of 20,000 chlamydospores, for type 1 and type 3 effects. Regression curves for type 3 effect in 2%WA and 2%CMA at the tested concentrations showed higher ovicidal activity with increasing chlamydospore concentrations. Results indicate that, at concentrations of 1000, 10,000 and 20,000 per Petri dish, chlamydospores of P. chlamydosporia effectively destroyed T. taeniaeformis eggs and can be considered a potential biological control agent for this cestode. PMID:20338078

Braga, F R; Silva, A R; Carvalho, R O; Araújo, J V; Pinto, P S A

2010-03-26

 
 
 
 
321

Usefulness of serological ELISA assay for Taenia saginata to detect naturally infected bovines.  

UK PubMed Central (United Kingdom)

Bovine cysticercosis, a cosmopolitan disease caused by Taenia saginata, leads to economic losses due to carcass devaluation at slaughter. Sanitary inspection at slaughterhouses, the routine diagnostic method in Brazil, lacks the necessary sensitivity to detect the mildly infected cattle that are typically encoutered in Brazil. In this study we have tested cattle sera from animals diagnosed as positive and negative by veterianry inspection for (1) anti-parasite antibodies using metacestodes antigens (T. solium vesicular fluid and T. saginata secretions) and (2) the HP10 secreted antigen of viable metacestodes. The cut-off values were calculated by ROC curve for intense and mild infections conditions, and by the classical method ( for negative samples). The sensitivity and specificity of these diagnostic tests were different depending on the assumed cut-off value and, importantly, whether the infection was mild or intense. In spite of these observations, however, such ELISA assays for serum antibodies and parasite antigens constitute an important tool for epidemiological porposes, and in establishing priorities for the control of bovine cysticercosis.

Paulan Sde C; Gonzáles RM; Peralta LA; Vicentini-Oliveira JC; Biondi GF; Conde ES; Parkhouse RM; Nunes CM

2013-04-01

322

Usefulness of serological ELISA assay for Taenia saginata to detect naturally infected bovines.  

Science.gov (United States)

Bovine cysticercosis, a cosmopolitan disease caused by Taenia saginata, leads to economic losses due to carcass devaluation at slaughter. Sanitary inspection at slaughterhouses, the routine diagnostic method in Brazil, lacks the necessary sensitivity to detect the mildly infected cattle that are typically encoutered in Brazil. In this study we have tested cattle sera from animals diagnosed as positive and negative by veterianry inspection for (1) anti-parasite antibodies using metacestodes antigens (T. solium vesicular fluid and T. saginata secretions) and (2) the HP10 secreted antigen of viable metacestodes. The cut-off values were calculated by ROC curve for intense and mild infections conditions, and by the classical method ( for negative samples). The sensitivity and specificity of these diagnostic tests were different depending on the assumed cut-off value and, importantly, whether the infection was mild or intense. In spite of these observations, however, such ELISA assays for serum antibodies and parasite antigens constitute an important tool for epidemiological porposes, and in establishing priorities for the control of bovine cysticercosis. PMID:23802239

Paulan, Silvana de Cássia; Gonzáles, Rutilia Marisela Hernándes; Peralta, Laura Adalid; Vicentini-Oliveira, Josy Campanhã; Biondi, Germano Francisco; Conde, Edda Sciuto; Parkhouse, Robert Michael Evans; Nunes, Cáris Maroni

323

Parasites and Foodborne Illness  

Science.gov (United States)

... Toxoplasma gondii Trichinella spiralis Taenia saginata/Taenia solium (Tapeworms) Parasites may be present in food or in ... cayetanensis , Toxoplasma gondii , Trichinella spiralis , Taenia saginata (beef tapeworm), and Taenia solium (pork tapeworm). [ Top of Page ] ...

324

Isolation of Diagnostic Glycoproteins to Taenia Solium, Immunoblot-Assay and Method for the Detection of Human Cysticercosis.  

Science.gov (United States)

The present invention is directed to a method for diagnosing active human neurocysticercosis utilizing an immunoblot assay which comprises: detecting the presence of antibodies in the serum or cerebrospinal fluid of a human to be diagnosed, wherein said a...

V. C. W. Tsang J. A. Brand A. E. Boyer M. Wilson P. M. Schantz

1988-01-01

325

Field evaluation of the efficacy and the safety of a combination of oxantel/pyrantel/praziquantel in the treatment of naturally acquired gastrointestinal nematode and/or cestode infestations in dogs in Europe.  

Science.gov (United States)

In five multicentre field trials, the efficacy and safety of a combination of oxantel/pyrantel/praziquantel (Dolpac), Vetoquinol SA) in the treatment of naturally acquired gastrointestinal nematode and/or cestode infestation in dogs was evaluated in northern and southern Europe. Forty-eight investigators from France, Belgium, Germany, Italy and Spain enrolled 329 dogs to be treated with the tested combination; 235 of these dogs complied with the inclusion criteria of the protocol and had a tested helminth identified on Day 0. A pooled analysis was performed on each of the following helminth species: Toxocara canis, Ancylostoma caninum, Toxascaris leonina, Trichuris vulpis, Uncinaria stenocephala, Taenia spp. and Dipylidium caninum, which were isolated on Day 0. The main efficacy criterion was the egg per gram (epg) percent reduction of the nematodes and the absence of proglottids and or eggs for the cestodes. After treatment, dogs were examined on Day 7, Day 14 and Day 21. The efficacy of the combination against Toxocara canis was 99.1%, 98.8% and 98.9% on Day 7, Day 14 and Day 21, respectively. At the same occasions the efficacy was, respectively, 99.2%, 99.2% and 99.3% against Ancylostoma caninum, 97.3%, 97.2% and 98.4% against Trichuris vulpis, 98.4%, 98.8% and 98.8% against Uncinaria stenocephala, 98.9%, 99.5% and 99.9% against Toxascaris leonina, 97.1%, 100% and 100% against Dipylidium caninum and 100% against Taenia spp. PMID:17184919

Grandemange, E; Claerebout, E; Genchi, C; Franc, M

2006-12-20

326

Abnormal Taenia saginata tapeworms in Thailand.  

UK PubMed Central (United Kingdom)

Sixty-eight residents of Ban Luang and Ban Pang Kae villages, in Nan Province, northern Thailand, visited our mobile field station in September 2006 and March 2007, seeking treatment for taeniasis. After treatment, 22 cases discharged tapeworm strobila in their fecal samples and 17 scolices were recovered. Among these, 3 were morphologically abnormal, with six suckers on the scolex. To confirm the species of these tapeworms, the mitochondrial cytochrome c oxidase subunit I (COI) gene was used as a molecular marker. The partial COI sequences (800 bp) of the abnormal tapeworms were identical to the sequences of Taenia saginata deposited in Genbank.

Maipanich W; Sato M; Pubampen S; Sanguankiat S; Kusolsuk T; Thaenkham U; Waikagul J

2011-09-01

327

Occurrence of infection by the cestode Grillotia in Persian Gulf fish.  

UK PubMed Central (United Kingdom)

A cystic condition of the peritoneum of tuna fish (Thunnus thynnus) caught from the Persian Gulf is described. Parasitologic examination established widespread infection by the cestode Grillotia. An account is given of the taxonomic position of this genus.

