Conservación in vitro de chayote (Sechium edule)

OpenAIRE

Alvarenga-Venutolo, Silvana; Abdelnour-Esquivel, Ana; Villalobos-Aránbula, Víctor

2007-01-01

Conservación in vitro de chayote (Sechium edule). La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l) y ácido acetil salicílico (10-9, 10-6 y 10-3 M) al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC) y combinaciones de estos factores, en Costa Rica, en 1997. Se e...

Properties of cast films made of chayote (Sechium edule Sw.) tuber starch reinforced with cellulose nanocrystals

Science.gov (United States)

In this study, cellulose (C) and cellulose nanocrystals (CN) were blended with chayote tuber (Sechium edule Sw.) starch (CS) in formulations cast into films. The films were conditioned at different storage temperatures and relative humidity (RH), and analyzed by mechanical tests, X-ray diffraction, ...

The inhibitory effect of Mesembryanthemum edule (L.) bolus essential oil on some pathogenic fungal isolates

Science.gov (United States)

2014-01-01

Background Mesembryanthemum edule is a medicinal plant which has been indicated by Xhosa traditional healers in the treatment HIV associated diseases such as tuberculosis, dysentery, diabetic mellitus, laryngitis, mouth infections, ringworm eczema and vaginal infections. The investigation of the essential oil of this plant could help to verify the rationale behind the use of the plant as a cure for these illnesses. Methods The essential oil from M. edule was analysed by GC/MS. Concentration ranging from 0.005 - 5 mg/ml of the hydro-distilled essential oil was tested against some fungal strains, using micro-dilution method. The plant minimum inhibitory activity on the fungal strains was determined. Result GC/MS analysis of the essential oil resulted in the identification of 28 compounds representing 99.99% of the total essential oil. A total amount of 10.6 and 36.61% constituents were obtained as monoterpenes and oxygenated monoterpenes. The amount of sesquiterpene hydrocarbons (3.58%) was low compared to the oxygenated sesquiterpenes with pick area of 9.28%. Total oil content of diterpenes and oxygenated diterpenes detected from the essential oil were 1.43% and 19.24%. The fatty acids and their methyl esters content present in the essential oil extract were found to be 19.25%. Antifungal activity of the essential oil extract tested against the pathogenic fungal, inhibited C. albican, C. krusei, C. rugosa, C. glabrata and C. neoformans with MICs range of 0.02-0.31 mg/ml. the activity of the essential oil was found competing with nystatin and amphotericin B used as control. Conclusion Having accounted the profile chemical constituent found in M. edule oil and its important antifungal properties, we consider that its essential oil might be useful in pharmaceutical and food industry as natural antibiotic and food preservative. PMID:24885234

Sechium edule (Jacq. Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line

Directory of Open Access Journals (Sweden)

Sandra Salazar-Aguilar

2017-07-01

Full Text Available The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC and column chromatography (CC, identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions. Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC50 1.85 µg·mL−1, but the lymphocytes were affected by the extract (IC50 30.04 µg·mL−1. Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL−1. Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

Sechium edule (Jacq.) Swartz, a New Cultivar with Antiproliferative Potential in a Human Cervical Cancer HeLa Cell Line.

Science.gov (United States)

Salazar-Aguilar, Sandra; Ruiz-Posadas, Lucero Del Mar; Cadena-Iñiguez, Jorge; Soto-Hernández, Marcos; Santiago-Osorio, Edelmiro; Aguiñiga-Sánchez, Itzen; Rivera-Martínez, Ana Rocío; Aguirre-Medina, Juan Francisco

2017-07-25

The Sechium edule Perla Negra cultivar is a recently-obtained biological material whose progenitors are S. edule var. nigrum minor and S. edule var. amarus silvestrys, the latter of which has been reported to have antiproliferative activity against the HeLa P-388 and L-929 cancer cell lines. The present study aimed to determine if the methanolic extract of the fruit of the Perla Negra cultivar had the same biological activity. The methanolic extract was phytochemically characterized by thin layer chromatography (TLC) and column chromatography (CC), identifying the terpenes and flavonoids. The compounds identified via high performance liquid chromatography (HPLC) were Cucurbitacins B, D, E, and I for the terpene fractions, and Rutin, Phlorizidin, Myricetin, Quercetin, Naringenin, Phloretin, Apigenin, and Galangin for the flavonoid fractions). Biological activity was evaluated with different concentrations of the methanolic extract in the HeLa cell line and normal lymphocytes. The methanolic extract inhibited the proliferation of HeLa cells (IC 50 1.85 µg·mL -1 ), but the lymphocytes were affected by the extract (IC 50 30.04 µg·mL -1 ). Some fractions, and the pool of all of them, showed inhibition higher than 80% at a concentration of 2.11 µg·mL -1 . Therefore, the biological effect shown by the methanolic extract of the Perla Negra has some specificity in inhibiting tumor cells and not normal cells; an unusual feature among molecules investigated as potential biomedical agents.

Cryopreservation of chayote (Sechium edule JACQ.SW.) zygotic embryos and shoot-tips from in vitroplantlets

OpenAIRE

Abdelnour-Esquivel, Ana; Engelmann, Florent

2002-01-01

This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM we...

Chemical analyses and in vitro and in vivo toxicity of fruit methanol extract of Sechium edule var. nigrum spinosum.

Science.gov (United States)

Aguiñiga-Sánchez, Itzen; Cadena-Íñiguez, Jorge; Santiago-Osorio, Edelmiro; Gómez-García, Guadalupe; Mendoza-Núñez, Víctor Manuel; Rosado-Pérez, Juana; Ruíz-Ramos, Mirna; Cisneros-Solano, Víctor Manuel; Ledesma-Martínez, Edgar; Delgado-Bordonave, Angel de Jesus; Soto-Hernández, Ramón Marcos

2017-12-01

Sechium edule (Jacq.) Sw. (Cucurbitaceae) is used in ethnomedicine, but the diversity of the varietal groups of this species has not often been considered. This is important because we previously reported that different variety of species exhibit different activities across different tumor cell lines. This study investigates the chemical composition and biological activities of extracts obtained from S. edule var. nigrum spinosum. The leukemia P388 cell line and mononuclear bone marrow cells (MNCBMs) were treated with the extract at a concentration ranging from 40 to 2370 μg/mL for cytotoxicity and viability assays. CD-1 mice were treated with 8-5000 mg/kg extract and monitored every hour for the first 24 h and subsequently for seven days for signs of toxicity (LD 50 ). In addition, the chromatographic profile of the extract was determined by HPLC. The extract inhibits the proliferation of both P388 cells and MNCBMs, with IC 50 values of 927 and 1911 μg/mL, respectively, but reduced the viability and induced the apoptosis of only leukemia cells. The LD 50 was higher than 5000 mg/kg, and this concentration did not alter the blood chemistry or cell count but doubled the mitotic index in the bone marrow. The HPLC showed the presence of cucurbitacins, phloridzin, naringenin, phloretin, apigenin, and gallic, chlorogenic, vanillic, p-hydroxybenzoic, caffeic, and p-coumaric acids. Sechium edule var. nigrum spinosum contains bioactive compounds that explain the antiproliferative and nutraceutical activities, and its lack of physiological side effects constitutes an added value to a widely consumed vegetable.

Short-term fluctuations in bivalve larvae compared with some environmental factors in a coastal lagoon (South Portugal

Directory of Open Access Journals (Sweden)

Luis M.Z. Chícaro

2000-12-01

Full Text Available In this study, short-term fluctuations in bivalve larvae were compared with some triggering factors for a period of sixteen months. Data on the abundance of planktonic larvae, collected two to three times a week were related to water temperature, salinity, wind velocity, tidal amplitude and chlorophyll a. Higher densities of planktonic bivalve larvae were caught between May and August, but intense fluctuations in abundance were observed. Planktonic bivalve larvae of eighteen taxa were identified. Larvae of Mytilus galloprovincialis, Cerastoderma edule, Ruditapes decussates and Venerupis spp. were the most abundant. The seasonal fluctuations of bivalve abundance seem to be controlled by temperature, the major factor in the timing of the reproduction of bivalves. Nevertheless, advection may be also a key factor during the planktonic life of bivalve species in coastal systems, such as the Ria Formosa.

Chemical composition profiling and antifungal activity of the essential oil and plant extracts of Mesembryanthemum edule (L.) bolus leaves.

Science.gov (United States)

Omoruyi, Beauty Etinosa; Afolayan, Anthony Jide; Bradley, Graeme

2014-01-01

Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could help to verify the efficacy of the plant in the management or treatment of these illnesses. Various concentrations of the hydro-distilled essential oil, ranging from 0.005-5 mg/ml, were tested against some fungal strains, using the micro-dilution method. Minimum inhibitory activity was compared with four other different crude extracts of hexane, acetone, ethanol and aqueous samples from the same plant. The chemical composition of the essential oil, hexane, acetone and ethanol extracts was determined using GC-MS. GC/MS analysis of the essential oil resulted in the identification of 28 compounds, representing 99.99% of the total oil. Phytoconstituents of hexane, acetone and ethanol extracts yielded a total peak chromatogram of fifty nine compounds. A total amount of 10.6% and 36.61% of the constituents were obtained as monoterpenes and oxygenated monoterpenes. Sesquiterpene hydrocarbons (3.58%) were relatively low compared to the oxygenated sesquiterpenes (9.28%), while the major concentrated diterpenes and oxygenated diterpenes were 1.43% and 19.24 %, respectively and phytol 12.41%. Total amount of fatty acids and their methyl esters content, present in the oil extract, were found to be 19.25 %. Antifungal activity of the oil extract and four solvent extracts were tested against five pathogenic fungal strains. The oil extract showed antifungal activity against Candida albican, Candida krusei, Candida rugosa, Candida glabrata and Cryptococcus neoformans with MIC ranges of 0.02 0.31 mg/ml. Hexane extract was active against the five fungal strains with MICs ranging between 0.02-1.25 mg/ml. Acetone extracts were active against C. krusei only at 0.04mg/ml. No

Conservación in vitro de chayote (Sechium edule

Directory of Open Access Journals (Sweden)

Silvana Alvarenga-Venutolo

2007-01-01

Full Text Available Conservación in vitro de chayote (Sechium edule. La técnica de conservación in vitro a mediano plazo fue examinada en chayote. Para ello se determinó la supervivencia de los brotes después de la adición de altas concentraciones de sacarosa (0, 30, 50, 60, 70 y 80 g/l y ácido acetil salicílico (10-9, 10-6 y 10-3 M al medio de cultivo, de disminuciones en la temperatura de crecimiento (16, 18, 20, 22 y 25ºC y combinaciones de estos factores, en Costa Rica, en 1997. Se encontró que los brotes mantuvieron altos porcentajes de viabilidad después de ser conservados durante seis meses en los tratamientos evaluados. Debido a la apariencia más vigorosa y a la coloración más verde que presentaron las plántulas, se consideró que el mejor tratamiento fue la adición de 60 g/l de sacarosa al medio de cultivo combinado con la incubación a 16ºC.

Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

Science.gov (United States)

Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

2006-02-01

Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively.

Baltic leaders who returned from West to East

Index Scriptorium Estoniae

2006-01-01

Artiklis tutvustatakse kolme Balti riigi presidentide sarnast minevikku eksiilis ning nenditakse, et varasem demokraatlikus riigis elamise kogemus on kindlasti kaasa aidanud Eesti, Läti ja Leedu majanduslikule ning välispoliitilisele edule

Metabolites of saxitoxin analogues in bivalves contaminated by Gymnodinium catenatum.

Science.gov (United States)

Vale, Paulo

2010-01-01

Bivalve metabolites of saxitoxin analogues, not present in microalgae, were recently described as an important toxin fraction in mussels contaminated by Alexandrium tamarense. These possess very low fluorescence, and require mass spectrometry detection. HILIC-MS was implemented to look for these metabolites in bivalves contaminated during Gymnodinium catenatum blooms at the Portuguese coast. The presence of M1 was tentatively identified in several bivalves, ranging from estuarine (Mytilus galloprovinciallis, Cerastoderma edule and Ruditapes decussatus) to oceanic habitat (Donax trunculus and Ensis spp.). It was hypothesized that M1 could contribute to an important fraction of the profile of STX analogues. M1 was more abundant in estuarine bivalves that retain longer PSP toxins, in the following order: mussels>cockles>clams. These data highlight that the study by fluorimetry alone of the carbamoyl, N-sulfocarbamoyl, and decarbamoyl families is manifestly insufficient to fully understand toxin dynamics in bivalves feeding on G. catenatum without a proper study of hydroxybenzoate and hydroxylated M-toxins.

Comparative studies on the morphometry and physiology of European populations of the lagoon specialist Cerastoderma glaucum (Bivalvia

Directory of Open Access Journals (Sweden)

Katarzyna Tarnowska

2009-09-01

Full Text Available Seasonal changes in the morphometric and physiological parameters of the cockle Cerastoderma glaucum (Bivalvia from the Baltic Sea (GD, the North Sea (LV, and the Mediterranean Sea (BL were investigated. The cockles from GD were much smaller than those from other populations due to osmotic stress. The female to male ratios did not differ significantly from 1:1. The northern populations (GD, LV had a monocyclic reproductive pattern, whereas the southern population (BL seemed to reproduce throughout the year. Seasonal changes in the contents of biochemical components appeared to be correlated with changes in trophic conditions and the reproductive cycle. Protein content was the highest in spring for all the populations. The highest lipid contents and lowest carbohydrate contents were noted in GD and BL in spring, while no marked differences were noted among seasons in LV (probably because the data from both sexes were pooled. Respiration rates in GD were the highest among the populations, which could have been due to osmotic stress. High metabolic rates expressed by high respiration rates in GD and LV in spring and autumn could have resulted from gamete development (in spring and phytoplankton blooms (in spring and autumn.

Mesocosm validation of the marine No Effect Concentration of dissolved copper derived from a species sensitivity distribution.

Science.gov (United States)

Foekema, E M; Kaag, N H B M; Kramer, K J M; Long, K

2015-07-15

The Predicted No Effect Concentration (PNEC) for dissolved copper based on the species sensitivity distribution (SSD) of 24 marine single species tests was validated in marine mesocosms. To achieve this, the impact of actively maintained concentrations of dissolved copper on a marine benthic and planktonic community was studied in 18 outdoor 4.6m(3) mesocosms. Five treatment levels, ranging from 2.9 to 31μg dissolved Cu/L, were created in triplicate and maintained for 82days. Clear effects were observed on gastropod and bivalve molluscs, phytoplankton, zooplankton, sponges and sessile algae. The most sensitive biological endpoints; reproduction success of the bivalve Cerastoderma edule, copepod population development and periphyton growth were significantly affected at concentrations of 9.9μg Cu/L and higher. The No Observed Effect Concentration (NOEC) derived from this study was 5.7μg dissolved Cu/L. Taking into account the DOC concentration of the mesocosm water this NOEC is comparable to the PNEC derived from the SSD. Copyright © 2015. Published by Elsevier B.V.

Effect of feeding chayote (Sechium edule) meal on growth performance and nutrient utilization in indigenous pig (Zovawk) of Mizoram.

Science.gov (United States)

Lalthansanga, James; Samanta, A K

2015-07-01

This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule) meal by replacing standard concentrate mixture (CM) on the growth parameters such as feed intake, body weight gain, average daily gain (ADG) and feed conversion ratio (FCR), and nutrient utilization in indigenous pig of Mizoram. Twenty-four growing indigenous pigs (Zovawk) were used to study the effect of feeding chayote (Sechium edule) meal (fruits and leaves at the ratio 4:1) on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4). Chayote meal was used to replace standard CM (pig grower ration) at 0% (G1), 20% (G2), 30% (G3), and 40% (G4). During the feeding trial of 90 days, it was found that the dry matter (DM) intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg) was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05) among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05), although the ether extract digestibility in G1 was significantly low (pChayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule

Directory of Open Access Journals (Sweden)

Sergio Espíndola Mateos

2015-10-01

Full Text Available β-Glucosidase (EC 3.2.1.21 is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1, in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results. One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min−1. The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

Purification and Partial Characterization of β-Glucosidase in Chayote (Sechium edule).

Science.gov (United States)

Mateos, Sergio Espíndola; Cervantes, Carlos Alberto Matías; Zenteno, Edgar; Slomianny, Marie-Christine; Alpuche, Juan; Hernández-Cruz, Pedro; Martínez-Cruz, Ruth; Canseco, Maria Del Socorro Pina; Pérez-Campos, Eduardo; Rubio, Manuel Sánchez; Mayoral, Laura Pérez-Campos; Martínez-Cruz, Margarito

2015-10-23

β-Glucosidase (EC 3.2.1.21) is a prominent member of the GH1 family of glycoside hydrolases. The properties of this β-glucosidase appear to include resistance to temperature, urea, and iodoacetamide, and it is activated by 2-ME, similar to other members. β-Glucosidase from chayote (Sechium edule) was purified by ionic-interchange chromatography and molecular exclusion chromatography. Peptides detected by LC-ESI-MS/MS were compared with other β-glucosidases using the BLAST program. This enzyme is a 116 kDa protein composed of two sub-units of 58 kDa and shows homology with Cucumis sativus β-glucosidase (NCBI reference sequence XP_004154617.1), in which seven peptides were found with relative masses ranging from 874.3643 to 1587.8297. The stability of β-glucosidase depends on an initial concentration of 0.2 mg/mL of protein at pH 5.0 which decreases by 33% in a period of 30 h, and then stabilizes and is active for the next 5 days (pH 4.0 gives similar results). One hundred μg/mL β-D-glucose inhibited β-glucosidase activity by more than 50%. The enzyme had a Km of 4.88 mM with p-NPG and a Kcat of 10,000 min(-1). The optimal conditions for the enzyme require a pH of 4.0 and a temperature of 50 °C.