Tirgari M; Radhakrishnan CV; Howard BR

1975-05-01

328

Steroid synthesis by Taenia crassiceps WFU cysticerci is regulated by enzyme inhibitors.  

UK PubMed Central (United Kingdom)

Cysticerci and tapeworms from Taenia crassiceps WFU, ORF and Taenia solium synthesize sex-steroid hormones in vitro. Corticosteroids increase the 17?-estradiol synthesis by T. crassiceps cysticerci. T. crassiceps WFU cysticerci synthesize corticosteroids, mainly 11-deoxycorticosterone (DOC). The aim of this work was to investigate whether classical steroidogenic inhibitors modify the capacity of T. crassiceps WFU cysticerci to synthesize corticosteroids and sex steroid hormones. For this purpose, T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, pre-cultured for 24h in DMEM+antibiotics/antimycotics and cultured in the presence of tritiated progesterone ((3)H-P4), androstendione ((3)H-A4), or dehydroepiandrosterone ((3)H-DHEA) plus different doses of the corresponding inhibitors, for different periods. Blanks with the culture media adding the tritiated precursors were simultaneously incubated. At the end of the incubation period, parasites were separated and media extracted with ether. The resulting steroids were separated by thin layer chromatography (TLC). Data were expressed as percent transformation of the tritiated precursors. Results showed that after 2h of exposure of the cysticerci to 100 ?M formestane, the (3)H-17?-estradiol synthesis from tritiated androstenedione was significantly inhibited. The incubation of cysticerci in the presence of (3)H-DHEA and danazol (100 nM) resulted in (3)H-androstenediol accumulation and a significant reduction of the 17?-estradiol synthesis. The cysticerci (3)H-DOC synthesis was significantly inhibited when the parasites were cultured in the presence of different ketoconazole dosis. The drug treatments did not affect parasite's viability. The results of this study showed that corticosteroid and sex steroid synthesis in T. crassiceps WFU cysticerci can be modified by steroidogenic enzyme inhibitors. As was shown previously by our laboratory and others, parasite survival and development depends on sex steroids, therefore the inhibition of their synthesis is a good starting point exploited in situations where the inhibition of steroidogenesis could help to control the infection for the development of new treatments, or replacement of the usual therapy in resistant parasite infections. We raise the possibility that these drug actions may be beneficially.

Aceves-Ramos A; Valdez RA; Gaona B; Willms K; Romano MC

2013-07-01

329

Steroid synthesis by Taenia crassiceps WFU cysticerci is regulated by enzyme inhibitors.  

Science.gov (United States)

Cysticerci and tapeworms from Taenia crassiceps WFU, ORF and Taenia solium synthesize sex-steroid hormones in vitro. Corticosteroids increase the 17?-estradiol synthesis by T. crassiceps cysticerci. T. crassiceps WFU cysticerci synthesize corticosteroids, mainly 11-deoxycorticosterone (DOC). The aim of this work was to investigate whether classical steroidogenic inhibitors modify the capacity of T. crassiceps WFU cysticerci to synthesize corticosteroids and sex steroid hormones. For this purpose, T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, pre-cultured for 24h in DMEM+antibiotics/antimycotics and cultured in the presence of tritiated progesterone ((3)H-P4), androstendione ((3)H-A4), or dehydroepiandrosterone ((3)H-DHEA) plus different doses of the corresponding inhibitors, for different periods. Blanks with the culture media adding the tritiated precursors were simultaneously incubated. At the end of the incubation period, parasites were separated and media extracted with ether. The resulting steroids were separated by thin layer chromatography (TLC). Data were expressed as percent transformation of the tritiated precursors. Results showed that after 2h of exposure of the cysticerci to 100 ?M formestane, the (3)H-17?-estradiol synthesis from tritiated androstenedione was significantly inhibited. The incubation of cysticerci in the presence of (3)H-DHEA and danazol (100 nM) resulted in (3)H-androstenediol accumulation and a significant reduction of the 17?-estradiol synthesis. The cysticerci (3)H-DOC synthesis was significantly inhibited when the parasites were cultured in the presence of different ketoconazole dosis. The drug treatments did not affect parasite's viability. The results of this study showed that corticosteroid and sex steroid synthesis in T. crassiceps WFU cysticerci can be modified by steroidogenic enzyme inhibitors. As was shown previously by our laboratory and others, parasite survival and development depends on sex steroids, therefore the inhibition of their synthesis is a good starting point exploited in situations where the inhibition of steroidogenesis could help to control the infection for the development of new treatments, or replacement of the usual therapy in resistant parasite infections. We raise the possibility that these drug actions may be beneficially. PMID:23608546

Aceves-Ramos, A; Valdez, R A; Gaona, B; Willms, K; Romano, M C

2013-04-20

330

Frequency of serum anti-cysticercus antibodies in the population of a rural Brazilian community (Cássia dos Coqueiros, SP) determined by ELISA and immunoblotting using Taenia crassiceps antigens/ Frequência de anticorpos séricos anti-cisticerco na população de uma comunidade rural brasileira (Cássia dos Coqueiros, SP) determinada por ELISA e imunoblot usando antígenos de Taenia crassiceps  

Scientific Electronic Library Online (English)

Full Text Available Abstract in portuguese Considerando o impacto na saúde pública gerado pela ocorrência da cisticercose, especialmente a forma neurológica, neurocisticercose (NC), foi estudada a freqüência de positividade de anticorpos anti-cisticerco em amostras de soro de 1.863 habitantes do município de Cássia dos Coqueiros, SP, situado a 80 Km de Ribeirão Preto, região considerada endêmica para a cisticercose. As amostras foram avaliadas pelo teste ELISA usando extrato antigênico de líquido vesi (more) cular de Taenia crassiceps (Tcra) e as amostras reagentes e inconclusivas foram analisadas pelo imunoblot. Das 459 amostras submetidas ao imunoblot, 40 foram fortemente imunorreativas para os peptídeos imuno dominantes de 18 e 14kD. Considerando o uso do teste imunoblot como confirmatório, dada sua elevada especificidade, a soroprevalência de anticorpos anti-cisticerco foi de 2,1% na população estudada. Abstract in english Considering the impact of cysticercosis on public health, especially the neurologic form of the disease, neurocysticercosis (NC), we studied the frequency of positivity of anti-Taenia solium cysticercus antibodies in serum samples from 1,863 inhabitants of Cássia dos Coqueiros, SP, a municipal district located 80 km from Ribeirão Preto, an area considered endemic for cysticercosis. The 1,863 samples were tested by enzyme linked immunosorbent assay (ELISA) using an antig (more) enic extract from Taenia crassiceps vesicular fluid (Tcra). The reactive and inconclusive ELISA samples were tested by immunoblotting. Of the 459 samples submitted to immunoblotting, 40 were strongly immunoreactive to the immunodominant 18 and 14 kD peptides. Considering the use of immunoblotting as confirmatory due to its high specificity, the anti-cysticercus serum prevalence in this population was 2.1%.

BRAGAZZA, Lúcia M.; VAZ, Adelaide J.; PASSOS, Afonso D.C.; TAKAYANAGUI, Osvaldo M.; NAKAMURA, Paulo M.; ESPÍNDOLA, Noeli M.; PARDINI, Alessandra; BUENO, Ednéia C.

2002-02-01

331

Digeneans and cestodes parasitic in the white-faced ibis Plegadis chihi (Aves: Threskiornithidae) from Argentina.  

UK PubMed Central (United Kingdom)

Some digeneans and cestodes parasitic in a population of the white-faced ibis Plegadis chihi (Vieillot) from Buenos Aires province, Argentina, are presented. The digeneans Dietziella egregia (Dietz, 1909), Patagifer bilobus (Rudolphi, 1819), Ascocotyle (Leighia) hadra Ostrowski de Nuñez, 1992 and Posthodiplostomum nanum Dubois, 1937 from the intestine; Prosthogonimus ovatus (Rudolphi, 1803) from the cloaca; Athesmia heterolecithodes (Braun, 1899) from the bile ducts and the cestode Hymenolepis megalops (Nitzsch in Creplin, 1829) from the cloaca, were recorded. The discovery of D. egregia, P. ovatus, A. heterolecithodes and P. nanum constitute new host and/or new geographical records. Adults of A. (L.) hadra, previously described in experimental definitive hosts, are first reported from a naturally infected bird. Hymenolepis megalops, a cestode of Anseriformes is first reported from Ciconiiformes.

Digiani MC

2000-01-01

332

Digeneans and cestodes parasitic in the white-faced ibis Plegadis chihi (Aves: Threskiornithidae) from Argentina.  

Science.gov (United States)

Some digeneans and cestodes parasitic in a population of the white-faced ibis Plegadis chihi (Vieillot) from Buenos Aires province, Argentina, are presented. The digeneans Dietziella egregia (Dietz, 1909), Patagifer bilobus (Rudolphi, 1819), Ascocotyle (Leighia) hadra Ostrowski de Nuñez, 1992 and Posthodiplostomum nanum Dubois, 1937 from the intestine; Prosthogonimus ovatus (Rudolphi, 1803) from the cloaca; Athesmia heterolecithodes (Braun, 1899) from the bile ducts and the cestode Hymenolepis megalops (Nitzsch in Creplin, 1829) from the cloaca, were recorded. The discovery of D. egregia, P. ovatus, A. heterolecithodes and P. nanum constitute new host and/or new geographical records. Adults of A. (L.) hadra, previously described in experimental definitive hosts, are first reported from a naturally infected bird. Hymenolepis megalops, a cestode of Anseriformes is first reported from Ciconiiformes. PMID:11104147

Digiani, M C

2000-01-01

333

Cestode infection in 2 dogs: cytologic findings in liver and a mesenteric lymph node.  

UK PubMed Central (United Kingdom)

Mesocestoides cestode infections in dogs are well known for causing severe peritonitis with larvae or larval fragments (metacestodes, tetrathyridia, or calcareous corpuscles) frequently observed cytologically in peritoneal fluid samples. This case report describes the cytologic and clinical features of 2 dogs infected with cestode larvae, with one case confirmed and the other presumed to be Mesocestoides sp. In these 2 unusual cases, cestode larvae or larval fragments were found in fine-needle aspirates of the liver and a mesenteric lymph node, but no organisms were found in peritoneal fluid samples. The data presented in this report indicate that clinical pathologists should not rule out Mesocestoides sp cestodiasis based on the absence of larvae in peritoneal fluid samples from dogs.

Patten PK; Rich LJ; Zaks K; Blauvelt M

2013-03-01

334

BIOCHEMICAL STUDIES OF GASTROINTESTINAL CESTODE PARASITES IN OVIS BHARAL (L.) FROM VIDHARBHA REGION  

Directory of Open Access Journals (Sweden)

Full Text Available Most of the parasites reside in association of animals, birds, and fishes of economic importance. Parasitic biochemistry has great practical importance through chemotherapy and vaccine production and in understanding of the complex association involved in the host parasite relationship However; information in parasite biochemistry is patchy. It is a field growing in parallel with the new surge of interest in tropical diseases. Whereas previously parasitologists have been required to adopt biochemical methodology in order to stay abreast of development. Gastrointestinal cestodes are the most pathogenic parasites in Ovis bharal in tropic and subtropic areas. Present investigation deals with the biochemistry (Protein, glycogen and lipid) of Cestode parasites in Ovis bharal.

M. B. Sonune

2012-01-01

335

Concomitant Infection of Appendix with Taenia and Enterobius vermicularis  

Directory of Open Access Journals (Sweden)

Full Text Available Appendicitis is one of the most common causes of acute surgical disease in children and young adult. There are many reports in the world, concerning the infectivity of appendix with different parasites. However, concomitant infection of appendix with Taenia and Enterobius vermicularis is a rare case. A twelve years old boy, living in Islam-shahr, Iran, admitted to a hospital, presenting symptoms suggestive of appendicitis. Following surgically resection of the appendix, histopathological examination was performed on H&E stained sections. In the lumen of the appendix, section of E. vermicularis adult female and eggs of Taenia were visible.

A.R. Meamar; N. Ahady; M.H. Falakimoghaddam; M.R. Safari; E.B. Kia

2006-01-01

336

In vitro effects of albendazole on Raillietina echinobothrida, the cestode of chicken, Gallus domesticus  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Albendazole, a member of benzimidazole group of compounds, has been shown to have a broad spectrum activity against all classes of helminth parasites. Although it has also been experimentally proven to be effective against cestode infection of poultry, the actual effects of the drug are not yet desc...

Lalchhandama K

337

In vitro Effects of Albendazole on Raillietina echinobothrida, the Cestode of Chicken, Gallus domesticus  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Albendazole, a member of benzimidazole group of compounds, has been shown to have a broad spectrum activity against all classes of helminth parasites. Although it has also been experimentally proven to be effective against cestode infection of poultry, the actual effects of the drug are not yet desc...

Lalchhandama, K

338

A survey of ectoparasites, cestodes and management of free-range indigenous chickens in rural Zimbabwe.  

UK PubMed Central (United Kingdom)

A survey of ectoparasites, cestodes and husbandry aspects of indigenous free-range chickens was carried out in selected districts from the highveld and lowveld of rural Zimbabwe. The survey recorded infection with 4 species from the order Phthiraptera (lice), 1 species from the order Siphonaptera (fleas), 6 species from the order Acarina (ticks and mites) and 9 species of cestodes. Among the ectoparasites, the most prevalent was Menacanthus stramineus (87.7%) followed by Echidinophaga gallinacea (71.9%). Chickens in the Mazowe district had the highest number of ectoparasites species (10 of 11) followed by Goromonzi district (9 of 11) both these districts are situated in the highveld of Zimbabwe. The most prevalent cestode species was Raillietina tetragona (84.4%), followed by Raillietina echinobothrida (32.2%). Chickens in the Goromonzi district had the highest number of cestode species (7 of 9), followed by Mazowe district (one subgenus and 5 of 9). In all the districts sampled the main purpose of keeping free-range chickens was for meat for the household, with few households using the birds as a source of income. The majority of households kept their birds extensively with barely any appropriate housing, and supplementary feeding was only occasionally practised.

Mukaratirwa S; Hove T

2009-09-01

339

A survey of ectoparasites, cestodes and management of free-range indigenous chickens in rural Zimbabwe.  