Assessing the role of benthic filter feeders on phytoplankton production in a shellfish farming site: Mont Saint Michel Bay, France

Science.gov (United States)

Cugier, Philippe; Struski, Caroline; Blanchard, Michel; Mazurié, Joseph; Pouvreau, Stéphane; Olivier, Frédéric; Trigui, Jihane R.; Thiébaut, Eric

2010-07-01

The macrobenthic community of Mont Saint Michel Bay (English Channel, France) is mainly dominated by filter feeders, including cultivated species (oysters and mussels). An ecological model of the bay was developed, coupling a 2D hydro-sedimentary model and two biological models for primary production and filter-feeder filtration. The filter-feeder model includes three cultivated species ( Mytilus edulis, Crassostrea gigas and Ostrea edulis), one invasive species ( Crepidula fornicata) and eight wild native species ( Abra alba, Cerastoderma edule, Glycymeris glycymeris, Lanice conchilega, Macoma balthica, Paphia rhomboides, Sabellaria alveolata, andSpisula ovalis). For cultivated and invasive species, the production of biodeposits was computed to assess their role in restimulating primary production. Chlorophyll a concentrations appeared to be strongly controlled by the filter feeders. When the pressure of each benthic compartment on phytoplankton was estimated separately wild species and the invasive slipper limpet C.fornicata were shown to be key elements in the control of primary production. Conversely, the role of cultivated species, particularly oysters, was weaker. Feedback due to the mineralization of biodeposits also appears to be crucial to fully evaluate the role of filter feeders in primary production.

Effect of feeding chayote (Sechium edule meal on growth performance and nutrient utilization in indigenous pig (Zovawk of Mizoram

Directory of Open Access Journals (Sweden)

James Lalthansanga

2015-07-01

Full Text Available Aim: This study was planned to investigate the effect of feeding different levels of chayote (Sechium edule meal by replacing standard concentrate mixture (CM on the growth parameters such as feed intake, body weight gain, average daily gain (ADG and feed conversion ratio (FCR, and nutrient utilization in indigenous pig of Mizoram. Materials and Methods: Twenty-four growing indigenous pigs (Zovawk were used to study the effect of feeding chayote (Sechium edule meal (fruits and leaves at the ratio 4:1 on growth performance and nutrient utilization. They were allocated randomly into 4 treatment groups (G1, G2, G3, and G4. Chayote meal was used to replace standard CM (pig grower ration at 0% (G1, 20% (G2, 30% (G3, and 40% (G4. Results: During the feeding trial of 90 days, it was found that the dry matter (DM intake decreased as the level of chayote meal increased. For G1, G2, G3, and G4, the ADG (kg was 0.24±0.04, 0.23±0.03, 0.18±0.02, and 0.18±0.02, respectively, and the feed conversion efficiency was 5.42±0.44, 4.93±0.17, 5.38±0.05, and 5.74±0.53, respectively. However, there was no significant difference (p>0.05 among the different treatment groups in respect to ADG and FCR. At the end of the feeding trial, digestibility trial was conducted to study the effect of feeding chayote meal in the digestibility of the different nutrients by the experimental animals. From the digestibility trial, it was revealed that the digestibility coefficient of DM, crude protein, and crude fiber were also similar (p>0.05, although the ether extract digestibility in G1 was significantly low (p<0.01 as compared to G2, G3, and G4. Conclusion: Chayote meal could safely replace the standard grower ration up to 40% in the diet of growing local pigs without causing any adverse effects on growth and nutrient utilization.

VALORACIÓN DE LA CIDRA PAPA (Sechium edule COMO ALTERNATIVA DE ALIMENTACIÓN Y RECUPERACIÓN DE VÍNCULOS CON EL CAMPO VALORAÇÃO DA Sechium edule COMO ALTERNATIVA DE ALIMENTAÇÃO E RECUPERAÇÃO DOS VINCULOS COM O CAMPO VALUATION OF Sechium edule AS AN ALIMENTARY ALTERNATIVE AND RECUPERATION OF BONDS TO THE COUNTRY

Directory of Open Access Journals (Sweden)

CONSUELO MONTES R

2011-12-01

Full Text Available El objetivo de la investigación, fue valorar la cidra papa (Sechium edule como alternativa de alimentación para familias en desplazamiento que viven en asentamientos urbano marginales de Popayán, con el fin de contribuir a la recuperación del conocimiento tradicional asociado al uso y manejo, identificar ecotipos, identificar el significado sociocultural como alternativa para mantener los vínculos con el campo, evaluar productividad y posibilidades de manejo en espacios urbano marginales. El proceso se desarrolló mediante 'investigación participativa', donde los actores participaron en dinámicas recreativas, talleres de sensibilización y socialización, giras de intercambio de saberes, de semillas y generación de conocimientos, lo que permitió obtener información, y la apropiación del proceso. Se definieron como áreas de estudio 3 comunas de Popayán, se seleccionaron 4 asentamientos, se aplicaron 116 encuestas, se realizaron visitas mensuales por asentamiento, entablando diálogos informales con las familias participantes. Se conocieron las posibilidades de manejo de la planta, se incentivó la siembra de la misma aplicando el concepto de agricultura urbana donde se asoció la planta con otras hortalizas. Se pudo constatar que plantas como la cidra se adaptan a las condiciones que ofrecen los asentamientos y que son fuente alternativa para la alimentación de estas poblaciones, se fomentó el consumo de especies sub utilizadas, se hizo intercambio de saberes y se generaron espacios para motivar la conservación de ecotipos y especies de plantas como la cidra, que pueden resistir a las condiciones de marginalidad.0 objetivo da pesquisa, foi avaliar a cidra papa (Sechium edule como alternativa de alimentação para familias deslocadas que moram nos perímetros da cidade de Popayán, com o proposito de contribuir na recuperação do conhecimento tradicional relacionado com a utilização e manejo, identificação de ecotipos e o

Study of flavonoids of Sechium edule (Jacq) Swartz (Cucurbitaceae) different edible organs by liquid chromatography photodiode array mass spectrometry.

Science.gov (United States)

Siciliano, Tiziana; De Tommasi, Nunziatina; Morelli, Ivano; Braca, Alessandra

2004-10-20

A liquid chromatography-mass spectrometry (LC-MS)-based method was developed for the characterization of flavonoids from Sechium edule (Jacq) Swartz (Cucurbitaceae) edible organs, a plant cultivated since pre-Colombian times in Mexico where the fruit is called chayote. Chayote is used for human consumption in many countries; in addition to the fruits, stems, leaves and the tuberous part of the roots are also eaten. Eight flavonoids, including three C-glycosyl and five O-glycosyl flavones, were detected, characterized by nuclear magnetic resonance spectroscopic data, and quantified in roots, leaves, stems, and fruits of the plant by LC-photodiode array-MS. The aglycone moieties are represented by apigenin and luteolin, while the sugar units are glucose, apiose, and rhamnose. The results indicated that the highest total amount of flavonoids was in the leaves (35.0 mg/10 g of dried part), followed by roots (30.5 mg/10 g), and finally by stems (19.3 mg/10 g). Copyright 2004 American Chemical Society

Cryopreservation of chayote (Sechium edule JACQ. SW.) zygotic embryos and shoot-tips from in vitro plantlets.

Science.gov (United States)

Abdelnour-Esquivel, Ana; Engelmann, Florent

2002-01-01

This paper presents the development of cryopreservation protocols for zygotic embryos and apices of chayote (Sechium edule Jacq. Sw.), a tropical plant species with recalcitrant seeds. Zygotic embryos of two cultivars, Ccocro negro (CN) and Claudio (Cl) could withstand cryopreservation, with survival percentages of 10 and 30 %, after desiccation to 23 and 19 % moisture content (fresh weight basis), respectively. Apices sampled on in vitro plantlets of cultivars Cl, 13 and JM were successfully cryopreserved using a vitrification technique. Optimal conditions included the culture of mother-plants for 22 days on medium containing 0.3 M sucrose, culture of excised apices on the same medium for 1 day, loading of apices for 20 min with 2M glycerol + 0.4M glycerol, treatment with a series of diluted PVS2 solution (60 % PVS2 followed by 80 % PVS2 solution for 15 min (cultivar Cocoro Blanco [CB]) or 30 min (cultivars CN and Cl) at each concentration), rapid freezing and thawing, washing of shoot-tips with a 1.2 M sucrose solution, followed by recovery on media with progressively decreasing sucrose concentrations until the standard concentration of 0.1 M was reached. The highest survival percentages achieved ranged between 17 and 38 %, depending on the cultivar.

Nutraceutic Characteristics of the Extracts and Juice of Chayote (Sechium edule (Jacq. Sw. Fruits

Directory of Open Access Journals (Sweden)

María de la Luz Riviello-Flores

2018-05-01

Full Text Available Fruits of chayote [Sechium edule (Jacq. Swartz] are a non-traditional vegetable widely consumed in Latin America, with the state of Veracruz, México being the world’s main producer, but little is known about the nutraceutical potential. This study aimed to determine the chemical compositions and antioxidant activities from the juice fruits from two commercial varieties of chayote cultivated in Mexico, as well as a proposal for the elaboration of chayote juices with stevia leaves and pineapple juice. The physicochemical properties of juice from virens levis (VL and nigrum spinosum (NS varieties were determined using standard methods. The juice of the two varieties differ significantly regarding the concentrations of total soluble solids and total sugars, but not vitamin C. The total concentration of phenolics in NS extracts was slightly higher than in VL (1005 and 856 mg 100 g−1 dry-weight, respectively, but the total flavonoid contents were similar (27 and 26 mg 100 g−1 dry-weight, respectively. Cucurbitacin D was predominant in both varieties. The radical scavenging capacities of VL and NS extracts varied slightly (IC50 = 0.45 to 0.65 mg mL−1, while the antioxidant activities were similar (~80%. The NS variety is particularly promising regarding nutraceutical application. The chayote juice combined with stevia and pineapple maintained the original nutraceutical characteristics of the fruit, but enhanced the organoleptic characteristics like density and sugar/acidity balance.

Immediate effect of intertidal non-mechanised cockle harvesting on macrobenthic communities: a comparative study

Directory of Open Access Journals (Sweden)

Francisco Miguel Sousa Leitão

2007-12-01

Full Text Available In Ria Formosa cockles (Cerastoderma edule have traditionally been harvested with a harvesting-knife (HK. However, over the last six years there has been an increase in the use of a hand-dredge (HD to exploit cockle beds. A comparative study on the impact of these harvesting methods on the benthic macrofauna was undertaken with the aim of evaluating the possible introduction of the hand-dredge in the fishery. Macrofaunal mortality was very low regardless of the gear. However, the total mortality resulting from using the HK was superior to the one observed for the HD. For the same fishing time the hand-dredge covers an area approximately five times greater that the one covered by the knife, with the former yielding 5 times the catch of the latter. Consequently, the use of hand-dredges increases the fishing effort, which may lead to the overexploitation of the cockle populations. Our results revealed that the immediate effect of both gears on macrobenthic communities was similar and minimal. Therefore, we believe that introducing the hand-dredge in the cockle fishery should only be authorised if other management measures, such as daily quotas, closed areas and limiting the number of fishing licenses, are implemented.

Micropropagación de chayote (sechium edule jacq. Sw. a partir de brotes vegetativos

Directory of Open Access Journals (Sweden)

Ana Abdelnour

2002-01-01

Full Text Available El chayote (Sechium edule es una importante fuente de divisas para los países exportadores, entre los que Costa Rica mantiene el liderazgo mundial. Entre los factores más limitantes para su producci ón se encuentra el material de siembra, tradicionalmente la semilla, que por su naturaleza no permite la obtención de una producción morfológicamente homogénea de frutos (color, forma y textura de la epidermis motivo de los altos porcentajes de rechazo en las plantas empacadoras. El establecimiento de una metodología de propagación vegetativa de la especie ayudaría a resolver los problemas de heterogeneidad. Por lo anterior, la presente investigación se dirigió a desarrollar un método de micropropagación a partir de brotes vegetativos. Se evaluó el efecto de varios desinfectantes y concentraciones de reguladores de crecimiento en las etapas de establecimiento, multiplicación y enraizamiento de dos cultivares comerciales. Se observó que una desinfección con hipoclorito de calcio al 4% permitió el mayor porcentaje de explantes establecidos asépticamente bajo condiciones in vitro (49%. También se observó que durante las etapas posteriores de la micropropagación, los requerimientos de reguladores de crecimiento fueron muy bajos (0,1 mgL-1 de BA en la etapa de brotación de yemas y de 0,1 a 0,2 mgL-1 de AIB durante el enraizamiento o no se requirieron (etapa de multiplicaci ón de microestacas.

Shifting baselines in the Ems Dollard estuary: A comparison across three decades reveals changing benthic communities

Science.gov (United States)

Compton, Tanya J.; Holthuijsen, Sander; Mulder, Maarten; van Arkel, Maarten; Schaars, Loran Kleine; Koolhaas, Anita; Dekinga, Anne; ten Horn, Job; Luttikhuizen, Pieternella C.; van der Meer, Jaap; Piersma, Theunis; van der Veer, Henk W.

2017-09-01

At a time when there is a growing discussion about the natural state of estuaries, a comparison of macrozoobenthos communities from two surveys conducted 30 years apart in the Ems Dollard estuary, in the eastern Wadden Sea, The Netherlands, provides a unique opportunity to compare changes over time. As expected, our comparison revealed a gradient in species composition from land (the Dollard) to sea (the Outer Ems) at both points in time, with brackish species in the Dollard and more marine species in the Outer Ems (Wadden Sea). Total richness increased over time; however, this mainly reflected the immigration of new species and sampling differences. In the Dollard, total biomass declined over time, most likely reflecting de-eutrophication in this area. Strikingly, at the meeting point between the sea and the brackish Dollard, i.e. the Inner Ems, the community composition changed from one dominated by bivalves (1970s) to one dominated by worms (since 2009). This change involved a reduction in total biomass, mainly of Mya arenaria, and immigration of polychaete worms (Marenzellaria viridis and Alitta succinea). In the Outer Ems, an increase in total biomass was observed, associated with the recent successful recruitment of Cerastoderma edule. This comparison highlights that historical data provides useful insights at large spatial scales. However, a full understanding of the complex dynamics of estuaries requires an analysis of continuous long-term monitoring series.

Shellfish dredging pushes a flexible avian top predator out of a marine protected area.

Directory of Open Access Journals (Sweden)

Jan A van Gils

2006-11-01

Full Text Available There is a widespread concern about the direct and indirect effects of industrial fisheries; this concern is particularly pertinent for so-called "marine protected areas" (MPAs, which should be safeguarded by national and international law. The intertidal flats of the Dutch Wadden Sea are a State Nature Monument and are protected under the Ramsar convention and the European Union's Habitat and Birds Directives. Until 2004, the Dutch government granted permission for ~75% of the intertidal flats to be exploited by mechanical dredgers for edible cockles (Cerastoderma edule. Here we show that dredged areas belonged to the limited area of intertidal flats that were of sufficient quality for red knots (Calidris canutus islandica, a long-distance migrant molluscivore specialist, to feed. Dredging led to relatively lower settlement rates of cockles and also reduced their quality (ratio of flesh to shell. From 1998 to 2002, red knots increased gizzard mass to compensate for a gradual loss in shellfish quality, but this compensation was not sufficient and led to decreases in local survival. Therefore, the gradual destruction of the necessary intertidal resources explains both the loss of red knots from the Dutch Wadden Sea and the decline of the European wintering population. This study shows that MPAs that do not provide adequate protection from fishing may fail in their conservation objectives.

The reproductive cycle, condition index, and glycogen reserves of the cockles Cerastoderma glaucum from the Gulf of Gabès (Tunisia).

Science.gov (United States)

Karray, Sahar; Smaoui-Damak, Wafa; Rebai, Tarek; Hamza-Chaffai, Amel

2015-11-01

The gametogenic cycle of the Cerastoderma glaucum was analyzed using both qualitative and semi-quantitative methods. The condition index and glycogen concentrations were determined in order to provide information on energy storage. The cockles were collected monthly from a Bayyadha site located 15 km south of Sfax City (Gulf of Gabès) between January 2007 and January 2008. From histological point of view, we applied two approaches: (i) the qualitative method describing the various stages of gamete development for males and females during a cycle of 13 months, and (ii) the semi-quantitative method concerning the estimation of different tissue surfaces. The results showed that there is evidence of three periods of reproduction in this population. A comparison between the surfaces occupied by the three organs showed that the foot and the gonad surfaces are higher than the surface of the adductor muscle. This could suggest that these two organs are more involved in the process of glycogen reserve storage. The results of the glycogen concentrations in the different tissues (gonad, adductor muscle, and "remainders") show that during the second and third periods of reproduction, glycogen was stored in the adductor muscle and in the remainder during sexual rest, and in the gonad during the gametogenesis phases in order to supply the reproductive effort. On the contrary, in the first period of reproduction, the low concentrations of glycogen recorded in the gonad coincided with its high degree of development. This fact could be related to environmental conditions (low temperature and food) recorded during this period.

Effects of IAA and IBA on the in vitro rooting of stem cuttings of Sechium edule (Jacq. Sw

Directory of Open Access Journals (Sweden)

José García García

2015-01-01

Full Text Available This investigation was carried out with the objective of evaluating the response of shoots of chayote [S. edule (Jacq. Sw.] to the application of indole-3-butyric acid (IBA and indole-3-acetic acid (IAA on the in vitro rooting phase. The effect of three culture media, modified from the proposed of Murashige and Skoog (MS was studied: 1- 65% MS salt base, 2- 65% MS salt base + 0.05 mg l-1 of indolebutyric acid (AIB and 3- 65% MS salt base + 3.0 mg l-1-3-indole acetic acid (IAA. The variables evaluated were: number of roots, length and number of shoots per in vitro seedling. The best result were obtained when using 65% MS salt base with 3.0 mg l-1 of IAA. Significant differences (P<0.05 among treatments containing growth regulators was obtained for the variables number of roots and length of in vitro plantlets. In the UNA-730 accession root induction was obtained in a 65% MS salt base culture medium without growth regulators; however, when IAA and IBA was added the induction was 100%. The differences identified in this work with regards to the root induction were probably the combined result of genotype and specific culture conditions. Key words: auxins, chayote, growth regulators, in vitro culture

Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas, Mytilus edulis and Cerastoderma edule, in relation to food competition

NARCIS (Netherlands)

Troost, K.; Stamhuis, E.J.; van Duren, L.A; Wolff, W.J.

Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

Feeding current characteristics of three morphologically different bivalve suspension feeders, Crassostrea gigas Mytilus edulis and Cerastoderma edule , in relation to food competition

NARCIS (Netherlands)

Troost, K.; Stamhuis, E.J.; Duren, L.A.; Wolff, W.

2009-01-01

Introduced Pacific oysters (Crassostrea gigas) have shown rapid expansion in the Oosterschelde estuary, while stocks of native bivalves declined slightly or remained stable. This indicates that they might have an advantage over native bivalve filter feeders. Hence, at the scale of individual

Criterios locales para selección de semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de Chiapas, México

Directory of Open Access Journals (Sweden)

Francisco Guevara Hernández

2015-04-01

Full Text Available En el estudio se identificaron y analizaron los criterios socio-antropológicos fundamentados en etnoagronomía y etnobotánica de los productores para seleccionar semillas de chayote (Sechium edule Jacq. Sw. en zonas rurales de los municipios Villa Corzo y Villaflores (Chiapas, México. En entrevistas semi-estructuradas realizadas a 60 productores se describieron los criterios locales para seleccionar las semillas de esta hortaliza, considerando características de color, tamaño y presencia de espinas en los frutos, así como la obtención de variedades y recomendaciones para la siembra. Sin considerar la procedencia de los productores, el cultivo del chayote se realiza independientemente del tamaño, el color o la presencia de espinas en los frutos. Más de 60% de los productores entrevistados compra las semillas y prefieren aquellas variedades que posean frutos con espinas debido a su sabor agradable. Se confirmó la validez de los estudios socio-antropológicos en sistemas agrícolas tradicionales en la zona, particularmente en etnobotánica, para entender las relaciones sociales y productivas a nivel local, y para definir sistemas productivos sostenibles a partir de los criterios propios de las familias campesinas, lo que permite documentar, analizar, validar y entender multi-criterios relacionados con la producción familiar de chayote y su posible mejoramiento.

HONGOS CAUSANTES DE ENFERMEDADES POSTCOSECHA EN CHAYOTE (Sechium edule (Jacq. SW. Y SU CONTROL IN VITRO

Directory of Open Access Journals (Sweden)

Siul D. Romero-Velazquez

2015-01-01

Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusarium sp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

Hongos causantes de enfermedades postcosecha en chayote (Sechium edule(Jacq. SW. y su control in vitro

Directory of Open Access Journals (Sweden)

Siul D. Romero Velazquez

2015-11-01

Full Text Available El fruto de chayote (Sechium edule (Jaqc. Sw. es una hortaliza de exportación de importancia para México y Costa Rica. El proceso comercial exige cumplir con estándares de calidad, que implican frutos sanos y libres de defectos. Sin embargo, debido a las condiciones de alta humedad que se desarrollan en los frutos empacados en películas plásticas, se han presentado rechazos en el mercado de exportación, por la presencia de enfermedades fungosas. El objetivo de este trabajo fue identificar morfológica (microscopía óptica y electrónica de barrido y molecularmente (PCR: Polimerase Chain Reaction las especies de hongos causales de las principales enfermedades postcosecha de chayote en frutos infectados procedentes de huertas comerciales para exportación, así como probar in vitro la efectividad de diversos productos comerciales en la inhibición del crecimiento de dichos hongos. Los resultados mostraron a Didymella bryoniae como el causante de “gomosis de las cucurbitáceas” y a Fusarium oxysporum y F. solani como causales de fusariosis o ahogamiento de guías; estos patógenos dañan la parte basal y media de frutos comerciales, además de Chaetomium globosum, un asociado al proceso infeccioso de Fusariumsp., como saprófito no patógeno. La inoculación con Bacillus subtilis presentó una inhibición efectiva (0,01 mg.l-1 i.a en las pruebas in vitro contra Didymella bryoniae, Fusarium oxysporum y F. solani; el fungicida más efectivo contra los 2 primeros fue Tebuconazole-trifloxystrobin, con una DL50 de 0,0116 y 0,0106 mg.l-1 respectivamente; no así contra F. solani, cuyo mayor control fue registrado con procloraz, con DL50 de 0,0042 mg.l-1. Estos resultados contribuyen al reconocimiento de las enfermedades fungosas más importantes en chayote y su perspectiva de control durante el manejo postcosecha de frutos para exportación.

Accumulation of Sellafield-derived radiocarbon ((14)C) in Irish Sea and West of Scotland intertidal shells and sediments.

Science.gov (United States)

Tierney, Kieran M; Muir, Graham K P; Cook, Gordon T; MacKinnon, Gillian; Howe, John A; Heymans, Johanna J; Xu, Sheng

2016-01-01

The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ((14)C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This (14)C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate (14)C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in (14)C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine (14)C-enriched material close to Sellafield. Copyright © 2015 The Authors. Published by Elsevier Ltd.. All rights reserved.

BMAA in shellfish from two Portuguese transitional water bodies suggests the marine dinoflagellate Gymnodinium catenatum as a potential BMAA source.

Science.gov (United States)

Lage, Sandra; Costa, Pedro Reis; Moita, Teresa; Eriksson, Johan; Rasmussen, Ulla; Rydberg, Sara Jonasson

2014-07-01

The neurotoxin β-N-methylamino-l-alanine (BMAA) and its putative role in multiple neurodegenerative diseases have been intensely studied since 2005 when the toxin was discovered to be produced by worldwide-distributed cyanobacterial species inhabiting terrestrial, marine, brackish, and freshwater ecosystems. Recently, BMAA production was also associated with one eukaryotic group, namely, diatoms, raising questions about its production by other phytoplanktonic groups. To test for BMAA bioavailability in ecosystems where abundant phytoplanktonic blooms regularly occur, samples of filter-feeding shellfish were collected in two Portuguese transitional water bodies. BMAA content in cockles (Cerastoderma edule) collected weekly between September and November 2009 from Ria de Aveiro and at least once a month from May to November from Ria Formosa, fluctuated from 0.079±0.055 to 0.354±0.066μg/g DW and from below the limit of detection to 0.434±0.110μg/g DW, respectively. Simultaneously to BMAA occurrence in cockles, paralytic shellfish toxins were detected in shellfish as a result of Gymnodinium catenatum blooms indicating a possible link between this marine dinoflagellate and BMAA production. Moreover, considerable high BMAA levels, 0.457±0.186μg/g DW, were then determined in a laboratory grown culture of G. catenatum. This work reveals for the first time the presence of BMAA in shellfish from Atlantic transitional water bodies and consubstantiate evidences of G. catenatum as one of the main sources of BMAA in these ecosystems. Copyright © 2014 Elsevier B.V. All rights reserved.

Trematode infection modulates cockles biochemical response to climate change.

Science.gov (United States)

Magalhães, Luísa; de Montaudouin, Xavier; Figueira, Etelvina; Freitas, Rosa

2018-05-06

Resulting mainly from atmospheric carbon dioxide (CO 2 ) build-up, seawater temperature rise is among the most important climate change related factors affecting costal marine ecosystems. Global warming will have implications on the water cycle, increasing the risk of heavy rainfalls and consequent freshwater input into the oceans but also increasing the frequency of extreme drought periods with consequent salinity increase. For Europe, by the end of the century, projections describe an increase of CO 2 concentration up to 1120 ppm (corresponding to 0.5 pH unit decrease), an increase in the water temperature up to 4 °C and a higher frequency of heavy precipitation. These changes are likely to impact many biotic interactions, including host-parasite relationships which are particularly dependent on abiotic conditions. In the present study, we tested the hypothesis that the edible cockle, Cerastoderma edule, exposed to different salinity, temperature and pH levels as proxy for climate change, modify the infection success of the trematode parasite Himasthla elongata, with consequences to cockles biochemical performance. The results showed that the cercariae infection success increased with acidification but higher biochemical alterations were observed in infected cockles exposed to all abiotic experimental stressful conditions tested. The present study suggested that changes forecasted by many models may promote the proliferation of the parasites infective stages in many ecosystems leading to enhanced transmission, especially on temperate regions, that will influence the geographical distribution of some diseases and, probably, the survival capacity of infected bivalves. Copyright © 2018 Elsevier B.V. All rights reserved.

Are metallothioneins equally good biomarkers of metal and oxidative stress?

Science.gov (United States)

Figueira, Etelvina; Branco, Diana; Antunes, Sara C; Gonçalves, Fernando; Freitas, Rosa

2012-10-01

Several researchers investigated the induction of metallothioneins (MTs) in the presence of metals, namely Cadmium (Cd). Fewer studies observed the induction of MTs due to oxidizing agents, and literature comparing the sensitivity of MTs to different stressors is even more scarce or even nonexistent. The role of MTs in metal and oxidative stress and thus their use as a stress biomarker, remains to be clearly elucidated. To better understand the role of MTs as a biomarker in Cerastoderma edule, a bivalve widely used as bioindicator, a laboratory assay was conducted aiming to assess the sensitivity of MTs to metal and oxidative stressors. For this purpose, Cd was used to induce metal stress, whereas hydrogen peroxide (H2O2), being an oxidizing compound, was used to impose oxidative stress. Results showed that induction of MTs occurred at very different levels in metal and oxidative stress. In the presence of the oxidizing agent (H2O2), MTs only increased significantly when the degree of oxidative stress was very high, and mortality rates were higher than 50 percent. On the contrary, C. edule survived to all Cd concentrations used and significant MTs increases, compared to the control, were observed in all Cd exposures. The present work also revealed that the number of ions and the metal bound to MTs varied with the exposure conditions. In the absence of disturbance, MTs bound most (60-70 percent) of the essential metals (Zn and Cu) in solution. In stressful situations, such as the exposure to Cd and H2O2, MTs did not bind to Cu and bound less to Zn. When organisms were exposed to Cd, the total number of ions bound per MT molecule did not change, compared to control. However the sort of ions bound per MT molecule differed; part of the Zn and all Cu ions where displaced by Cd ions. For organisms exposed to H2O2, each MT molecule bound less than half of the ions compared to control and Cd conditions, which indicates a partial oxidation of thiol groups in the cysteine

Shellfish Fishery Severely Reduces Condition and Survival of Oystercatchers Despite Creation of Large Marine Protected Areas

Directory of Open Access Journals (Sweden)

Simon Verhulst

2004-06-01

Full Text Available Fisheries and other human activities pose a global threat to the marine environment. Marine protected areas (MPAs are an emerging tool to cope with such threats. In the Dutch Wadden Sea, large MPAs (covering 31% of all intertidal flats have been created to protect shellfish-eating birds and allow recovery of important habitats. Even though shellfish fishing is prohibited in these areas, populations of shellfish-eating birds in the Wadden Sea have declined sharply. The role of shellfish fisheries in these declines is hotly debated, therefore, we investigated the effectiveness of MPAs for protecting oystercatcher (Haematopus ostralegus populations. Shellfish stocks (cockles, Cerastoderma edule were substantially higher in the MPAs, but surprisingly this has not resulted in a redistribution of wintering oystercatchers. Oystercatchers in unprotected areas had less shellfish in their diet and lower condition (a combined measure of mass and haematological parameters, and their estimated mortality was 43% higher. It is likely, therefore, that shellfish fishing explains at least part of the 40% decline in oystercatcher numbers in recent years. Condition and mortality effects were strongest in males, and the population sex ratio was female biased, in agreement with the fact that males rely more on shellfish. The unprotected areas apparently function as an "ecological trap," because oystercatchers did not respond as anticipated to the artificial spatial heterogeneity in food supply. Consequently, the MPAs are effective on a local scale, but not on a global scale. Similar problems are likely to exist in terrestrial ecosystems, and distribution strategies of target species need to be considered when designing terrestrial and marine protected areas if they are to be effective.

West and East

Directory of Open Access Journals (Sweden)

Alexander Rappaport

2017-12-01

Full Text Available The topic “West-East” has a clear cultural and historical meaning. Orthodox temples face East. The way from West to East and from East to West is tens of thousands of kilometers long and has a special meaning. It differs from the way from North to South: the horizontal axes connect regions, while the vertical axis (Earth-Sky connects the worlds. The expansion of Eurasian tribes occurred along the East-West axis – the world horizontal way. Today the cultural memory of people in the East and West finds itself in the theatre of new dramas of existence and new forces. With the advances in electronic technologies, the world movements seem to have sunk in the depth of the chthonian past to come up anew to the surface of fantastic speeds and momentary connections. A new type of planetary landscape-space relation appears, giving no place for West and East.

Reproductive investment in the intertidal bivalve Macoma balthica

Science.gov (United States)

Honkoop, P. J. C.; Van der Meer, J.; Beukema, J. J.; Kwast, D.

1999-05-01

Bivalve eggs generally contain large amounts of lipids which, in comparison with proteins and carbohydrates, have high energy contents and are thus costly in energetic terms. As lipid contents vary between species, comparisons of reproductive investments should not only include numbers and sizes of eggs, but also their energy content. We estimated the investment in egg material of mature females of the Baltic tellin Macoma balthica (L.) in terms of both mass and energy content. All mass below a minimum body mass (below which no eggs are produced) was defined as structural mass. This threshold amounts to a body mass index (BMI) of 5.6 (ash-free dry mass per cubic shell length in mg cm -3). More than half (55%) of the mass above the structural mass was invested in egg material and 45% in extra somatic tissue and tissue for production and storage of gametes. This means that the amount of eggs spawned ranged from 0 (at BMI = 5.6 mg cm -3) to 33% of the total ash-free dry mass (at a high BMI value of 14 mg cm -3). Eggs contained a relatively large amount of lipids, about 30% of their ash-free dry mass, whereas non-egg material contained only about 7% lipids. Eggs of two other bivalves in the Wadden Sea, the cockle Cerastoderma edule and the mussel Mytilus edulis, were smaller and contained only about 11% and 20% lipids, respectively. Energy content of M. balthica eggs amounted to ˜0.006 J, in the other two species to ˜0.002 J. The function of the more expensive eggs in M. balthica may be related to its early spawning in spring, causing slower larval development until first feeding.

The East Midlands in 2006: the demography of the East Midlands

OpenAIRE

Lawton, C

2006-01-01

The East Midlands in 2006 is the evidence base that was produced to underpin the devleopment of the regional economic strategy, A Flourishing Region. This document presents detailed analysis of the demography of the East Midlands.

Climatic variability of east Malaysia

International Nuclear Information System (INIS)

Camerlengo, A.L.; Saadon, M.N.; Awang, M.; Somchit, H.; Rang, L.Y.

2001-01-01

The objective of this paper is to learn the variability of atmospheric pressure, relative humidity and insolation in East Malaysia. The main results of our study are: (1) a gentle pressure gradient is observed at the east coast in the boreal winter, (2) smaller atmospheric pressure values are noted during the first inter-monsoon period all across East Malaysia, (3) lesser insolation values are observed in Sarawak and at the east coast during the boreal winter as compared to the boreal summer, and (4) a poleward increase of insolation is registered. (author)

East African Medical Journal

African Journals Online (AJOL)

The East African Medical Journal is intended for publication of papers on ... research on problems relevant to East Africa and other African countries will receive special ... Analysis of survival patterns of TB‐HIV co‐infected patients in relation to ...