Science.gov (United States)

A survey of ectoparasites, cestodes and husbandry aspects of indigenous free-range chickens was carried out in selected districts from the highveld and lowveld of rural Zimbabwe. The survey recorded infection with 4 species from the order Phthiraptera (lice), 1 species from the order Siphonaptera (fleas), 6 species from the order Acarina (ticks and mites) and 9 species of cestodes. Among the ectoparasites, the most prevalent was Menacanthus stramineus (87.7%) followed by Echidinophaga gallinacea (71.9%). Chickens in the Mazowe district had the highest number of ectoparasites species (10 of 11) followed by Goromonzi district (9 of 11) both these districts are situated in the highveld of Zimbabwe. The most prevalent cestode species was Raillietina tetragona (84.4%), followed by Raillietina echinobothrida (32.2%). Chickens in the Goromonzi district had the highest number of cestode species (7 of 9), followed by Mazowe district (one subgenus and 5 of 9). In all the districts sampled the main purpose of keeping free-range chickens was for meat for the household, with few households using the birds as a source of income. The majority of households kept their birds extensively with barely any appropriate housing, and supplementary feeding was only occasionally practised. PMID:20169754

Mukaratirwa, S; Hove, T

2009-09-01

340

Review of tapeworms of rodents in the Republic of Buryatia, with emphasis on anoplocephalid cestodes  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Examination of ca. 500 rodents [Microtus spp., Myodes spp., Cricetulus barabensis (Pallas), Apodemus peninsulae Thomas] from 14 localities in the Republic of Buryatia (Russian Federation) revealed a minimum of 11 cestode species representing Anoplocephaloides Baer, 1923 s. str. (1 species), Paranopl...

Voitto Haukisalmi; Heikki Henttonen; Lotta Hardman; Michael Hardman; Juha Laakkonen; Galina Murueva; Jukka Niemimaa

 
 
 
 
341

Cestodes change the isotopic signature of brine shrimp, Artemia, hosts: implications for aquatic food webs.  

Science.gov (United States)

To reach the final host (greater flamingos), the cestode Flamingolepis liguloides alters the behaviour of its intermediate host, the brine shrimp, Artemia parthenogenetica, causing it to spend more time close to the water surface. During summer 2010, we showed that the prevalence of this cestode was consistently higher at the top of the water column in the Odiel salt pans in south-western Spain. We used stable nitrogen (N) and carbon (C) isotopic analysis to test the hypothesis that cestodes also alter resource use by Artemia. In early summer, we compared stable isotopes in infected hosts at the surface with those from uninfected hosts at the bottom of the water column. In late summer, we compared infected and uninfected Artemia from the bottom. ?(15)N was consistently enriched in infected individuals compared with uninfected hosts, especially in Artemia with multiple infections of F. liguloides (family Hymenolepididae) and those with mixed infections of F. liguloides and cestodes of the family Dilepididae. Infected individuals from the surface were enriched in ?(13)C compared with uninfected ones from the bottom, but the opposite was found when comparing uninfected and infected Artemia from the same depth. This may be caused by the increase in lipid concentration in infected Artemia. Isolated cysticercoids of F. liguloides were significantly enriched in ?(13)C compared with cysticercoids in infected hosts, but surprisingly were not enriched in N. Our findings illustrate the way cestodes can alter food webs and highlight the importance of considering the parasitic status of prey in studies of trophic ecology in saline wetlands. PMID:23220358

Sánchez, Marta I; Varo, Nico; Matesanz, Cristina; Ramo, Cristina; Amat, Juan A; Green, Andy J

2012-12-03

342

Cestodes change the isotopic signature of brine shrimp, Artemia, hosts: implications for aquatic food webs.  

UK PubMed Central (United Kingdom)

To reach the final host (greater flamingos), the cestode Flamingolepis liguloides alters the behaviour of its intermediate host, the brine shrimp, Artemia parthenogenetica, causing it to spend more time close to the water surface. During summer 2010, we showed that the prevalence of this cestode was consistently higher at the top of the water column in the Odiel salt pans in south-western Spain. We used stable nitrogen (N) and carbon (C) isotopic analysis to test the hypothesis that cestodes also alter resource use by Artemia. In early summer, we compared stable isotopes in infected hosts at the surface with those from uninfected hosts at the bottom of the water column. In late summer, we compared infected and uninfected Artemia from the bottom. ?(15)N was consistently enriched in infected individuals compared with uninfected hosts, especially in Artemia with multiple infections of F. liguloides (family Hymenolepididae) and those with mixed infections of F. liguloides and cestodes of the family Dilepididae. Infected individuals from the surface were enriched in ?(13)C compared with uninfected ones from the bottom, but the opposite was found when comparing uninfected and infected Artemia from the same depth. This may be caused by the increase in lipid concentration in infected Artemia. Isolated cysticercoids of F. liguloides were significantly enriched in ?(13)C compared with cysticercoids in infected hosts, but surprisingly were not enriched in N. Our findings illustrate the way cestodes can alter food webs and highlight the importance of considering the parasitic status of prey in studies of trophic ecology in saline wetlands.

Sánchez MI; Varo N; Matesanz C; Ramo C; Amat JA; Green AJ

2013-01-01

343

Field efficacy of praziquantel oral paste against naturally acquired equine cestodes in Ethiopia.  

Science.gov (United States)

The efficacy of an oral formulation of praziquantel (Equitape, Horse paste, Fort Dodge) in the reduction of cestode egg counts and serum antibody level against Anoplocephala perfoliata was assessed in 44 donkeys under field conditions. The donkeys were confirmed both by faecal examination and serum antibody assessed by an enzyme-linked immunosorbent assay to have natural infection with tapeworms. The donkeys were randomly allocated into treatment (n?=?22) and control (n?=?22) groups. The treatment group was treated with both praziquantel and ivermectin (Ivomec, Merial) at a dose rate of 1 mg/kg and 200 ?g/kg, respectively while the control group was treated only with ivermectin. Faecal samples were collected before treatment (day-0) and 2, 6, 8, 12, and 16 weeks post-treatment while blood samples were collected before treatment and 8 and 16 weeks after treatment and analysed. The results of the study demonstrated that praziquantel paste was highly effective in reducing cestode eggs in donkeys and had an efficacy of more than 99 % until week 16 (day?112). No cestode egg reappearance by 16 weeks post-treatment in any animal in the treatment group was observed while donkeys in the control group continued shedding cestode eggs. The immunological assay also showed a significant reduction in serum antibody level against A. perfoliata in treated donkeys compared to the control group (p?=?0.0001). This marked decrease in serum antibody level indicates reduced risk of cestode-associated colic and other gastrointestinal disorders and clinical diseases. No adverse reactions or clinical effects were encountered in any animal within either group throughout the trial period. PMID:23001508

Getachew, A M; Innocent, G; Proudman, C J; Trawford, A; Feseha, G; Reid, S W J; Faith, B; Love, S

2012-09-22

344

Field efficacy of praziquantel oral paste against naturally acquired equine cestodes in Ethiopia.  