Pathways to an East Asian Higher Education Area: A Comparative Analysis of East Asian and European Regionalization Processes

Science.gov (United States)

Chao, Roger Y., Jr.

2014-01-01

The Author argues that historical regional developments in Europe and East Asia greatly influence the formation of an East Asian Higher Education Area. As such, this article compares European and East Asian regionalization and higher education regionalization processes to show this path dependency in East Asian regionalization of higher education…

Genetic diversity of Diaphorina citri and its endosymbionts across east and south-east Asia.

Science.gov (United States)

Wang, Yanjing; Xu, Changbao; Tian, Mingyi; Deng, Xiaoling; Cen, Yijing; He, Yurong

2017-10-01

Diaphorina citri is the vector of 'Candidatus Liberibacter asiaticus', the most widespread pathogen associated huanglongbing, the most serious disease of citrus. To enhance our understanding of the distribution and origin of the psyllid, we investigated the genetic diversity and population structures of 24 populations in Asia and one from Florida based on the mtCOI gene. Simultaneously, genetic diversity and population structures of the primary endosymbiont (P-endosymbiont) 'Candidatus Carsonella ruddii' and secondary endosymbiont (S-endosymbiont) 'Candidatus Profftella armatura' of D. citri were determined with the housekeeping genes. AMOVA analysis indicated that populations of D. citri and its endosymbionts in east and south-east Asia were genetically distinct from populations in Pakistan and Florida. Furthermore, P-endosymbiont populations displayed a strong geographical structure across east and south-east Asia, while low genetic diversity indicated the absence of genetic structure among the populations of D. citri and its S-endosymbiont across these regions. The 'Ca. C. ruddii' is more diverse and structured than the D. citri and the 'Ca. P. armatura' across east and south-east Asia. Multiple introductions of the psyllid have occurred in China. Management application for controlling the pest is proposed based on the genetic information of D. citri and its endosymbionts. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

Impact of anthropogenic aerosols from global, East Asian, and non-East Asian sources on East Asian summer monsoon system

Science.gov (United States)

Wang, Qiuyan; Wang, Zhili; Zhang, Hua

2017-01-01

The impact of the total effects due to anthropogenic aerosols from global, East Asian, and non-East Asian sources on East Asian summer monsoon (EASM) system is studied using an aerosol-climate online model BCC_AGCM2.0.1_CUACE/Aero. The results show that the summer mean net all-sky shortwave fluxes averaged over East Asian monsoon region (EAMR) at the top of the atmosphere (TOA) and surface reduce by 4.8 and 5.0 W m- 2, respectively, due to the increases of global aerosol emissions in 2000 relative to 1850. Changes in radiations and their resulting changes in heat and water transport and cloud fraction contribute together to the surface cooling over EAMR in summer. The increases in global anthropogenic aerosols lead to a decrease of 2.1 K in summer mean surface temperature and an increase of 0.4 hPa in summer mean surface pressure averaged over EAMR, respectively. It is shown that the changes in surface temperature and pressure are significantly larger over land than ocean, thus decreasing the contrast of land-sea surface temperature and pressure. This results in the marked anomalies of north and northeast winds over eastern and southern China and the surrounding oceans in summer, thereby weakening the EASM. The summer mean precipitation averaged over the EAMR reduces by 12%. The changes in non-East Asian aerosol emissions play a more important role in inducing the changes of local temperature and pressure, and thus significantly exacerbate the weakness of the EASM circulation due to local aerosol changes. The weakening of circulation due to both is comparable, and even the effect of non-local aerosols is larger in individual regions. The changes of local and non-local aerosols contribute comparably to the reductions in precipitation over oceans, whereas cause opposite changes over eastern China. Our results highlight the importance of aerosol changes outside East Asia in the impact of the changes of anthropogenic aerosols on EASM.

Simulated East-west differences in F-region peak electron density at Far East mid-latitude region

Science.gov (United States)

Ren, Z.; Wan, W.

2017-12-01

In the present work, using Three-Dimensional Theoretical Ionospheric Model of the Earth in Institute of Geology and Geophysics, Chinese Academy of Sciences (TIME3D-IGGCAS), we simulated the east-west differences in Fregion peak electron density (NmF2) at Far East mid-latitude region.We found that, after removing the longitudinal variations of neutral parameters, TIME3D-IGGCAS can better represent the observed relative east-west difference (Rew) features. Rew is mainly negative (West NmF2 > East NmF2) at noon and positive (East NmF2 >West NmF2) at evening-night. The magnitude of daytime negative Rew is weak at local winter and strong at local summer, and the daytime Rew show two negative peaks around two equinoxes. With the increasing of solar flux level, the magnitude of Rew mainly become larger, and two daytime negative peaks slight shifts to June Solstice. With the decreasing of geographical latitude, Rew mainly become positive, and two daytime negative peaks slight shifts to June Solstice. Our simulation also suggested that the thermospheric zonal wind combined with the geomagnetic field configuration play a pivotal role in the formation of the ionospheric east-west differences at Far East midlatitude region.

ISSN 2073 ISSN 2073-9990 East Cent. East Cent. East Cent. Afr. J.

African Journals Online (AJOL)

DELL

East and Central African Journal of Surgery. ... collaboration in the writing and editing of Surgical Care at the District Hospital, ... increasing availability of computers and huge developments in software technology such ... Emergency Surgery ...

Ecology of megabenthic bivalve communities from sandy beaches on the south coast of Portugal

Directory of Open Access Journals (Sweden)

Marta M. Rufino

2010-03-01

Cardiidae (except Acanthocardia tuberculata and Cerastoderma edule included mostly species occurring in deeper waters. Bathymetric sequence of species distribution within some families was observed.

Accumulation of Sellafield-derived radiocarbon ("1"4C) in Irish Sea and West of Scotland intertidal shells and sediments

International Nuclear Information System (INIS)

Tierney, Kieran M.; Muir, Graham K.P.; Cook, Gordon T.; MacKinnon, Gillian; Howe, John A.; Heymans, Johanna J.; Xu, Sheng

2016-01-01

The nuclear energy industry produces radioactive waste at various stages of the fuel cycle. In the United Kingdom, spent fuel is reprocessed at the Sellafield facility in Cumbria on the North West coast of England. Waste generated at the site comprises a wide range of radionuclides including radiocarbon ("1"4C) which is disposed of in various forms including highly soluble inorganic carbon within the low level liquid radioactive effluent, via pipelines into the Irish Sea. This "1"4C is rapidly incorporated into the dissolved inorganic carbon (DIC) reservoir and marine calcifying organisms, e.g. molluscs, readily utilise DIC for shell formation. This study investigated a number of sites located in Irish Sea and West of Scotland intertidal zones. Results indicate "1"4C enrichment above ambient background levels in shell material at least as far as Port Appin, 265 km north of Sellafield. Of the commonly found species (blue mussel (Mytilus edulis), common cockle (Cerastoderma edule) and common periwinkle (Littorina littorea)), mussels were found to be the most highly enriched in "1"4C due to the surface environment they inhabit and their feeding behaviour. Whole mussel shell activities appear to have been decreasing in response to reduced discharge activities since the early 2000s but in contrast, there is evidence of continuing enrichment of the carbonate sediment component due to in-situ shell erosion, as well as indications of particle transport of fine "1"4C-enriched material close to Sellafield. - Highlights: • We measure "1"4C activity in shells and sediment at sites on the UK west coast. • Mussel shell activity varies in response to average "1"4C discharges from Sellafield. • Shell activities reflect species feeding habits and ecological niche. • NE Irish Sea inorganic sediment activity will gradually increase. • Increases in sediment activity will occur at remote sites on the Scottish west coast.

The human alimentary tract transfer and body retention of environmental polonium-210

International Nuclear Information System (INIS)

Hunt, G J; Rumney, H S

2007-01-01

This paper presents the results of a 4 year study to investigate the human alimentary tract transfer factor (f A value) and body retention of 210 Po in shellfish. In the first 3 years, mussels (Mytilus edulis L.), cockles (Cerastoderma edule L.) and brown meat from crab (Cancer pagurus L.) were successively studied. In each year five volunteers (from a pool of seven) ate a suitable portion of the shellfish and provided 24 h samples of excreta usually for 3 days before and for at least 7 days during and after eating. Subsamples of shellfish were analysed to determine the intakes of 210 Po. Faeces were analysed and the data used to assess apparent f A values. Urine samples were analysed in the mussel and crab studies to provide urinary excretion parameters. Pb-210 was also analysed during the mussel study; the levels were low, leading to large uncertainties, but confirming the negligible effect of radioactive decay to its granddaughter 210 Po in the main study. In the fourth year, larger samples of brown crab meat were eaten by five volunteers and faecal samples were taken at suitable times over periods of up to 43 days to study body retention of 210 Po. The first ∼7 days provided additional data on f A values. Pooled results for the apparent f A for the whole study lay in the range 0.15-0.65 with a mean of 0.46; corrections for endogenous excretion suggest a true f A value of ∼0.51, supporting the value of 0.5 currently used by the International Commission on Radiological Protection (ICRP). The retention data suggest a biological half-time of about 40 days, in broad consistency with the 50 days currently used by the ICRP. Thus there is no strong evidence from this study suggesting a change in dose coefficient for 210 Po. Full experimental data are provided to allow independent further interpretation

Multiscale patterns in the diversity and organization of benthic intertidal fauna among French Atlantic estuaries

Science.gov (United States)

Blanchet, Hugues; Gouillieux, Benoît; Alizier, Sandrine; Amouroux, Jean-Michel; Bachelet, Guy; Barillé, Anne-Laure; Dauvin, Jean-Claude; de Montaudouin, Xavier; Derolez, Valérie; Desroy, Nicolas; Grall, Jacques; Grémare, Antoine; Hacquebart, Pascal; Jourde, Jérôme; Labrune, Céline; Lavesque, Nicolas; Meirland, Alain; Nebout, Thiebaut; Olivier, Frédéric; Pelaprat, Corine; Ruellet, Thierry; Sauriau, Pierre-Guy; Thorin, Sébastien

2014-07-01

Based on a parallel sampling conducted during autumn 2008, a comparative study of the intertidal benthic macrofauna among 10 estuarine systems located along the Channel and Atlantic coasts of France was performed in order to assess the level of fauna similarity among these sites and to identify possible environmental factors involved in the observed pattern at both large (among sites) and smaller (benthic assemblages) scales. More precisely this study focused on unraveling the observed pattern of intertidal benthic fauna composition and diversity observed at among-site scale by exploring both biotic and abiotic factors acting at the among- and within-site scales. Results showed a limited level of similarity at the among-site level in terms of intertidal benthic fauna composition and diversity. The observed pattern did not fit with existing transitional water classification methods based on fish or benthic assemblages developed in the frame of the European Water Framework Directive (WFD). More particularly, the coastal plain estuaries displayed higher among-site similarity compared to ria systems. These coastal plain estuaries were characterized by higher influence of river discharge, lower communication with the ocean and high suspended particulate matter levels. On the other hand, the ria-type systems were more dissimilar and different from the coastal plain estuaries. The level of similarity among estuaries was mainly linked to the relative extent of the intertidal "Scrobicularia plana-Cerastoderma edule" and "Tellina tenuis" or "Venus" communities as a possible consequence of salinity regime, suspended matter concentrations and fine particles supply with consequences on the trophic functioning, structure and organization of benthic fauna. Despite biogeographical patterns, the results also suggest that, in the context of the WFD, these estuaries should only be compared on the basis of the most common intertidal habitat occurring throughout all estuarine systems

Middle East - future perspectives

International Nuclear Information System (INIS)

Lior, Y.

1997-01-01

Facts concerning the basic features of Tlatelolco Treaty are discussed in comparison with the Middle East situation which is described as a special case. Countries in the Middle East should attain political, social and ideological maturity necessary for the adoption of negotiating strategies suitable for this particular region

Middle East Respiratory Syndrome

Centers for Disease Control (CDC) Podcasts

2014-07-07

This podcast discusses Middle East Respiratory Syndrome, or MERS, a viral respiratory illness caused by Middle East Respiratory Syndrome Coronavirus—MERS-CoV.  Created: 7/7/2014 by National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 7/7/2014.

Middle East Respiratory Syndrome (MERS)

Science.gov (United States)

Middle East Respiratory Syndrome Coronavirus; MERS-CoV; Novel coronavirus; nCoV ... for Disease Control and Prevention website. Middle East Respiratory Syndrome (MERS): Frequently asked questions and answers. www. ...

The Upper Miocene of the Rostov Dome (Eastern Paratethys: Implication of the chronostratigraphy and bivalvia-based biostratigraphy

Directory of Open Access Journals (Sweden)

Ruban Dmitry A.

2005-01-01

Full Text Available The Rostov Dome is located in the south of the Russian Platform. In the Late Miocene this area was embraced by the Eastern Paratethys. The implications of a recently developed Neogene chronostratigraphy to the studied area are discussed. The Sarmatian regional stage corresponds to the upper part of the Langhian, the entire Serravalian and the lower part of the Tortonian global stages; the Maeotian regional stage corresponds to the upper part of the Tortonian and the lowermost horizons of the Messinian global stages; the Pontian regional stage corresponds to most of the Messinian and the lowermost Zanclean global stages. A first Bivalvia-based bio-stratigraphic framework is proposed for the territory of the Rostov Dome. Five biozones were established within the Serravalian-Messinian: Tapes vitalianus, Cerastoderma fittoni-Cerastoderma subfittoni, Congeria panticapaea, Congeria amygdaloides navicula and Monodacna pseudocatillus-Prosodacna schirvanica.

Scopus: Journal of East African Ornithology

African Journals Online (AJOL)

Scopus: Journal of East African Ornithology has been published since 1977 by the Bird Committee of the East Africa Natural History Society. Originally titled Scopus, the addition of Journal of East African Ornithology began with our January 2018 issue. The journal is published Open Access twice a year, typically in January ...

Funding problems threaten Middle East's synchrotron

CERN Multimedia

McCabe, H

1999-01-01

Scientists will tour the Middle East to try to raise support for the Synchrotron radiation for Experimental Science and Applications in the Middle East project. The plan is to dismantle and move a decommissioned synchrotron from Berlin to the Middle East where scientists of any nationality would be able to use it (3 paragraphs).

Middle East and North African Oil.

Science.gov (United States)

Al-Quazzaz, Ayad

1981-01-01

Traces the history of oil and natural gas in the Middle East and relates the importance of the Middle East's current stores of oil to economic development. Information is presented on the relationship of major oil companies and local governments, OPEC, rate of production, and the impact of oil on the societies of the Middle East and North Africa.…

Integration and reintegration in CARIM-East countries

OpenAIRE

STRATAN, Alexandru; SAVELYEVA, Galina; KOTELNIK, Vera; ZAKHAROVA, Svetlana

2013-01-01

CARIM-East: Creating an Observatory of Migration East of Europe Version in other language: Migration Policy Centre CARIM-East Research Report 2013/38 Policy in the field of migrants’ integration is a relatively new task for practically all CARIM-East countries. Integration has an impact upon demography, including the composition and structure of the country’s population, namely gender ratio, mortality, marriage structure, birth rate, ageing etc. While integrating into society migr...

The first-step of EAST remote participation system

Energy Technology Data Exchange (ETDEWEB)

Sun, Xiaoyang, E-mail: xysun@ipp.ac.cn; Ji, Zhenshan; Wang, Feng; Li, Shi; Wang, Yong

2016-11-15

Highlights: • A new design for remote participation system for EAST tokamak is proposed. • Rich Internet Application (RIA) and NoSQL Database was select to implement the system. • Two kind of technique for accessing EPICS PV data remotely through Internet was proposed. - Abstract: The EAST Tokamak at Institute of Plasma Physics Chinese Academy of Sciences (CASIPP) is the first fully-superconducting Tokamak facility. International collaboration can improve the quality and impact of fusion research. It is a key feature for EAST research. During 2014 EAST campaign, more than 60 physicists and experts visited CASIPP and participated in EAST discharging experiment. With an increasing number of collaborations, remote participation becomes important as an economical and effective alternative to traditional way. This paper presents an overview of the first-step development work of the EAST Remote Participation System (EAST RPS). At current stage, the EAST RPS is focused on remote access to engineering data, NoSQL-based data archiving engine, message service and video service.

The first-step of EAST remote participation system

International Nuclear Information System (INIS)

Sun, Xiaoyang; Ji, Zhenshan; Wang, Feng; Li, Shi; Wang, Yong

2016-01-01

Highlights: • A new design for remote participation system for EAST tokamak is proposed. • Rich Internet Application (RIA) and NoSQL Database was select to implement the system. • Two kind of technique for accessing EPICS PV data remotely through Internet was proposed. - Abstract: The EAST Tokamak at Institute of Plasma Physics Chinese Academy of Sciences (CASIPP) is the first fully-superconducting Tokamak facility. International collaboration can improve the quality and impact of fusion research. It is a key feature for EAST research. During 2014 EAST campaign, more than 60 physicists and experts visited CASIPP and participated in EAST discharging experiment. With an increasing number of collaborations, remote participation becomes important as an economical and effective alternative to traditional way. This paper presents an overview of the first-step development work of the EAST Remote Participation System (EAST RPS). At current stage, the EAST RPS is focused on remote access to engineering data, NoSQL-based data archiving engine, message service and video service.