UK PubMed Central (United Kingdom)

The efficacy of an oral formulation of praziquantel (Equitape, Horse paste, Fort Dodge) in the reduction of cestode egg counts and serum antibody level against Anoplocephala perfoliata was assessed in 44 donkeys under field conditions. The donkeys were confirmed both by faecal examination and serum antibody assessed by an enzyme-linked immunosorbent assay to have natural infection with tapeworms. The donkeys were randomly allocated into treatment (n?=?22) and control (n?=?22) groups. The treatment group was treated with both praziquantel and ivermectin (Ivomec, Merial) at a dose rate of 1 mg/kg and 200 ?g/kg, respectively while the control group was treated only with ivermectin. Faecal samples were collected before treatment (day-0) and 2, 6, 8, 12, and 16 weeks post-treatment while blood samples were collected before treatment and 8 and 16 weeks after treatment and analysed. The results of the study demonstrated that praziquantel paste was highly effective in reducing cestode eggs in donkeys and had an efficacy of more than 99 % until week 16 (day?112). No cestode egg reappearance by 16 weeks post-treatment in any animal in the treatment group was observed while donkeys in the control group continued shedding cestode eggs. The immunological assay also showed a significant reduction in serum antibody level against A. perfoliata in treated donkeys compared to the control group (p?=?0.0001). This marked decrease in serum antibody level indicates reduced risk of cestode-associated colic and other gastrointestinal disorders and clinical diseases. No adverse reactions or clinical effects were encountered in any animal within either group throughout the trial period.

Getachew AM; Innocent G; Proudman CJ; Trawford A; Feseha G; Reid SW; Faith B; Love S

2013-01-01

345

[Effect of the fungus Paecilomyces lilacinus on Taenia saginata eggs].  

UK PubMed Central (United Kingdom)

With the aim of demonstrating the effectiveness of the fungus Paecilomyces lilacinus on Taenia saginata eggs under laboratory conditions, a trial was set up in Petri dishes with water-agar 2%. There was ovicidal activity (p < 0.05) in relation to the control group on the tenth day of interaction and an internal colonization rate of 25.5% in the eggs.

Braga FR; Araújo JV; Araujo JM; Carvalho RO; Silva AR

2008-11-01

346

Out of Africa: origins of the Taenia tapeworms in humans.  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Phylogenetic and divergence date analyses indicate that the occurrence of Taenia tapeworms in humans pre-dates the development of agriculture, animal husbandry and domestication of cattle (Bos spp.) or swine (Sus scrofa). Taeniid tapeworms in Africa twice independently colonized hominids and the gen...

Hoberg, E P; Alkire, N L; de Queiroz, A; Jones, A

347

High prevalence of cestodes in Artemia spp. throughout the annual cycle: relationship with abundance of avian final hosts.  

UK PubMed Central (United Kingdom)

Brine shrimp, Artemia spp., act as intermediate hosts for a range of cestode species that use waterbirds as their final hosts. These parasites can have marked influences on shrimp behavior and fecundity, generating the potential for cascading effects in hypersaline food webs. We present the first comprehensive study of the temporal dynamics of cestode parasites in natural populations of brine shrimp throughout the annual cycle. Over a 12-month period, clonal Artemia parthenogenetica were sampled in the Odiel marshes in Huelva, and the sexual Artemia salina was sampled in the Salinas de Cerrillos in Almería. Throughout the year, 4-45 % of A. parthenogenetica were infected with cestodes (mean species richness?=?0.26), compared to 27-72 % of A. salina (mean species richness?=?0.64). Ten cestode species were recorded. Male and female A. salina showed similar levels of parasitism. The most prevalent and abundant cestodes were those infecting the most abundant final hosts, especially the Greater Flamingo Phoenicopterus ruber. In particular, the flamingo parasite Flamingolepis liguloides had a prevalence of up to 43 % in A. parthenogenetica and 63.5 % in A. salina in a given month. Although there was strong seasonal variation in prevalence, abundance, and intensity of cestode infections, seasonal changes in bird counts were weak predictors of the dynamics of cestode infections. However, infection levels of Confluaria podicipina in A. parthenogenetica were positively correlated with the number of their black-necked grebe Podiceps nigricollis hosts. Similarly, infection levels of Anomotaenia tringae and Anomotaenia microphallos in A. salina were correlated with the number of shorebird hosts present the month before. Correlated seasonal transmission structured the cestode community, leading to more multiple infections than expected by chance.

Sánchez MI; Nikolov PN; Georgieva DD; Georgiev BB; Vasileva GP; Pankov P; Paracuellos M; Lafferty KD; Green AJ

2013-05-01

348

High prevalence of cestodes in Artemia spp. throughout the annual cycle: relationship with abundance of avian final hosts.  

Science.gov (United States)

Brine shrimp, Artemia spp., act as intermediate hosts for a range of cestode species that use waterbirds as their final hosts. These parasites can have marked influences on shrimp behavior and fecundity, generating the potential for cascading effects in hypersaline food webs. We present the first comprehensive study of the temporal dynamics of cestode parasites in natural populations of brine shrimp throughout the annual cycle. Over a 12-month period, clonal Artemia parthenogenetica were sampled in the Odiel marshes in Huelva, and the sexual Artemia salina was sampled in the Salinas de Cerrillos in Almería. Throughout the year, 4-45 % of A. parthenogenetica were infected with cestodes (mean species richness?=?0.26), compared to 27-72 % of A. salina (mean species richness?=?0.64). Ten cestode species were recorded. Male and female A. salina showed similar levels of parasitism. The most prevalent and abundant cestodes were those infecting the most abundant final hosts, especially the Greater Flamingo Phoenicopterus ruber. In particular, the flamingo parasite Flamingolepis liguloides had a prevalence of up to 43 % in A. parthenogenetica and 63.5 % in A. salina in a given month. Although there was strong seasonal variation in prevalence, abundance, and intensity of cestode infections, seasonal changes in bird counts were weak predictors of the dynamics of cestode infections. However, infection levels of Confluaria podicipina in A. parthenogenetica were positively correlated with the number of their black-necked grebe Podiceps nigricollis hosts. Similarly, infection levels of Anomotaenia tringae and Anomotaenia microphallos in A. salina were correlated with the number of shorebird hosts present the month before. Correlated seasonal transmission structured the cestode community, leading to more multiple infections than expected by chance. PMID:23463137

Sánchez, Marta I; Nikolov, Pavel N; Georgieva, Darina D; Georgiev, Boyko B; Vasileva, Gergana P; Pankov, Plamen; Paracuellos, Mariano; Lafferty, Kevin D; Green, Andy J

2013-03-06

349

[A proposal concerning renovation of Chinese terms for cestodes with special references to metacestodes and spargana].  

UK PubMed Central (United Kingdom)

Some of the Chinese names involved in the cestode life cycle were not in coincidence with that of the Latin terms and their definitions, and may be imprecise in application. The term of metacestode has been misled into defining that is the larval stage in intermediate hosts or the infective stage to definite hosts; there was no specific Chinese term for sparganum which used to express it with same meaning and word as plerocercoid; the terms of oncosphere, procercoid and plerocercoid including cercomer were incorrectly translated; same meaning of hydatid and hydatid cyst were vaguely read in Chinese literature and protoscolex is concerning to a larva in the relevant literature. A renovated unified system of naming the various stages and phases of cestode development including adult in Chinese was proposed.

Wen TH

2010-08-01

350

[A proposal concerning renovation of Chinese terms for cestodes with special references to metacestodes and spargana].  

Science.gov (United States)

Some of the Chinese names involved in the cestode life cycle were not in coincidence with that of the Latin terms and their definitions, and may be imprecise in application. The term of metacestode has been misled into defining that is the larval stage in intermediate hosts or the infective stage to definite hosts; there was no specific Chinese term for sparganum which used to express it with same meaning and word as plerocercoid; the terms of oncosphere, procercoid and plerocercoid including cercomer were incorrectly translated; same meaning of hydatid and hydatid cyst were vaguely read in Chinese literature and protoscolex is concerning to a larva in the relevant literature. A renovated unified system of naming the various stages and phases of cestode development including adult in Chinese was proposed. PMID:21137317

Wen, Ting-huan

2010-08-01

351

[Lipids of Raillietina tetragona and Raillietina echinobothrida cestodes from the intestines of hens  

UK PubMed Central (United Kingdom)

Lipids of the cestodes R. tetragona and R. echinobothrida, parasites of chickens, were studied by thin-layer and gas-liquid chromatography methods. The quantity of neutral lipids amounts to 74.4% in R. tetragona and to 73.1% in R. echinobothrida. Triglycerides amount to 35.6% and 38.4% of the neutral lipids in these species, sterols to 21.6% and 17.2%, sterol esters to 25.1% and 32.0%, diglycerides to 2.8% and 1.4% and free fatty acids to 7.8% and 6.5%, respectively. Fatty acids content of worms is similar but not identical of that of chicken intestine lipids. Cestode infection affects the lipid content of chicken intestine resulting in the decrease of triglycerides and oleic acid quantities and in the increase of the amount of free fatty acids and stearic acid.

Vykhrestiuk NP; Iarygina GV; Il'iasov IN

1981-11-01

352

The ant, Pachycondyla sennaarensis (Mayr) as an intermediate host for the poultry cestode, Raillietina tetragona (Molin).  

UK PubMed Central (United Kingdom)

The role of several species of ants as intermediate hosts for poultry cestodes in the Sudan was investigated by a search for cysticercoids in specimens from poultry houses in various localities in the country. Pachycondyla sennaarensis, Messor galla and Acantholepis sp. were the only species collected from the areas surveyed. All these ants were examined for cysticercoids of poultry tapeworms but only P. sennaarensis was found to carry cysticercoids, all of which were identical to those of the poultry cestode, Raillietina tetragona. This tapeworm was recovered from all chicks fed the cysticercoids obtained from P. sennaarensis. R. tetragona cysticercoids were present in 63.3% of the P. sennaarensis sampled with 1-40 cysticercoids per ant, which is the heaviest recorded infestation of an ant species with these cysticeroids.

Mohammed OB; Hussein HS; Elowni EE

1988-01-01

353

[Lipids of Raillietina tetragona and Raillietina echinobothrida cestodes from the intestines of hens].  

Science.gov (United States)

Lipids of the cestodes R. tetragona and R. echinobothrida, parasites of chickens, were studied by thin-layer and gas-liquid chromatography methods. The quantity of neutral lipids amounts to 74.4% in R. tetragona and to 73.1% in R. echinobothrida. Triglycerides amount to 35.6% and 38.4% of the neutral lipids in these species, sterols to 21.6% and 17.2%, sterol esters to 25.1% and 32.0%, diglycerides to 2.8% and 1.4% and free fatty acids to 7.8% and 6.5%, respectively. Fatty acids content of worms is similar but not identical of that of chicken intestine lipids. Cestode infection affects the lipid content of chicken intestine resulting in the decrease of triglycerides and oleic acid quantities and in the increase of the amount of free fatty acids and stearic acid. PMID:7198767

Vykhrestiuk, N P; Iarygina, G V; Il'iasov, I N

354

The ant, Pachycondyla sennaarensis (Mayr) as an intermediate host for the poultry cestode, Raillietina tetragona (Molin).  

Science.gov (United States)

The role of several species of ants as intermediate hosts for poultry cestodes in the Sudan was investigated by a search for cysticercoids in specimens from poultry houses in various localities in the country. Pachycondyla sennaarensis, Messor galla and Acantholepis sp. were the only species collected from the areas surveyed. All these ants were examined for cysticercoids of poultry tapeworms but only P. sennaarensis was found to carry cysticercoids, all of which were identical to those of the poultry cestode, Raillietina tetragona. This tapeworm was recovered from all chicks fed the cysticercoids obtained from P. sennaarensis. R. tetragona cysticercoids were present in 63.3% of the P. sennaarensis sampled with 1-40 cysticercoids per ant, which is the heaviest recorded infestation of an ant species with these cysticeroids. PMID:3195046

Mohammed, O B; Hussein, H S; Elowni, E E

1988-01-01

355

Effect of heat treatment on viability of Taenia hydatigena eggs.  

UK PubMed Central (United Kingdom)

Effects of heat treatments on activation and infectivity of Taenia hydatigena eggs were assessed. Eggs containing oncospheres were used for in vitro and in vivo studies to determine the response to 5min of heat treatment, ranging from room temperature (22°C) to 60°C. The study demonstrated 99.47% and 100% reduction in oncosphere activation or infectivity after 5min of heat treatment at 60°C and 57.38°C under in vitro and in vivo conditions, respectively. Similar results between the two approaches indicted the appropriateness of the in vitro methods to identify oncosphericidal treatments of practical significance. Similar heat treatments may also be effective against Taenia saginata and help to reduce occurrence of beef cysticercosis.

Buttar BS; Nelson ML; Busboom JR; Hancock DD; Walsh DB; Jasmer DP

2013-04-01

356

Study on Human Taeniasis by Administring Anti-Taenia Drug  

Directory of Open Access Journals (Sweden)

Full Text Available Mazandaran province, northern Iran, has been an area with highest prevalence of infectivity with human taeniasis during past decades. In order to assess current situation of taeniasis in the province by a method which can yield a correct estimation of infection rate, this study was performed by administrating anti-Taenia drug, during 2003-2004. A total of 417 people were randomly selected from rural areas of Mazandaran province. All of them were at first given a dose of niclosamide (2-4 500 mg tablets) and bisacodile (1-3 5 mg tablets); then their 36 h stool passage was collected and examined macroscopically and microscopically. The results revealed that 2 individuals (0.5%) were infected with Taenia saginata. Compared with previous decades, there is a sharp drop on human taeniasis in the study area. Infected peoples were followed up till complete treatment.

EB Kia; J Masoud; A Yalda; M Mahmoudi; H Farahani

2005-01-01

357

Taenia taeniaeformis in rat favors protracted skin lesions caused by Sporothrix schenckii infection: Dectin-1 and IL-17 are dispensable for clearance of this fungus.  

UK PubMed Central (United Kingdom)

We occasionally found that cestode Taenia taeniaeformis in rats favored Sporothrix schenckii infection and survival, causing protracted cutaneous lesions. In this study, we compared the pathology and cytokines profile of rats co-infected with the two pathogens and infected with S. schenckii alone to explore underlying mechanisms. In the co-infection group, there was high expression of ?-glucan receptor Dectin-1 in the cutaneous lesions and no multinucleated giant cells, but in the S. schenckii infection group the opposite was observed. Cytokines profiles demonstrated an expected finding that IL-4, commonly expressed in helminth and fungus infection, is undetectable in the two infection groups. In the single fungal infection group, cytokines IFN-?, IL-10 and IL-17 kept increasing in the first few weeks of infection to a peak which was followed by gradual decrease. This study showed that Dectin-1 and IL-17, which were believed to be the major anti-fungus mechanisms, are Th2 independent and dispensable for clearance of S. schenckii infection, suggesting that S. schenckii has a different molecular recognition pattern and evokes anti-infection mechanisms other than Dectin-1 and IL-17.