Biogas - Bioenergy potential in East Africa

International Nuclear Information System (INIS)

1997-01-01

The workshop is part of the project: 'Energy production from Sisal Waste in East Africa' sponsored by the Danish Energy Agency, an agency under the Danish Ministry of Environment and Energy. This project has been carried out in close cooperation between the Danish Technological Institute and University of Dar es Salaam, Applied Microbiology Unit, who has also taken care of the practical arrangement. The main objectives of the workshop was: To present the ongoing research in East Africa on biogas production from organic residues; To get an overview of political and administrative issues related to promotion and implementation of renewable energy facilities in East Africa; To discuss appropriate set-ups for bioenergy facilities in East Africa. (au)

Biogas - Bioenergy potential in East Africa

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

The workshop is part of the project: `Energy production from Sisal Waste in East Africa` sponsored by the Danish Energy Agency, an agency under the Danish Ministry of Environment and Energy. This project has been carried out in close cooperation between the Danish Technological Institute and University of Dar es Salaam, Applied Microbiology Unit, who has also taken care of the practical arrangement. The main objectives of the workshop was: To present the ongoing research in East Africa on biogas production from organic residues; To get an overview of political and administrative issues related to promotion and implementation of renewable energy facilities in East Africa; To discuss appropriate set-ups for bioenergy facilities in East Africa. (au)

Biogas - Bioenergy potential in East Africa

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

The workshop is part of the project: `Energy production from Sisal Waste in East Africa` sponsored by the Danish Energy Agency, an agency under the Danish Ministry of Environment and Energy. This project has been carried out in close cooperation between the Danish Technological Institute and University of Dar es Salaam, Applied Microbiology Unit, who has also taken care of the practical arrangement. The main objectives of the workshop was: To present the ongoing research in East Africa on biogas production from organic residues; To get an overview of political and administrative issues related to promotion and implementation of renewable energy facilities in East Africa; To discuss appropriate set-ups for bioenergy facilities in East Africa. (au)

Leukaemia in East Suffolk

International Nuclear Information System (INIS)

Bush, M.F.H.

1983-09-01

An investigation was conducted by the East Suffolk Health Authority to determine whether there were any geographical variations in the incidence of leukaemia over the last fifteen years in East Suffolk suggesting an environmental hazard, e.g. Sizewell Power Station. No areas were found to have a statistically significant increased incidence of leukaemia cases although there did appear to be a cluster of cases in the Leiston area. (U.K.)

East Greenland Caledonides: stratigraphy, structure and geochronology: Lower Palaeozoic stratigraphy of the East Greenland Caledonides

Directory of Open Access Journals (Sweden)

Smith, M. Paul

2004-12-01

Full Text Available The Lower Palaeozoic stratigraphy of the East Greenland Caledonides, from the fjord region of North-East Greenland northwards to Kronprins Christian Land, is reviewed and a number of new lithostratigraphical units are proposed. The Slottet Formation (new is a Lower Cambrian quartzite unit, containing Skolithos burrows, that is present in the Målebjerg and Eleonore Sø tectonic windows, in the nunatak region of North-East Greenland. The unit is the source of common and often-reported glacial erratic boulders containing Skolithos that are distributed throughout the fjord region. The Målebjerg Formation (new overlies the Slottet Formation in the tectonic windows, and comprises limestones and dolostones of assumed Cambrian–Ordovician age. The Lower Palaeozoic succession of the fjord region of East Greenland (dominantly limestones and dolostones is formally placed in the Kong Oscar Fjord Group (new. Amendments are proposed for several existing units in the Kronprins Christian Land and Lambert Land areas, where they occur in autochthonous, parautochthonous and allochthonous settings.

A nuclear-weapon-free Middle East

International Nuclear Information System (INIS)

Jortner, Joshua

1986-01-01

The paper examines the issue of nuclear-weapon States involvement in regional conflicts, and whether such a conflict in the Middle East could trigger a nuclear war between the Super-Powers. Comments on the Middle Eastern situation are given, along with a discussion of the Non-Proliferation Treaty (NPT) and the Middle East, Israel and the NPT, and the nuclear potential in Arab countries. The proposal, by Israel, of a nuclear weapon-free zone in the Middle East is outlined. (UK)

The Danish East India Company

DEFF Research Database (Denmark)

Sørensen, Karsten Engsig

2005-01-01

The article analysis the first Danish East India Company incorporated in 1616, which was the first Danish Stock Company and which has impacts even on modern Danish company la......The article analysis the first Danish East India Company incorporated in 1616, which was the first Danish Stock Company and which has impacts even on modern Danish company la...

Comité Scientifique de la Revue des Sciences et de la Technologie ...

African Journals Online (AJOL)

MICROSIM

croissance du mollusque Cerastoderma glaucum dans trois stations sur les berges (profondeur < 1.50 m) de la lagune Mellah. .... biométriques, peut être ramenée à la loi d'allométrie ..... Ces densités élevées dans ce secteur seraient en.

The genus Cuscuta L. in East Asia

Directory of Open Access Journals (Sweden)

E. V. Aistova

2015-07-01

Full Text Available On the basis of published data, herbarium collections  and  our  own  research  the  overview  of  the spread  of  7  dodder  species  (genus  Cuscuta  on  the territory of  of the Russian Far East and East Asia is given. The  history  of  research  dodders  on  the  territory  of  the Russian Far East, ecological and spreading peculiarities are described. Certain eurytopic species (C. campestris Yunck., C. japonica Choisy and C. europaea L. growing on the territory of the Russian Far East have plasticity and  rapid  adaptive  response  for  changing  ecological and  geographical  conditions.  C.  epilinum  Weihe, C. epithymum (L. Nathh., C. tinei Insenga have not been naturalized in the Russian Far East.

Regional Integration: A Political Federation of the East African ...

African Journals Online (AJOL)

The aim of this paper is to explore the possibility and viability of an East African political federation project. Since the late 1800s under the then British East Africa, the countries of East Africa have been searching for ways to integrate. The search led to the establishment of the East African Community (EAC) in December ...

Soccer: Moulding the Middle East and North Africa

OpenAIRE

Dorsey, J.M.

2016-01-01

Nowhere in the world has sports in general and soccer in particular played such a key role in the development of a region than in the Middle East and North Africa. Yet, the nexus of sports, politics and society is one area that Middle East studies with few exceptions have ignored. Similarly, sports studies have focused on all parts of the world with one exception: the Middle East and North Africa. Nonetheless, sports and particularly soccer has been in various parts of the Middle East key to ...

East Asian Values Surveys : making a case for East Asian-origin values survey concepts

OpenAIRE

Vinken, Henk

2006-01-01

This paper aims to contribute to social scientific work towards enhancing the cultural fit of comparative values surveys projects on a conceptual level both for Western and East Asian survey research communities and their publics. It starts with noting that, after a long period in which Western values were regarded superior ('orientalism'), in recent decades certain East Asian and specifically Confucian values are much celebrated ('reversed orientalism'). Yet, most contemporary cross-cultural...

World review: Middle East

International Nuclear Information System (INIS)

Anon.

2000-01-01

The article gives information on contracts announced (and to whom) and recently completed in some parts of the Middle East in the petroleum, natural gas and petrochemicals industries. Areas specifically mentioned are Bahrain, Egypt, Iran, Libya, Oman, Qatar, Saudi Arabia, Syria and the United Arab Emirates. The prospects for the petrochemical industry in particular are good and continued growth is expected. Gas is likely to make an increasingly important contribution to the prosperity of the Middle East and is expected to carry a higher priority than expansion of crude oil production

Выборы как предвестник перемен / Айн Тоотс

Index Scriptorium Estoniae

Тоотс, Айн, 1944-

2009-01-01

Kohalike omavalitsuste volikogude valimiste tulemustest. Endise Tallinna linnapea Hardo Aasmäe sõnul võib Keskerakonna võit kohalikel valimistel sillutada teed Edgar Savisaare edule 2011. a. presidendivalimistel

East African Journal of Statistics: Journal Sponsorship

African Journals Online (AJOL)

East African Journal of Statistics: Journal Sponsorship. Journal Home > About the Journal > East African Journal of Statistics: Journal Sponsorship. Log in or Register to get access to full text downloads.

Nuclear power in East Asia

International Nuclear Information System (INIS)

Abelson, P.H.

1996-01-01

This editorial discusses the shifting dominance in the nuclear reactor technology from the USA to new leadership in East Asia. With the expanding economies and electricity demand, Design, construction and operation of a large number of nuclear power plants in east Asia will support nuclear engineers, technologist, manufacturing facilities, and potential weapons experts. In contrast, the cessation of construction of power reactors in the US is leading to deminished nuclear capabilities

Russia And East Asia: New Opportunities And Challenges

Directory of Open Access Journals (Sweden)

Anna A. Kireeva

2014-01-01

Full Text Available The article focuses on major dimensions, achievements, challenges and prospects of relations between Russia and East Asia. Strategic importance of the region is shaped by East Asia's increasing role in world politics and economy as well as by its appeal for Russia's modernization agenda. Russia's great power status rests upon the effectiveness of its East Asian policy and development model of Siberia and the Russian Far East. Russia's positions in East Asia have improved substantially over the 2000s. However, its involvement in regional economic interaction is still insignificant and Russia cannot be regarded as a full-fledged regional player in this domain. Russian-Chinese strategic partnership has been the axis of Russia's East Asian foreign policy, though overdependence on China threatens Russia's independent policy in the region and encourages Russia to search for ways to diversify its ties. Russia's national interests reside in multivector policy, aimed at developing substantive relations not only with China but also with Japan, South Korea, ASEAN (Vietnam in the first place and India along with Russia's involvement in the resolution of Korean nuclear crisis. The rise of China and the US counter-offensive have resulted in a changing strategic environment in East Asia. A need for balancing between the US and China has brought about ASEAN countries' desire to welcome Russia as a "balancer" or an "honest player" in the region. It corresponds with Russia's course on playing a greater role in regional cooperation and integration. Russia's improving ties in political, economic, energy and security dimensions have the potential to contribute to the stability of the emerging polycentric regional order in East Asia and development of Russia's regions of Siberia and the Far East.

RUSSIA AND EAST ASIA: NEW OPPORTUNITIES AND CHALLENGES

Directory of Open Access Journals (Sweden)

Anna A. Kireeva

2014-01-01

Full Text Available The article focuses on major dimensions, achievements, challenges and prospects of relations between Russia and East Asia. Strategic importance of the region is shaped by East Asia's increasing role in world politics and economy as well as by its appeal for Russia's modernization agenda. Russia's great power status rests upon the effectiveness of its East Asian policy and development model of Siberia and the Russian Far East. Russia's positions in East Asia have improved substantially over the 2000s. However, its involvement in regional economic interaction is still insignificant and Russia cannot be regarded as a full-fledged regional player in this domain. Russian-Chinese strategic partnership has been the axis of Russia's East Asian foreign policy, though overdependence on China threatens Russia's independent policy in the region and encourages Russia to search for ways to diversify its ties. Russia's national interests reside in multivector policy, aimed at developing substantive relations not only with China but also with Japan, South Korea, ASEAN (Vietnam in the first place and India along with Russia's involvement in the resolution of Korean nuclear crisis. The rise of China and the US counter-offensive have resulted in a changing strategic environment in East Asia. A need for balancing between the US and China has brought about ASEAN countries' desire to welcome Russia as a "balancer" or an "honest player" in the region. It corresponds with Russia's course on playing a greater role in regional cooperation and integration. Russia's improving ties in political, economic, energy and security dimensions have the potential to contribute to the stability of the emerging polycentric regional order in East Asia and development of Russia's regions of Siberia and the Far East.

Trade Liberalization between Russia and East Asian Countries

Directory of Open Access Journals (Sweden)

Dmitriy Aleksandrovich Izotov

2015-12-01

Full Text Available Based on the international statistics data the author estimates effects of trade liberalization between Russia and East Asian countries. The prospective niche markets in mutual trade and the impact of trade liberalization on the national economies were identified. Using a partial equilibrium model the author indicates the following positive trade effects for Russia and East Asia: trade creation effect prevails over trade diversion effect; general welfare and mutual trade of the countries tend to increase. The Russian economy has positive trade effects with all the East Asian countries, with the highest scale in the case of Sino-Russian trade. At the same time trade liberalization has following some costs for the Russian economy: a the growing role of imports, mostly from China, compared to Russian exports; b reduction of tariff revenues, which are four times higher for Russia, compared to East Asian countries; c continued negative trade balance with the East Asian countries. The evaluation shows that the increase of Russian exports to East Asian countries is feasible only for certain commodity groups which determine marketable niches of specific East Asian countries; at the same time, Russia can import from East Asia a huge range of commodity groups. The study reveals that reduction in tariff measures and non- tariff restrictions will not lead to a massive increase in Russian exports and changing in its trade and geographical structure. On the basis of prolongation of short-term trends the author identifies long-term challenges and opportunities for the Russian economy from trade liberalization with East Asian countries. According to the estimation results, the author suggests that in the current environment of global trade liberalization the tariff measures become less significant as a tool for redistribution of commodity flows

Proceedings of the French Senate conference 'Going Nuclear in the Middle East - In search of an European Middle East policy'

International Nuclear Information System (INIS)

Larcher, G.; De Rohan, J.; Malley, R.; Francois-Poncet, J.; Boroumand, L.; Cordesman, A.H.; Alani, M.; Hourcade, B.; Cerisier-ben Guiga, M.; Shihabi, M.; Singh, M.; Siegman, H.; Aubin De La Messuziere, Y.; Boillon, B.; Yasseen, F.; Barzani, M.; Chouet, A.; Filiu, J.P.; Heisbourg, F.; Giuliani, J.D.; Asseburg, M.; Spencer, C.; Solana Madagaria, J.

2010-01-01

The Middle East today is quite clearly one of the global hotspots of the world. It is also a big challenge for the international community. The interests are due to geography, history, economics and also to the fact that what takes place in the Middle East is important for the security of rest of the world. These two days of conference organised by the French Senate took stock of the Middle East question through 6 round tables dealing with: 1 - General overview Nuclear Islam in the Middle East; 2 - How likely is a successful dialogue with Iran? 3 - What Future for the Palestinian People? 4 - 2010, A Renaissance for Iraq? 5 - The Latest on Al Qaeda? 6 - In search of a European Union Policy for the Middle East. This document gathers the talks of the different experts and the questions and answers from the participants. (J.S.)

Pazopanib Maintenance Therapy in East Asian Women With Advanced Epithelial Ovarian Cancer: Results From AGO-OVAR16 and an East Asian Study.

Science.gov (United States)

Kim, Jae-Weon; Mahner, Sven; Wu, Ling-Ying; Shoji, Tadahiro; Kim, Byoung-Gie; Zhu, Jian-Qing; Takano, Tadao; Park, Sang-Yoon; Kong, Bei-Hua; Wu, Qiang; Wang, Kung-Liahng; Ngan, Hextan Ys; Liu, Ji-Hong; Wei, Li-Hui; Mitrica, Ionel; Zhang, Pingkuan; Crescenzo, Rocco; Wang, Qiong; Cox, Charles J; Harter, Philipp; du Bois, Andreas

2018-01-01

The recent phase 3 trial AGO-OVAR16 demonstrated that pazopanib maintenance improved median progression-free survival in patients with ovarian cancer whose disease did not progress during first-line treatment. However, this improvement was not seen in the subset of East Asian patients. The current analysis evaluated the efficacy and safety of pazopanib maintenance in East Asian patients from AGO-OVAR16 and a separate East Asian study. East Asian patients from AGO-OVAR16 (n = 209) and the East Asian study (N = 145) were randomized 1:1 to receive pazopanib 800 mg/d or placebo for up to 24 months. The primary end point for each study was progression-free survival by RECIST (Response Evaluation Criteria in Solid Tumors) based on investigator assessment. Clinical and genetics data were analyzed separately by study or pooled according to separate predetermined statistical plans. Pazopanib maintenance had a detrimental effect on median progression-free survival versus placebo in East Asian patients from the combined studies (n = 354; 17.9 vs 21.5 months; hazard ratio, 1.114; 95% confidence interval, 0.818-1.518; P = 0.4928). Pazopanib maintenance showed a disadvantage in overall survival in East Asian patients from AGO-OVAR16 versus placebo (hazard ratio, 1.706; 95% confidence interval, 1.010-2.883; P = 0.0465); overall survival analysis was not performed in the East Asian study because of insufficient event numbers. Pazopanib-treated patients had a significantly higher incidence of grade 3 or higher hypertension (27%) and neutropenia (13%) versus placebo. The treatment effect of maintenance pazopanib in East Asian patients seemed to differ from that in non-Asian patients. In study-specific and pooled analyses, none of the potential factors analyzed could satisfactorily explain the different efficacy results of pazopanib in East Asian patients.

Analysis of EAST tokamak cryostat anti-seismic performance

International Nuclear Information System (INIS)

Chen Wei; Kong Xiaoling; Liu Sumei; Ni Xiaojun; Wang Zhongwei

2014-01-01

A 3-D finite element model for EAST tokamak cryostat is established by using ANSYS. On the basis of the modal analysis, the seismic response of the EAST tokamak cryostat structure is calculated according to an input of the design seismic response spectrum referring to code for seismic design of nuclear power plants. Calculation results show that EAST cryostat displacement and stress response is small under the action of earthquake. According to the standards, EAST tokamak cryostat structure under the action of design seismic can meet the requirements of anti-seismic design intensity, and ensure the anti-seismic safety of equipment. (authors)

Transitional processes and the role of cities in east and South-East Europe

Directory of Open Access Journals (Sweden)

Stojkov Borislav

2014-01-01

Full Text Available The cities of Eastern and South East Europe, passing through dynamic and uncertain processes of social, economic and political transition, are being confronted with serious challenges in relation to more stabilized cities of Central and, especially, Western Europe. The former policy of centralization is faced with political, administrative and economic changes, as well as with aspirations towards decentralization, regionalization and polycentrism. The confronted tendencies still dominantly influence to the level of Eastern and South East cities' competitiveness. This urgently asks for orientation towards functional positioning of cities within wider metropolitan and regional frameworks. Another crucial orientation is presented by initial tendencies of metropolitan areas linking or networking in wider regional context. Both tendencies indicate the crucial problem of city governance quality level, according to contemporary criteria instead classical and hierarchical model of executing governmental power. Some examples of cities in Eastern and South East Europe are presented in the article, as well as of some cities in Central Europe where initial phase of transition has been completed.

Middle East natural gas - getting it to markets

International Nuclear Information System (INIS)

Skinner, R.

1996-01-01

Middle East gas reserves, production, and consumption were presented graphically, along with the demand for 'piped' or liquefied natural gas in the Middle East itself, in Asia and in Europe. The European gas market outlook was examined, taking into account economic growth, EEC restructuring, crude oil prices and their effects on net-backs, deregulation and competitive grid-based energy, upstream and midstream investments under conditions of price uncertainty, and environmental and social influences. Middle East pipeline proposals (17 projects) for a total of 34,943 kilometres of pipeline, were reviewed. The general conclusion was that (1) the Middle East has lots of gas, (2) both Asia and Europe will be substantial markets for Middle East LNG despite the 'tyranny of distance', and (3) pipelines to these markets will be built in the longer-term. tabs., figs

Journal of East African Natural History

African Journals Online (AJOL)

The Journal of East African Natural History is published jointly by the East Africa Natural History Society and the National Museums of Kenya. The Journal publishes papers and notes in the field of natural history, broadly defined as the study of organisms in their natural state, relevant to the eastern African region.

Multinationals and East Asian Integration | IDRC - International ...

International Development Research Centre (IDRC) Digital Library (Canada)

... and the United States, in the recent and rapid economic growth and integration in East Asia. ... "dragons" of East Asia have emerged among the world's leading economic powers. ... Asian outlook: New growth dependent on new productivity.

East Asian Studies of Tropospheric Aerosols and their Impact on Regional Climate (EAST -AIRC): An overview

Science.gov (United States)

Zhangqing, Li; Li, C.; Chen, H.; Tsay, S.-C.; Holben, B.; Huang, J.; Li, B.; Maring, H.; Qian, Y.; Shi, G.;

East African rarities committee report | Fisher | Scopus: Journal of ...

African Journals Online (AJOL)

East African Rarities Committee (EARC) Special Report Species included for East African countries in Britton (1980) which have since been considered unacceptable. East African Rarities Committee Report 2013–2015. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

West-East migration in Germany since 1990

OpenAIRE

Beck, Grit

2011-01-01

Not only did 2.5 million people migrate from East Germany to West Germany between 1991 and 2006, 1.5 million people also moved from West to East Germany. This counter-current movement took placed largely unnoticed by the public and researchers alike. This paper uses both quantitative and qualitative data to first of all examine how the population structure in the New Länder has changed as a result of interregional migration between Länder in East and West Germany. It goes on to study the moti...

East Asian perspective on global environmental problems

International Nuclear Information System (INIS)

Yonehara, M.

1995-01-01

The Central Research Institute of Electric Power Industry has been conducting active global warming research programs focusing on development of a method to forecast climate change accompanying global warming both globally and in East Asia. A regional climate change forecasting method is being developed and researches are conducted on impacts of climate change on the natural and social environment in East Asia. Researches are also conducted focusing on the relationship between emissions and deposition of acid substances and assessment of the environmental impacts of acid rain in East Asia. 4 figs

The role of the East Asian active margin in widespread extensional and strike-slip deformation in East Asia

NARCIS (Netherlands)

Schellart, Wouter P.; Lister, G. S.

2005-01-01

East Asia is a region of widespread deformation, dominated by normal and strike-slip faults. Deformation has been interpreted to result from extrusion tectonics related to the India-Eurasia collision, which started in the Early Eocene. In East and SE China, however, deformation started earlier than

JPRS Report, East Europe

National Research Council Canada - National Science Library

1988-01-01

Partial Contents: East Europe, Party Activities, Socialist Party, Freedom Fighters, Education, Youth Training, Historian, Death Penalty, Peace Making Duties, Socialism, Communism, Economics, Restructuring...

Massive job cuts threaten East German science

CERN Multimedia

Hamer, M

1990-01-01

German reunification could result in thousands of scientists losing their jobs. At the end of this year the East German state budget for science will run out. Scientists in the East are keen to find Western support to protect their research (1 page).

Manufacture of EAST VS In-Vessel Coil

International Nuclear Information System (INIS)

Long, Feng; Wu, Yu; Du, Shijun; Jin, Huan; Yu, Min; Han, Qiyang; Wan, Jiansheng; Liu, Bin; Qiao, Jingchun; Liu, Xiaochuan; Li, Chang; Cai, Denggang; Tong, Yunhua

2013-01-01

Highlights: • ITER like Stainless Steel Mineral Insulation Conductor (SSMIC) used for EAST Tokamak VS In-Vessel Coil manufacture first time. • Research on SSMIC fabrication was introduced in detail. • Two sets totally four single-turn VS coils were manufactured and installed in place symmetrically above and below the mid-plane in the vacuum vessel of EAST. • The manufacture and inspection of the EAST VS coil especially the joint for the SSMIC connection was described in detail. • The insulation resistances of all the VS coils have no significant reduction after endurance test. -- Abstract: In the ongoing latest update round of EAST (Experimental Advanced Superconducting Tokamak), two sets of two single-turn Vertical Stabilization (VS) coils were manufactured and installed symmetrically above and below the mid-plane in the vacuum vessel of EAST. The Stainless Steel Mineral Insulated Conductor (SSMIC) developed for ITER In-Vessel Coils (IVCs) in Institute of Plasma Physics, Chinese Academy of Science (ASIPP) was used for the EAST VS coils manufacture. Each turn poloidal field VS coil includes three internal joints in the vacuum vessel. The middle joint connects two pieces of conductor which together form an R2.3 m arc segment inside the vacuum vessel. The other two joints connect the arc segment with the two feeders near the port along the toroidal direction to bear lower electromagnetic loads during operation. Main processes and tests include material performances checking, conductor fabrication, joint connection and testing, coil forming, insulation performances measurement were described herein

Crustal evolution in north-east and east Africa from model Nd ages

International Nuclear Information System (INIS)

Harris, N.B.W.; Hawkesworth, C.J.; Ries, A.C.

1984-01-01

The authors present the results of an Nd isotope study on the major rock units of the Pan-African (1,100-500 Myr BP) terrane. Charnockites from Jabel Uweinat, a basement inlier at the junction of Egypt, Libya and the Sudan, yield middle Archaean model Nd ages, whilst model ages of < 1,200 Myr have been obtained in a belt from the Eastern Desert of Egypt to north-west Kenya. Overall, the Pan-African rocks from north-east and east Africa and those from the Damara of Namibia exhibit a wide range of epsilonsub(Nd)(T) from +7.5 to -18.0 which reflects regional changes in tectonic style and is not readily reconciled with simple models for the evolution of average continental crust. (author)

East Capital suunab investorid Venemaale / Gert Tiivas ; interv. Raivo Sormunen

Index Scriptorium Estoniae

Tiivas, Gert, 1973-

2007-01-01

Rootsi investeerimispanga East Capitali Balti regiooni juht Gert Tiivas soovitab investeerida Baltimaadest suurema potentsiaaliga riikide börsidele. Vt. samas: CV: Gert Tiivas; East Capitali fondid. Diagramm: East Capitali Venemaa fondis on enim raha

In search of East Asian self-enhancement.

Science.gov (United States)

Heine, Steven J; Hamamura, Takeshi

2007-02-01

A meta-analysis of published cross-cultural studies of self-enhancement reveals pervasive and pronounced differences between East Asians and Westerners. Across 91 comparisons, the average cross-cultural effect was d = .84. The effect emerged in all 30 methods, except for comparisons of implicit self-esteem. Within cultures, Westerners showed a clear self-serving bias (d = .87), whereas East Asians did not (d = -.01), with Asian Americans falling in between (d = .52). East Asians did self-enhance in the methods that involved comparing themselves to average but were self-critical in other methods. It was hypothesized that this inconsistency could be explained in that these methods are compromised by the "everyone is better than their group's average effect" (EBTA). Supporting this rationale, studies that were implicated by the EBTA reported significantly larger self-enhancement effect for all cultures compared to other studies. Overall, the evidence converges to show that East Asians do not self-enhance.

Peculiarities of transformation processes in East Germany

Directory of Open Access Journals (Sweden)

Marion Dathe

2011-03-01

Full Text Available The process of socio-economic transformation of East German lands after the German reunification in 1990 is analyzed, the term "transformation" in frames of planned and market economies is defined. The author studies the historical determinants of the transformation process in Germany. German economic and industrial history in context of the driving forces and their social values, as well as the properties of the planning and economic systems that underlie the transformation of East German mentality, are considered. Further analysis is connected with economic, social and political components of the East German transformation process, "the dominance of the West", the collapse of the Council for Mutual Economic Assistance, privatization etc. Finally, the outcome of already traversed path of transformation of East Germany is considered. It is concluded, that the transformation process is not only historically conditioned situations of both the merging parties in the case of Germany, but also the positive or negative perception of its results and the motivation for its further implementation.

Current status of the East Sea Ecosystem in a changing world

Science.gov (United States)

Lee, Sang Heon; Kang, Chang-Keun; Lee, Chung IL; Kwak, Jung Hyun

2017-12-01

The East/Japan Sea (hereafter the East Sea) is changing quickly. Warming and structural changes in the East Sea have been reported by CREAMS, an acronym of ″Circulation Research of the East Asian Marginal Seas″, which began in 1993 as an international research program to understand the water mass structure and circulation in the East Sea (Kim and Kim, 1996; Kim, 1997; Kim et al., 2001, 2002). A subsequent research program of the EAST-I, an acronym of ″the East Asian Seas Time-series″, was launched by PICES (North Pacific Marine Science Organization) and financially supported by the Korean government, allowing us to deepen our knowledge about rapidly changing processes in the East Sea (Chang et al., 2010). Although there has been considerable progress in developing a mechanistic understanding of the East Sea ecosystem responses to disturbances, more comprehensive studies are needed to address the impacts of the frequency and intensity of disturbances on marine ecosystems. The most important question of the research has been: how do environmental changes affect structural and functional biodiversity? Recently launched research on ″Long-term change of structure and function in marine ecosystems of Korea″, which has been supported by the Korean government since 2011, has given an unprecedented insight into the ecosystem dynamics in the East Sea. It therefore seems an appropriate time to devote a special issue to the topic of ″Current status of the East Sea ecosystem in a changing world″.

Interdecadal variations of East Asian summer monsoon northward propagation and influences on summer precipitation over East China

Science.gov (United States)

Jiang, Z.; Yang, S.; He, J.; Li, J.; Liang, J.

2008-08-01

The interdecadal variation of northward propagation of the East Asian Summer Monsoon (EASM) and summer precipitation in East China have been investigated using daily surface rainfall from a dense rain gauge network in China for 1957 2001, National Center for Environmental Prediction/National Center for Atmospheric Research (NCEP/NCAR) reanalysis, European Center for Medium-Range Weather Forecast (ECMWF) reanalysis, and Global Mean Sea Level Pressure Dataset (GMSLP2) from Climatic Research Unit (CRU). Results in general show a consistent agreement on the interdecadal variability of EASM northward propagations. However, it appears that the interdecadal variation is stronger in NCEP than in ECMWF and CRU datasets. A newly defined normalized precipitation index (NPI), a 5-day running mean rainfall normalized with its standard deviation, clearly depicts the characteristics of summer rainbelt activities in East China in terms of jumps and durations during its northward propagations. The EASM northward propagation shows a prominent interdecadal variation. EASM before late 1970s had a rapid northward advance and a northern edge beyond its normal position. As a result, more summer rainfall occurred for the North China rainy season, Huaihe-River Mei-Yu, and South China Mei-Yu. In contrast, EASM after late 1970s had a slow northward movement and a northern edge located south of its normal position. Less summer precipitation occurred in East China except in Yangtze River basin. The EASM northernmost position (ENP), northernmost intensity (ENI), and EASM have a complex and good relationship at interdecadal timescales. They have significant influences on interdecadal variation of the large-scale precipitation anomalies in East China.

Scopus: Journal of East African Ornithology: Journal Sponsorship

African Journals Online (AJOL)

Scopus: Journal of East African Ornithology: Journal Sponsorship. Journal Home > About the Journal > Scopus: Journal of East African Ornithology: Journal Sponsorship. Log in or Register to get access to full text downloads.

East African Journal of Public Health: Journal Sponsorship

African Journals Online (AJOL)

East African Journal of Public Health: Journal Sponsorship. Journal Home > About the Journal > East African Journal of Public Health: Journal Sponsorship. Log in or Register to get access to full text downloads.

Monetary Cooperation in East Asia: Major Issues and Future Prospects

Directory of Open Access Journals (Sweden)

Jai-Won Ryou

2004-06-01

Full Text Available The Asian currency crisis in 1997 and the launch of the euro in 1999 made the possibility and desirability of introducing a regional currency union in East Asia a point of debate. At present, the empirical findings and policy implications of previous studies are mixed. We are still in need of theoretical and empirical studies that capture the salient features of East Asia, and give us reliable recommendations for incentive structures, configurations and policy instruments in monetary cooperation in its various stages. This paper aims to review major conceptual and empirical issues relevant to monetary cooperation in East Asia, including proposals for a regional cooperative framework for exchange rate stability or forming a currency union in the region. East Asian countries have no experience with any type of monetary cooperation and all we have are hypothetical predictions. Nevertheless, East Asian countries may be on the brink of an historical evolution to economic and monetary integration, as Europe was half a century ago. The progressive integration of markets in East Asia has conferred a commonality of economic interest upon the countries in the region. As the economic structures of East Asian countries converge with one another through closer ties of trade, investment and finance, the necessity for monetary cooperation will be more likely to emerge in the future. Monetary cooperation in East Asia will be a long process. East Asian countries should make efforts to build collective institutions in the beginning.

Potential of Fishing Port Development in the East Java

Science.gov (United States)

Rosana, N.; Prasita, V. D.

2018-03-01

The development of fishing ports in East Java is one of efforts to increase the province revenue, develop the fishing industry and to improve the welfare of fishermen. Profile of capture fisheries in East Java should be provide information that can be developed based on priorities and types of resources. The purpose of this study was to determine several districts in East Java which is a priority for the development of fishing ports based on the potential that exists. The method used is descriptive and spatial analysis in order to obtain an overview of the districts in East Java that has the potential to be developed. Results of the study is the districts in East Java are priorities for the development of fishing ports based on aspects related to the fishery is Banyuwangi, Trenggalek and Jember.