Zhang X; Zhang J; Huang H; Xue R; Hu X; Li M; Zhong Y; Yuan L

2012-01-01

358

Taenia taeniaeformis in rat favors protracted skin lesions caused by Sporothrix schenckii infection: Dectin-1 and IL-17 are dispensable for clearance of this fungus.  

Science.gov (United States)

We occasionally found that cestode Taenia taeniaeformis in rats favored Sporothrix schenckii infection and survival, causing protracted cutaneous lesions. In this study, we compared the pathology and cytokines profile of rats co-infected with the two pathogens and infected with S. schenckii alone to explore underlying mechanisms. In the co-infection group, there was high expression of ?-glucan receptor Dectin-1 in the cutaneous lesions and no multinucleated giant cells, but in the S. schenckii infection group the opposite was observed. Cytokines profiles demonstrated an expected finding that IL-4, commonly expressed in helminth and fungus infection, is undetectable in the two infection groups. In the single fungal infection group, cytokines IFN-?, IL-10 and IL-17 kept increasing in the first few weeks of infection to a peak which was followed by gradual decrease. This study showed that Dectin-1 and IL-17, which were believed to be the major anti-fungus mechanisms, are Th2 independent and dispensable for clearance of S. schenckii infection, suggesting that S. schenckii has a different molecular recognition pattern and evokes anti-infection mechanisms other than Dectin-1 and IL-17. PMID:23285072

Zhang, Xiaohui; Zhang, Jing; Huang, Huaiqiu; Xue, Ruzeng; Hu, Xuchu; Li, Meirong; Zhong, Yi; Yuan, Liyan

2012-12-20

359

[Epidemiology and control of cysticercosis in Peru].  

UK PubMed Central (United Kingdom)

Neurocysticercosis, the infection of the human central nervous system by the larval stage of the cestode Taenia solium, is an important cause of epilepsy and other neurological manifestations in Peru and most developing countries. Since 1987, the Cysticercosis Working Group in Peru has performed a series of epidemiological studies which led to estimate the impact and to better understand the transmission of Taenia solium. This information was later applied to the design and execution of a control program in Tumbes, in the Northern Coast of Peru. This paper reviews the main epidemiological findings, as well as the conceptual framework of the elimination program and the tools used. Advances in the control of taeniasis/cysticercosis in our country open the road towards its elimination and potential eradication.

Garcia HH; Gonzalez AE; Rodriguez S; Gonzalvez G; Llanos-Zavalaga F; Tsang VC; Gilman RH

2010-10-01

360

Encysted Tenia solium larva of oral cavity: Case report with review of literature  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Cysticercosis is caused by the larvae of the pig tapeworm, Tenia solium. Oral cysticercosis is a rare event and is often a diagnostic challenge to the clinician. We report a 12-year-old girl who presented with a single, painless, nodule on the lower lip that was diagnosed as cysticercosis. Current l...

Krishnamoorthy, Bhuvana; Suma, Gundareddy N; Dhillon, Manu; Srivastava, Siddharth; Sharma, Manisha Lakhanpal

 
 
 
 
361

Sympatric Distribution of Three Human Taenia Tapeworms Collected between 1935 and 2005 in Korea  

Digital Repository Infrastructure Vision for European Research (DRIVER)

Taeniasis has been known as one of the prevalent parasitic infections in Korea. Until recently, Taenia saginata had long been considered a dominant, and widely distributed species but epidemiological profiles of human Taenia species in Korea still remain unclear. In order to better understand distri...

Jeon, Hyeong-Kyu; Kim, Kyu-Heon; Chai, Jong-Yil; Yang, Hyun-Jong; Rim, Han-Jong; Eom, Keeseon S

362

Molecular Identification of Taenia Tapeworms by Cox1 Gene in Koh Kong, Cambodia  

Digital Repository Infrastructure Vision for European Research (DRIVER)

We collected fecal samples from 21 individuals infected with Taenia tapeworms in Koh Kong Province, Cambodia, and performed nucleotide sequencing of the cox1 gene and multiplex PCR on the eggs for DNA differential diagnosis of human Taenia tapeworms. Genomic DNA was extracted from the eggs of a mini...

Jeon, Hyeong-Kyu; Yong, Tai-Soon; Sohn, Woon-Mok; Chai, Jong-Yil; Hong, Sung-Jong; Han, Eun-Taek; Jeong, Hoo-Gn; Chhakda, Tep

363

Cestodes from Hector's beaked whale ( Mesoplodon hectori ) and spectacled porpoise ( Phocoena dioptrica ) from Argentinean waters.  

UK PubMed Central (United Kingdom)

Single individuals of 2 little-known cetacean species, Mesoplodon hectori and Phocoena dioptrica , stranded and died on the coast of Argentina (Buenos Aires and Chubut provinces, respectively) and were studied for the presence of helminths. The cestodes found were described and illustrated using light microscopy. The following cestode taxa were recovered: Tetrabothrius ( Tetrabothrius ) hobergi n. sp. (several fragmented specimens, at least 1 gravid) and Tetrabothrius ( s.l. ) sp. 1 (several fragmented immature specimens) from M. hectori , and Tetrabothrius ( s.l. ) sp. 2 (single fragmented immature specimen) and 2 morphotypes of tetraphyllidean larvae from P. dioptrica. Tetrabothrius ( T. ) hobergi n. sp. can be distinguished from Tetrabothrius ( T. ) forsteri by the greater number of testes and larger eggs and oncospheres, from Tetrabothrius ( T. ) curilensis by the smaller testes and vitellarium, the shape and size of the ovary, and the larger oncospheres and longer embryonic hooks, and from Tetrabothrius ( T. ) sp. from Ziphius cavirostris by the narrower strobila, smaller scolex, and smaller number of testes. The generic designations of Tetrabothrius ( s.l. ) sp. 1 and Tetrabothrius ( s.l. ) sp. 2 were based on the scolex morphology. Tetrabothrius ( s.l. ) sp. 1 is closest to Tetrabothrius ( T. ) forsteri and Tetrabothrius ( Biamniculus ) innominatus based on the number of testes, while the scolex size of Tetrabothrius ( Tetrabothrius ) sp. 2 is within the variability range reported for Tetrabothrius ( T. ) forsteri . More definite identification of the 2 species was not possible due to the condition of the available material. The present study provides the first descriptions of cestodes from M. hectori and P. dioptrica , thus enriching the knowledge regarding the helminths of insufficiently studied marine mammals.

Nikolov PN; Cappozzo HL; Berón-Vera B; Crespo EA; Raga JA; Fernández M

2010-08-01

364

Cestodes from Hector's beaked whale ( Mesoplodon hectori ) and spectacled porpoise ( Phocoena dioptrica ) from Argentinean waters.  