Medicinal Plants from Near East for Cancer Therapy

Science.gov (United States)

Abu-Darwish, Mohammad S.; Efferth, Thomas

2018-01-01

Background: Cancer is one of the major problems affecting public health worldwide. As other cultures, the populations of the Near East rely on medicinal herbs and their preparations to fight cancer. Methods: We compiled data derived from historical ethnopharmacological information as well as in vitro and in vivo results and clinical findings extracted from different literature databases including (PubMed, Scopus, Web of Science, and Google Scholar) during the past two decades. Results: In this survey, we analyzed the huge amount of data available on anticancer ethnopharmacological sources used in the Near East. Medicinal herbs are the most dominant ethnopharmacological formula used among cancer’s patients in the Near East. The data obtained highlight for the first time the most commonly used medicinal plants in the Near East area for cancer treatment illustrating their importance as natural anticancer agents. The literature survey reveals that various Arum species, various Artemisia species, Calotropis procera, Citrullus colocynthis, Nigella sativa, Pulicaria crispa, various Urtica species, Withania somnifera, and others belong to the most frequently used plants among cancer patients in the Near East countries. Molecular modes of action that have been investigated for plant extracts and isolated compounds from Near East include cell cycle arrest and apoptosis induction with participation of major player in these processes such as p53 and p21, Bcl-2, Bax, cytochrome c release, poly (ADP-ribose) polymerase cleavage, activation of caspases, etc. Conclusion: The ethnopharmacology of the Near East was influenced by Arabic and Islamic medicine and might be promising for developing new natural and safe anticancer agents. Further research is required to elucidate their cellular and molecular mechanisms and to estimate their clinical activity. PMID:29445343

Networks model of the East Turkistan terrorism

Science.gov (United States)

Li, Ben-xian; Zhu, Jun-fang; Wang, Shun-guo

2015-02-01

The presence of the East Turkistan terrorist network in China can be traced back to the rebellions on the BAREN region in Xinjiang in April 1990. This article intends to research the East Turkistan networks in China and offer a panoramic view. The events, terrorists and their relationship are described using matrices. Then social network analysis is adopted to reveal the network type and the network structure characteristics. We also find the crucial terrorist leader. Ultimately, some results show that the East Turkistan network has big hub nodes and small shortest path, and that the network follows a pattern of small world network with hierarchical structure.

Archives: East and Central African Journal of Surgery

African Journals Online (AJOL)

Items 1 - 40 of 40 ... Archives: East and Central African Journal of Surgery. Journal Home > Archives: East and Central African Journal of Surgery. Log in or Register to get access to full text downloads.

A New Paradigm for Higher Education and Culture in East Asia

Science.gov (United States)

Lee, Jeong-Kyu

2006-01-01

This article explores how cultural identity reveals itself in East Asian higher education. The following questions are addressed. First, what is culture and what is the characteristic of East Asian culture? Second, what are cultural situations of East Asian higher education? Third, how does the cultural identity of East Asia reveal itself in…

Technical diagnosis system for EAST tokamak

International Nuclear Information System (INIS)

Qian Jing; Weng, P.D.; Luo, J.R.; Chen, Z.M.; Wu, Y.

2010-01-01

Technical diagnosis system (TDS) is one of the important subsystems of EAST (experimental advanced superconducting tokamak) device, main function of which is to monitor status parameters in EAST device. Those status parameters include temperature of different positions of main components, resistance of each superconducting (SC) coils, joint resistance of SC coils and high-temperature superconducting (HTS) current leads, strain of cold-quality components endured force, and displacement and current of toroidal field (TF) coils in EAST device, which are analog input signals. In addition there are still some analog and digital output signals. The TDS monitors all of those signals in the period of EAST experiments. TDS data monitoring is described in detail for it plays important role during EAST campaign. And how to protect the SC magnet system during each plasma discharging is presented with data of temperature of coolant inlet and outlet of SC coils and feeders and cases of the TF coils and temperature in the upper and middle and bottom of the TF coil case. During construction of the TDS primary difficulties come from installation of Lakeshore Cernox temperature sensors, strain measurement of central solenoid coils support legs and installation of co-wound voltage sensors for quench detection. While during operation since the first commissioning big challenges are from temperature measurement changes in current leads and quench detection of PF coils. Those difficulties in both stages are introduced which are key to make the TDS reliable. Meanwhile analysis of experimental data like temperature as a back up to testify quench occurrence and stress on vacuum vessel thermal shield and vacuum vessel have also been discussed.

Kultuuritegelaste luhtunud katse ajalugu korrata / Ando Leps

Index Scriptorium Estoniae

Leps, Ando, 1935-

2003-01-01

Kultuuritegelaste pöördumine nelja erakonna poole üritas olla signaaliks nelja partei lähenemisele ja ühisele koostöövandele seista vastu Keskerakonna arvatavale edule Riigikogu valimistel. Võrdlus 1980. aasta 40 kirjaga

Cultural Foundations of Learning: East and West

Science.gov (United States)

Li, Jin

2012-01-01

Western and East Asian people hold fundamentally different beliefs about learning that influence how they approach child rearing and education. Reviewing decades of research, Dr. Jin Li presents an important conceptual distinction between the Western mind model and the East Asian virtue model of learning. The former aims to cultivate the mind to…

Fluxus East / Petra Stegmann

Index Scriptorium Estoniae

Stegmann, Petra

2008-01-01

Näitusest "Fluxus East" Kumu Kunstimuuseumis. Fluxuse liikumisest leedu kunstniku George Maciunase (1931-1978) eestvedamisel. Liikumise ilmingutest Eestis (happeningid, muusikaaktsioonid, visuaalne poeesia, mail art). Kuraator Petra Stegmann, kujundaja Andrea Pichl

A tale of two fjords – en analyse af bundfauna samfund i Odense og Roskilde Fjord

DEFF Research Database (Denmark)

Banta, Gary Thomas; Delefosse, Matthieu; Canal Vergés, Paula

gravende muslinger (f.eks. Cerastoderma spp.) mens Odense Fjord (OF) havde flere orme. Ligeledes så vi mange tubificide orme i den indre del af OF. I den indre del af RF så vi i stedet mange dansemyggelarver (Chironomidae). Af de undersøgte miljøvariable var vanddybde og salinitet (både niveauet og...

Phytogeography of the tropical north-east African mountains

Directory of Open Access Journals (Sweden)

I. Friis

1983-11-01

Full Text Available The tropical north-east African mountains are tentatively divided into four phytochoria, the formal rank of which is not defined. The division is based on patterns of distribution and endemism in the region. The recognition of a distinct Afromontane phytochorion is now well established (Chapman & White, 1970; Werger, 1978; White, 1978. However, there is still very little information on the phytogeography of the individual mountains or mountain systems. This study hopes to fill a little of the gap by analysing distribution patterns and patterns of endemism in the flora of the tropical north-east African mountains. The north-east African mountain system is the largest in tropical Africa (see e.g. map in White, 1978. At the core of this system is the large Ethiopian massif, around which are located various mountains and mountain chains. These include the Red Sea Hills in the Sudan, the mountain chain in northern Somalia, the south-west Arabian mountains, and the Imatong mountains of south-east Sudan. The latter are often referred to the East African mountain system (White, 1978 but. as I will point out later, they also have a close connection with the south-west highlands of Ethiopia. The paper presents some results of my study of the mountain flora of tropical north-east Africa, particularly the forest species. Where no source is indicated, the data are from my own unpublished studies.

Development and Implementation of the Collaboratory on EAST

International Nuclear Information System (INIS)

Zhang Mingxin; Luo Jiarong; Li Guiming; Wang Hua; Cheng Ting

2006-01-01

The collaboratory for the EAST is available, which possesses the capacity to further advance active research on EAST. In doing so, the distance between local researchers and participators over the world is just a click away. To feature the system with the function of remote control, the functional business logic is all encapsulated in the mandatory controls, which can potentially boost the computing capability of the clients with a B/S framework. At the same time, the EAST collaboratory embraces powerful on-line data exchange and data management functions via state-of-the-art XML Web services. With the goal of accessing and analysing the pivotal experimental data on-line, a data analysis system is implemented in JAVA. Finally as a valuable asset of the EAST collaboratory the function of videoconference will be also covered in this contribution

The latest development of EAST neutral beam injector

International Nuclear Information System (INIS)

Hu Chundong; Xu Yongjian

2014-01-01

As the first full superconducting non-circular cross section Tokomak in the world, EAST is used to explore the forefront physics and engineering issues on the construction of Tokomak fusion reactor. Neutral beam injection has been recognized as one of the most effective means for plasma heating. According to the research plan of the EAST physics experiment, a set of neutral beam injector (4∼8 MW, 10∼100 s)will be built and operational in 2014. The paper presents the latest development of EAST neutral beam injector and the latest experiment results of long pulse beam extraction and high power beam extraction are reported, those results show that all targets reach or almost reach the design targets. All these will lay a solid foundation for the achievement of plasma heating and current drive for EAST in 2014. (authors)

EAST ICRF system for long pulse operation

International Nuclear Information System (INIS)

Zhao, Y.P.; Zhang, X.J.; Mao, Y.Z.

2013-01-01

Radio frequency (RF) power in the ion cyclotron range of frequencies (ICRF) is one of the primary auxiliary heating techniques for Experimental Advanced Superconducting Tokamak (EAST). A 6.0 MW ICRF systems in the range of 25-70 MHz has been put into operation during the EAST 2012 spring campaign. The ICRF systems consist of two port-mounted antennas and each antenna is driven by two independent 1.5 MW RF power source. Another four 1.5 MW ICRF system is under way of construction.The system will deliver more than 10 MW of RF power to the plasma for 1000 sec pulse length. This paper gives brief introduction of the ICRF systems capability on EAST. (author)

EAST AFRICAN MEDICAL JOURNAL

African Journals Online (AJOL)

2003-11-11

Nov 11, 2003 ... East African Medical Journal Vol. ... Lecturer/Consultant Surgeon, Paediatric Surgery Unit, Department of Surgery, College of Medical Sciences, University of Calabar, .... mind and the results obtained were however satisfying.

Multiple Sclerosis Epidemiology in East Asia, South East Asia and South Asia: A Systematic Review.

Science.gov (United States)

Eskandarieh, Sharareh; Heydarpour, Pouria; Minagar, Alireza; Pourmand, Shadi; Sahraian, Mohammad Ali

2016-01-01

Multiple sclerosis (MS) is one of the most common chronic immune-mediated diseases of the human central nervous system and an important cause of non-traumatic neurologic disability among young population in several countries. Recent reports from East Asia, South East Asia and South Asia have proposed a low to moderate prevalence of MS in these countries. A literature review search was carried out in December 2014 in Medline, Embase, Scopus and Cochrane library to recover original population-based studies on MS epidemiology in East Asia, South East Asia and South Asia countries published between January 1, 1950 and December 30, 2014. We intended search strategies using the key words: multiple sclerosis, prevalence, incidence and epidemiology. Based on our inclusion criteria, 68 epidemiologic studies were included in this systematic review. The most extensively used diagnostic criteria in the studies were McDonald's criteria. Most studies were performed in a multi-center hospital setting. The female to male ratio varied and ranged from 0.7 in India to 9.0 in China. The mean age at disease onset ranged from the lowest age of 25.3 in Iran to the highest age of 46.4 in China. MS prevalence ranged from 0.77 in 100,000 populations in Hong Kong (1999) to 85.80 in 100,000 in Iran (2013). Advances in MS registries around the globe allow nationwide population-based studies and will allow worldly comparisons between the prevalence and incidence in different regions that are provided to monitor estimation. © 2016 S. Karger AG, Basel.

Forecasting of Currency Crises in East Asia

Directory of Open Access Journals (Sweden)

Chi-Young Song

2005-06-01

Full Text Available In this paper, we have developed a forecasting system for currency crisis in East Asia based on a signaling approach. Our system uses 15 monthly indicators of five East Asian countries including Indonesia, Korea, Malaysia, the Philippines and Thailand that were severely hit by the currency crisis in 1997. We investigate the performance of the system through deploying out-of-sample forecasting for the periods both before and after the 1997 East Asian currency crisis. Unlike the existing research based on the signaling approach, our out-of-sample forecasting does not fix the in-sample period. The out-of-sample forecasting between July 1995 and June 1997 shows that prior to breakout of the crisis, several indicators including real exchange rates and exports sent frequent warnings to all crisis-hit East Asian countries except the Philippines. This may indicate that a signaling-based early warning system for currency crisis could have been an useful method of forecasting the East Asian crisis. On the other hand, we also find that our forecasting system often generates warning signals during the out-of-sample period between July 1999 and June 2001. Since we have not observed any currency crisis in this region after 1998, these are all false alarms, indicating that our system may be seriously exposed to the type II error. We can, however, mitigate this problem if we adjust the optimal critical values of indicators depending on the preferences of forecasting system manager.

East and Central African Journal of Surgery: Contact

African Journals Online (AJOL)

Principal Contact. Prof. Ignatius Kakande Editor-in-Chief Association of Surgeons of East Africa. East and Central African Journal of Surgery. P.O. Box 7051. Kampala. Uganda. Alternative email: igkakande@gmail.com. Phone: +256 772 501 745. Email: ecajs@gmail.com ...

Stable isotopic composition of East African lake waters

International Nuclear Information System (INIS)

Odada, E.O.

2001-01-01

The investigation of stable isotopic composition of East African lake waters was conducted by scientists from the Department of Geology, University of Nairobi, as part of the International Decade for the East African Lakes (IDEAL) project and in close collaboration with the scientists from Large Lakes Observatory of the University of Minnesota and the Isotope Hydrology Laboratory of the IAEA in Vienna. The Research Contract was part of the IAEA Co-ordinated Research Programme on Isotope Techniques in Lake Dynamics Investigations, and was sponsored by the Agency. Water and grab sediment samples were obtained from East African Lakes during the month of January and February 1994 and July/August 1995. Water samples were analysed for oxygen and deuterium isotopic composition at the IAEA Laboratories in Vienna, Austria. In this final paper we report the results of the study of oxygen and deuterium isotopic composition from the East African lake waters. (author)

Cold war, quantum foundations, and East-West collaboration

Energy Technology Data Exchange (ETDEWEB)

Skaar-Jacobsen, Anja [Niels Bohr Archive, Copenhagen (Germany)

2011-07-01

It is well-known that the cultural cold war changed the ideological line in the Soviet Union from the late 1940s and that this had serious implications for the autonomy of research in genetics and quantum foundations in the East bloc. However, besides the more narrow concern from the point of view of research in quantum foundations, I suggest that the ideological impact on quantum foundations also constituted an obstacle for attempts by Western physicists to bring about a rapprochement between physics in the east and west in general. In connection with re-establishing East-West co-operation between physicists after Stalin's death in 1953 this obstacle needed to be cleared away. In my talk I discuss these issues and how the Institute for Theoretical Physics in Copenhagen came to be an important meeting place for physicists from the East and West from the mid-1950s.

GIS based application tool -- history of East India Company

Science.gov (United States)

Phophaliya, Sudhir

The emphasis of the thesis is to build an intuitive and robust GIS (Geographic Information systems) Tool which gives an in depth information on history of East India Company. The GIS tool also incorporates various achievements of East India Company which helped to establish their business all over world especially India. The user has the option to select these movements and acts by clicking on any of the marked states on the World map. The World Map also incorporates key features for East India Company like landing of East India Company in India, Darjeeling Tea Establishment, East India Company Stock Redemption Act etc. The user can know more about these features simply by clicking on each of them. The primary focus of the tool is to give the user a unique insight about East India Company; for this the tool has several HTML (Hypertext markup language) pages which the user can select. These HTML pages give information on various topics like the first Voyage, Trade with China, 1857 Revolt etc. The tool has been developed in JAVA. For the Indian map MOJO (Map Objects Java Objects) is used. MOJO is developed by ESRI. The major features shown on the World map was designed using MOJO. MOJO made it easy to incorporate the statistical data with these features. The user interface was intentionally kept simple and easy to use. To keep the user engaged, key aspects are explained using HTML pages. The idea is that pictures will help the user garner interest in the history of East India Company.

East Asia basin Analysis Project

International Nuclear Information System (INIS)

Terman, M.J.

1986-01-01

The United Nations-related Committee for Coordination of Joint Prospecting for Mineral Resources in Asian Offshore Areas (CCOP), in cooperation with the International Union of Geological Sciences and Circum-Pacific Council, is implementing the East Asia Basin Analysis Project. National and regional organizations, principally members of the ASEAN Council of Petroleum, are compiling maps at a scale of 1:2 million and stratigraphic cross sections of basins, with particular initial emphasis on defining and assessing oil and gas plays and with later analytical focus on other sedimentary minerals (e.g., coal, phosphate, evaporites, and uranium). Completion is anticipated in 1988. Two major elements of the project are being contributed from other agencies. (1) Base maps. - The US Geological Survey (USGS) has partly compiled eight sheets covering east Asia that show bathymetry, shorelines, and drainage systems. One sheet also presents topography and selected cultural features. All sheets are scheduled to be completed in 1987. (2) Geotectonic maps. - The Working Group on Studies of East Asian Tectonics and Resources (SEATAR) is now completing 10 transect studies with crustal profiles and strip maps at a scale of 1:1 million. One map for each transect shows a plate tectonic interpretation. Transect coordinators or others will be encouraged to extrapolate between the strips and complete the geotectonic interpretation (on USGS bases) in 1987. The IGCP Project 220 is also compiling on (USGS bases) the tin and tungsten granites of east Asia, emphasizing geochemical data needed to identify predictive models. Other mapping will probably follow mineral-deposit modeling workshops on ophiolotic chromite and regional symposia on oceanic massive sulfide and subvolcanic gold and base metals. Completion may be possible by 1989

Far East Asia | Page 67 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Far East Asia. Extrême-Orient. Read more about Environmental Degradation, Social Marginalization and the Dynamics of Vulnerability in the Earthquake of October 2005 (Pakistan). Language English. Read more about Promoting Trade in Services in the Middle East and North Africa : Pilot Project. Language English.