Science.gov (United States)

Single individuals of 2 little-known cetacean species, Mesoplodon hectori and Phocoena dioptrica , stranded and died on the coast of Argentina (Buenos Aires and Chubut provinces, respectively) and were studied for the presence of helminths. The cestodes found were described and illustrated using light microscopy. The following cestode taxa were recovered: Tetrabothrius ( Tetrabothrius ) hobergi n. sp. (several fragmented specimens, at least 1 gravid) and Tetrabothrius ( s.l. ) sp. 1 (several fragmented immature specimens) from M. hectori , and Tetrabothrius ( s.l. ) sp. 2 (single fragmented immature specimen) and 2 morphotypes of tetraphyllidean larvae from P. dioptrica. Tetrabothrius ( T. ) hobergi n. sp. can be distinguished from Tetrabothrius ( T. ) forsteri by the greater number of testes and larger eggs and oncospheres, from Tetrabothrius ( T. ) curilensis by the smaller testes and vitellarium, the shape and size of the ovary, and the larger oncospheres and longer embryonic hooks, and from Tetrabothrius ( T. ) sp. from Ziphius cavirostris by the narrower strobila, smaller scolex, and smaller number of testes. The generic designations of Tetrabothrius ( s.l. ) sp. 1 and Tetrabothrius ( s.l. ) sp. 2 were based on the scolex morphology. Tetrabothrius ( s.l. ) sp. 1 is closest to Tetrabothrius ( T. ) forsteri and Tetrabothrius ( Biamniculus ) innominatus based on the number of testes, while the scolex size of Tetrabothrius ( Tetrabothrius ) sp. 2 is within the variability range reported for Tetrabothrius ( T. ) forsteri . More definite identification of the 2 species was not possible due to the condition of the available material. The present study provides the first descriptions of cestodes from M. hectori and P. dioptrica , thus enriching the knowledge regarding the helminths of insufficiently studied marine mammals. PMID:20486735

Nikolov, Pavel N; Cappozzo, H Luis; Berón-Vera, Bárbara; Crespo, Enrique A; Raga, J Antonio; Fernández, Mercedes

2010-08-01

365

Nothing is perfect! Trouble-shooting in immunological and molecular studies of cestode infections.  

UK PubMed Central (United Kingdom)

SUMMARY This personal review focuses on ways to approach and overcome some of the more common issues encountered while studying cestode zoonoses. The information presented here is based on the author's own experiences with immunological and molecular approaches for the detection of these parasites. There are many incongruities between immunological and molecular studies due to biased work. Nothing is perfect. Indirect approaches using either immunological, or even molecular tools, are limited without confirmation from direct evidence of infection. The dilemma of whether developing countries should develop their own diagnostic tests or rely on commercially available kits is also discussed.

Ito A

2013-06-01

366

Cestodes in South American freshwater teleost fishes: keys to genera and brief description of species  

Directory of Open Access Journals (Sweden)

Full Text Available Keys to genera of cestodes in South American freshwater teleost fishes are provided, with diagnoses of genera and short descriptions of species. Two new genera are proposed, Chambriella gen.n. for Goezeella agostinhoi Pavanelli & Santos, 1992 and G paranaensis Pavanelli & Rego, 1989, and Brooksiella gen.n. for Amphoteromorphus praeputialis Rego, Santos & Silva, 1974. Nomimoscolex magna Rego, Santos & Silva, 1974, previously species inquirenda, is transferred to the genus Proteocephalus Weinland, 1858. Goezeella nupeliensis Pavanelli & Rego, 1989 is considered a species inquirenda. Species and host lists are included.

Amilcar Arandas Rego; James C Chubb; Gilberto C Pavanelli

1999-01-01

367

21 CFR 522.1870 - Praziquantel injectable solution.  

Science.gov (United States)

...For removal of canine cestodes Dipylidium caninum, Taenia pisiformis, and Echinococcus granulosus, and removal and control of canine cestode Echinococcus multilocularis . (iii) Limitations. For subcutaneous or...

2010-04-01

368

Sterilisation of cysticerci with gamma radiation  

International Nuclear Information System (INIS)

[en] Cysticerci of Taenia solium and of Taenia saginata were exposed to gamma radiation in doses varying from 0,2 - 1,4 kGy. Radiation had an adverse effect on the ability of the cysticerci to evaginate in vitro after a time lag of nine days in T. solium and after six days in T. saginata. Some cysticerci of T. solium treated with low doses (0,2 - 0,8 kGy) evaginated 24 days after treatment but no T. saginata cysticerci evaginated after 15 days. Cysticerci exposed to radiation doses of 0,2 - 1,2 kGy are as infective to golden hamsters as untreated cysticerci. Cestodes resulting from irradiated cysticerci, however, cannot maintain themselves indefinitely and are excreted or digested from Day +12 onwards. Such tapeworms do not grow but are resorbed and finally consist of only a scolex. It appears that radiation inhibits the ability of the cells to divide and the cells do not recover from this treatment. Carcasses lightly infested with cysticercosis could be rendered fit for human consumption by exposure to low doses (0,2 - 0,6 kGy) of gamma radiation[af] Blaaswurms van Taenia solium en Taenia saginata is aan gammastralingsdosisse van 0,2 tot 1,4 kGy blootgestel. Bestraling het 'n nadelige invloed op die vermoe van die blaaswurms om in vitro uit te stulp. Taenia solium het 'n vertraging van nege dae getoon terwyl Taenia saginata na ses dae uitgestulp het. Party blaaswurms van Taenia solium wat met lae dosisse (0,2 tot 0,8 kGy) behandel is, het 24 dae na behandeling uitgestulp terwyl geen Taenia saginata na 15 dae uitgestulp het. Blaaswurms was na stralingsdosisse van 0,2 tot 1,2 kGy nog net so aansteeklik vir goue hamsters as die onbehandelde blaaswurms. Lintwurms wat van bestraalde blaaswurms ontwikkel, kan hulself nie onbeperk handhaaf nie en word vanaf dag +12 uitgeskei of verteer. Hierdie lintwurms groei nie, maar word geresorbeer en bestaan uiteindelik net uit 'n skoleks. Dit blyk dat bestraling sel-deling inhibeer en dat die selle nie na die behandeling herstel nie. Karkasse wat ligtelik met sistiserkose besmet is, kan deur middel van lae gammastralingsdosisse (0,2 tot 0,6 kGy) vir menslike gebruik beveilig word

1979-10-05

369

Specificity of scolex and oncosphere antigens for the serological diagnosis of taeniid cestode infections in dogs.  

UK PubMed Central (United Kingdom)

Groups of dogs raised free of helminths were monospecifically infected with the common nematodes Toxocara canis, Ancylostoma caninum and Trichuris vulpis. Serums from these dogs, and a group of dogs of unknown history but infected with Dirofilaria immitis and Dipylidium caninum, had levels of antibody to their homologous nematode antigens readily detectable by ELISA. No cross-reactions were apparent when these serums were tested by ELISA using oncosphere antigens of Taenia hydatigena, T. pisiformis and T. ovis, scolex excretory/secretory antigens of T. hydatigena, T. pisiformis and Echinococcus granulosus or protoscolex antigen of E. granulosus.

Jenkins DJ; Rickard MD

1986-02-01

370

Cysticercosis  

Science.gov (United States)

... is an infection by a parasite called Taenia solium ( T. solium ), a pork tapeworm that creates cysts in different ... Cysticercosis is caused by swallowing eggs from T. solium , which are found in contaminated food. Autoinfection is ...