Second phase of the extension of ASEAN: East Timor case

Directory of Open Access Journals (Sweden)

Maricela Reyes López

2013-01-01

Full Text Available East Timor, the newly independent and small country of the Southeast Asia applies to join ASEAN. ASEAN members debate pro and con arguments on that admission. Vietnam, Lao and Cambodia are pro because they are beneficiary countries in economic terms trough ASEAN. Also, they ....the integration of all countries of the region, including East Timor, will be improve in a meaningful way the political and economic stability in the region. Today government officials, analysts and academics are debating on the Association of South East Asian Nations (ASEAN enlargement to admit East Timor as the eleventh member. East Timor recently declared independence and could benefit regionally just now as favorable factors are improving its economy and political position. Pro and con arguments of such membership represent more than an individual vote from the region’s friendly governments. A positive consensus will mean certain effects in the region and beyond it. This paper discusses arguments of several actors concerning the acceptance of East Timor into the ASEAN and its regional implications.

Development of Europe's gas hubs: Implications for East Asia

Directory of Open Access Journals (Sweden)

Xunpeng Shi

2016-10-01

Full Text Available Gas trading hubs have been initially developed in the US in 1980s, UK in 1990s, more recently in European in the 2000s and mulled in East Asia now. Due to its freshness and diversification in nationality, governance and culture, the European hub experience can offer valuable lessons for East Asia. This paper seeks to advance understanding of gas hub development in Europe and provide lessons for East Asia. The European experience highlights that market liberalization and transition of gas pricing mechanism are necessary in creating the competitive markets that are needed for functional gas hubs. Political will and regulations further safeguard the competition environment needed for hub development. Natural factors, such as significant domestic production and culture could have a significant impact on the hub development and transition of pricing mechanism. In East Asia, the path to gas trading hubs might be more difficult than in Europe but a growing market creates an opportunity to start new terms with new contracts. Nevertheless, East Asian needs to work hard to development its indigenous gas or LNG trading hubs.

Green chemistry education in the Middle East

Science.gov (United States)

Kolopajlo, Larry

2017-06-01

The Middle East once dominated the age of alchemy, and today it is experiencing a resurgence by transforming the age of petroleum chemicals into a greener science through Estidama. This green conversion is taking place through green chemical research and education. This report examines and reviews the understudied subject of green chemical education in the Middle East through the lens of context and history.

Development of plasma fueling on EAST

International Nuclear Information System (INIS)

Yao, X.J.; Zheng, X.W.; Li, C.Z.; Chen, Y.

2015-01-01

To achieve better plasma density control, experimental advanced superconducting tokamak (EAST) has already equipped with gas puffing (GP), supersonic molecular beam injection (SMBI) and pellet injection (PI). During the past few years, lots of experiments and ameliorations have been done. The performance of the SMBI and gas puffing (GP) feedback systems were used and compared. And the preliminary result of pellet injection was also presented here. The results shows the PI and SMBI were more compatible to the long pulse high density discharge on EAST. (author)

Online Health Search Experience: Sentiments from South East Asia

Directory of Open Access Journals (Sweden)

Anushia Inthiran

2016-12-01

Full Text Available Performing an online health search is a popular activity conducted on the Internet. Research studies from developed countries provide information on source used, type of search performed and devices used to perform the search. However, the same cannot be said about the online health information searching scene in South East Asia. Online health information searching is gaining popularity in South East Asia. Citizens in these countries are turning to the Internet to obtain health information quickly. Current research studies pertaining to online health information searching in South East Asian is limited, particularly relating to search experiences of South East Asian health searchers. Search experience is pertinent asit could deter or encourage the possibility of conducting future health searches. In this research study, a user study was conducted to describe the online search experience of South East Asian health searchers. A face to face interview with 50 participants was conducted. The interview was audio recorded and transcribed verbatim. Results indicate participants have positive and negative search experiences. In some cases, post search outcomes influenced the search experience. Results of this research study contribute to the growing domain of knowledge in relation to online health information searching. Results of this study also provide an understanding pertaining to the search experience of South East Asian online health searchers.

Book Review: Flora of Tropical East Africa | Bytebier | Journal of East ...

African Journals Online (AJOL)

Flora of Tropical East Africa Edited by H.J. Beentje & S.A. Ghazanfar. Polygalaceae by J. Paiva. Kew Publishing, Royal Botanic Gardens, Kew, UK, 2007. ISBN- 978 1 84246 191 4 (softbound). 61 pages. Dryopteridaceae by J.P. Roux, M. Shaffer-Fehre & B. Verdcourt. Kew Publishing, Royal Botanic Gardens, Kew, UK, 2007.

Far East Asia | Page 185 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

In Multinationals and East Asian Integration, leading Asian economists examine the role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia. With examples from China, Hong Kong, Indonesia, Malaysia, the Philippines, Singapore, ...

Far East Asia | Page 184 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

In Multinationals and East Asian Integration, leading Asian economists examine the role of foreign private-sector firms, especially from Japan and the United States, in the recent and rapid economic growth and integration in East Asia. With examples from China, Hong Kong, Indonesia, Malaysia, the Philippines, Singapore, ...

India hiilgav viletsus / Andrei Hvostov

Index Scriptorium Estoniae

Hvostov, Andrei, 1963-

2006-01-01

Hiinat nimetatakse maailma töökojaks, Indiat aga bürooks (back office), võrdlus põhineb India IT-firmade edul - kõik tegevused, mida saab teha arvutite abil, kipuvad kolima Indiasse. Tulevikuriik India on hädas keskaegsete tavadega

Edukaks töö ja arengu kaudu / Ketlin Priilinn

Index Scriptorium Estoniae

Priilinn, Ketlin, 1982-

2005-01-01

Ilmunud ka: Delovõje Vedomosti 2. veebr. lk. 11. TOP-i 2. koht. Ehituse, kaevetööde ja kinnisvaraga tegeleva Malkati Kaubanduse OÜ juhatuse liikme Indrek Puhalaineni sõnul on ettevõtet edule aidanud aktiivne töö. Diagramm

Phenolic Content, and Antioxidant and Antimicrobial Activities of ...

African Journals Online (AJOL)

Erah

Methods: The content of total phenols, flavonoids and anthocyanins of the alcohol, hydroalcohol and aqueous extracts of ... Keywords: Crataegus oxyacantha L.; Natural phenolic compounds; Antioxidant and antimicrobial activity, Southeast Serbia. ..... Antioxidant activities of Sechium edule (Jacq.) Swart extracts, Food ...

East Capitali fondid on pakkunud ülihäid tootlusi / Raigo Neudorf

Index Scriptorium Estoniae

Neudorf, Raigo

2007-01-01

Varahaldusfirma East Capital Baltimaade tegevust juhtiv Gert Tiivas ettevõtte asutamisest kümme aastat tagasi. Erinevalt konkurentidest on East Capital võtnud sihikule just arenevad turud, sh Venemaa ja Baltimaad. Vt. samas: 100 töötaja seas esindatud 24 rahvust; East Capitali fondid on popid Rootsi pensionäride seas. Tabel: East Capitali fondide tootlused

Autumn Cooling of Western East Antarctica Linked to the Tropical Pacific

Science.gov (United States)

Clem, Kyle R.; Renwick, James A.; McGregor, James

2018-01-01

Over the past 60 years, the climate of East Antarctica cooled while portions of West Antarctica were among the most rapidly warming regions on the planet. The East Antarctic cooling is attributed to a positive trend in the Southern Annular Mode (SAM) and a strengthening of the westerlies, while West Antarctic warming is tied to zonally asymmetric circulation changes forced by the tropics. This study finds recent (post-1979) surface cooling of East Antarctica during austral autumn to also be tied to tropical forcing, namely, an increase in La Niña events. The recent increase in La Niña conditions forces a Rossby wave into the Southern Hemisphere that increases anticyclonic circulation over the South Atlantic. The South Atlantic anticyclone is associated with cold air advection, weakened northerlies, and increased sea ice concentrations across the western East Antarctic coast, which has increased the rate of cooling at Novolazarevskaya and Syowa stations after 1979. This enhanced cooling over western East Antarctica is tied more broadly to a zonally asymmetric temperature trend pattern across East Antarctica during autumn that is consistent with a tropically forced Rossby wave rather than a SAM pattern; the positive SAM pattern is associated with ubiquitous cooling across East Antarctica, which is not seen in temperature observations after 1979. We conclude that El Niño-Southern Oscillation-related circulation anomalies, particularly zonal asymmetries that locally enhance meridional wind, are an important component of East Antarctic climate variability during autumn, and future changes in tropical Pacific climate will likely have implications for East Antarctica.

How the food supply harvestable by waders in the Wadden Sea depends on the variation in energy density, body weight, biomass, burying depth and behaviour of tidal-flat invertebrates

Science.gov (United States)

Zwarts, Leo; Wanink, Jan H.

For several reasons, waders in the Wadden Sea face a large seasonal and annual variation in their food supply. Observations on a tidal flat in the Dutch Wadden Sea have shown that: - (1) The average energy density of ten invertebrate prey species varies between 21 and 23 kJ·g -1 AFDW. In Scrobicularia plana and Mya arenaria, but not in Macoma balthica, the energy density is 10% lower in winter than in summer. - (2) Depending on the species, body weights of prey of similar size are 30 to 60% lower in winter than in summer. - (3) The year-to-year fluctuation in standing-crop biomass is larger in some species than in others, the difference depending mainly on the frequency of successful recruitment. The overall biomass of the macrobenthos in winter is half of that in summer, but the timing of the peak biomass differs per species. - (4) The burying depth varies per species: Cerastoderma edule live just beneath the surface, while M. balthica, S. plana, M. arenaria, Arenicola marina and Nereis diversicolor bury more deeply and the majority of these prey live out of reach of the bird's bill. In all six species, burying depth increases with size. There is no seasonal variation in depth of C. edule and M. arenaria, but the four other species live at most shallow depth in early summer and most deeply in midwinter. Burying depths in winter vary from year to year, but are unrelated to temperature. Neither has temperature any effect on depth within months. For knot Calidris canutus feeding on M. balthica, the fluctuation in the accessible fraction was the main source of variation in the biomass of prey that is actually harvestable, i.e. the biomass of prey of suitable size that is accessible. Accordingly, the paper reviews the available data on the temporal variations in accessibility, detectability, ingestibility, digestibility and profitability of prey for waders. Only a small part of the prey is harvestable since many accessible prey are ignored because of their low

Why Do East Asian Children Perform so well in PISA? An Investigation of Western-Born Children of East Asian Descent

Science.gov (United States)

Jerrim, John

2015-01-01

A small group of high-performing East Asian economies dominate the top of the Programme for International Student Assessment (PISA) rankings. This has caught the attention of Western policymakers, who want to know why East Asian children obtain such high PISA scores, and what can be done to replicate their success. In this paper I investigate…

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from Near East/South Asia, Egypt, Libya, Morocco, Tunisia, Israel, Jordan, Lebanon, Syria, Afghanistan, Bangladesh, and Iran contains articles on Political Science, Economics, Regional...

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from Near East/South Asia, Egypt, Libya, Tunisia, Israel, Afghanistan, Bangladesh, Iran, Iraq, and Pakistan contains articles on International, Regional, Political and Economic Issues...

Characterization of HIV Transmission in South-East Austria.

Science.gov (United States)

Hoenigl, Martin; Chaillon, Antoine; Kessler, Harald H; Haas, Bernhard; Stelzl, Evelyn; Weninger, Karin; Little, Susan J; Mehta, Sanjay R

2016-01-01

To gain deeper insight into the epidemiology of HIV-1 transmission in South-East Austria we performed a retrospective analysis of 259 HIV-1 partial pol sequences obtained from unique individuals newly diagnosed with HIV infection in South-East Austria from 2008 through 2014. After quality filtering, putative transmission linkages were inferred when two sequences were ≤1.5% genetically different. Multiple linkages were resolved into putative transmission clusters. Further phylogenetic analyses were performed using BEAST v1.8.1. Finally, we investigated putative links between the 259 sequences from South-East Austria and all publicly available HIV polymerase sequences in the Los Alamos National Laboratory HIV sequence database. We found that 45.6% (118/259) of the sampled sequences were genetically linked with at least one other sequence from South-East Austria forming putative transmission clusters. Clustering individuals were more likely to be men who have sex with men (MSM; pAustria had at least one putative inferred linkage with sequences from a total of 69 other countries. In conclusion, analysis of HIV-1 sequences from newly diagnosed individuals residing in South-East Austria revealed a high degree of national and international clustering mainly within MSM. Interestingly, we found that a high number of heterosexual males clustered within MSM networks, suggesting either linkage between risk groups or misrepresentation of sexual risk behaviors by subjects.

Portulacaria afra in East AFrica | Newton | Journal of East African ...

African Journals Online (AJOL)

No Abstract. East African Journal of Natural History Vol. 96 (1) 2007: pp. 107-108. http://dx.doi.org/10.2982/0012-8317(2007)96[107:PAIEA]2.0.CO;2 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...

East Asian Regionalisms and Korea in the 1940’s

Directory of Open Access Journals (Sweden)

Byong Kwon Song

2014-02-01

Full Text Available This paper seeks to consider the various types of regionalisms in East Asia during the 1940’s, and Korea’s position in the United States’ “Great China Policy” and demilitarization and democratization plans for Japan. After World War II, although aspects of regionalism were formed by the Cold War in East Asia, the regional structure of Northeast Asia was originally formed from the ‘turn of the century’ through the Asian Pacific War. From the beginning of the 1940’s, Japan promoted the idea of a “Greater East Asia Co-prosperity Sphere” in order to justify its hegemonic position in the East Asian regional order. In addition, the United States and Japan’s readjustment plans appeared to be related to strategies regarding the regional order of East Asia. During World War II, the victorious U.S. had already become one of the world’s superpowers and by principle, collaboration between the superpowers (United States, Great Britain, China, and the Soviet Union revealed an initiative for a four country police state. Japan devised a survival strategy in the case of its defeat. During the war in the early 1940’s, these policies and plans were used to recognize Großraum around the East Asian region. This paper points out the significance of the 1940’s and the continuity between the awareness of the wartime situation and the prospective situation during the postwar period. During the 1940’s, three forms of regionalism in East Asia appeared. The first was Japan’s regional hegemony over the East Asian regional order. In order to preserve regional hegemony, Imperial Japan gave specific meaning to Korea as an extension of its own economy. The second is based on the United States as an offshore hegemonic power, which chose China as a subordinate partner within East Asia and used the division of labor through sub-horizontal industry based on an initiative to suppress Japan. In order to weaken the economic dominance of Japanese Empire

Cancer Control Programs in East Asia: Evidence From the International Literature

Directory of Open Access Journals (Sweden)

Malcolm A. Moore

2014-07-01

Full Text Available Cancer is a major cause of mortality and morbidity throughout the world, including the countries of North-East and South-East Asia. Assessment of burden through cancer registration, determination of risk and protective factors, early detection and screening, clinical practice, interventions for example in vaccination, tobacco cessation efforts and palliative care all should be included in comprehensive cancer control programs. The degree to which this is possible naturally depends on the resources available at local, national and international levels. The present review concerns elements of cancer control programs established in China, Taiwan, Korea, and Japan in North-East Asia, Viet Nam, Thailand, Malaysia, and Indonesia as representative larger countries of South-East Asia for comparison, using the published literature as a guide. While major advances have been made, there are still areas which need more attention, especially in South-East Asia, and international cooperation is essential if standard guidelines are to be generated to allow effective cancer control efforts throughout the Far East.

Soccer: Moulding the Middle East and North Africa

NARCIS (Netherlands)

Dorsey, J.M.

2016-01-01

Nowhere in the world has sports in general and soccer in particular played such a key role in the development of a region than in the Middle East and North Africa. Yet, the nexus of sports, politics and society is one area that Middle East studies with few exceptions have ignored. Similarly, sports

The East European Press and Three-Mile Island.

Science.gov (United States)

Johnson, Owen V.

This report of the investigation into East European newspaper treatment of the accident at Pennsylvania's Three Mile Island nuclear power plant in the spring of 1979 focuses on the Czech and Slovak media, particularly on the Slovak Communist Party's daily newspaper, "Pravda." The response of the media of other East European countries to…

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from Near East/South Asia, Algeria, Sudan, Iraq, Israel, Kuwait, Saudi Arabia, Syria, Afghanistan, Bangladesh, India, Iran, and Pakistan, contains articles on Economics, Political Science...

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report contains articles on the Near East/South Asia, Egypt, Mauritania, Morocco, Tunisia, Israel, Jordan, Kuwait, Oman, Saudi Arabia, United Arab Emirates, Afghanistan, Iran and Pakistan...

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from the Near East/South Asia, Algeria, Egypt, Tunisia, Israel, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Afghanistan and Iran, contains articles on International Affairs, Politics...

Detection of phylogenetic extraction of sheep populations in East ...

African Journals Online (AJOL)

USER

2010-06-28

Jun 28, 2010 ... populations in East and South Asia based on fuzzy ... Based on the previous research, according to the Hierarchy clustering, the sheep populations in East and South ... have been known and some data have been obtained,.

Absolute intensity calibration for ECE measurements on EAST

International Nuclear Information System (INIS)

Liu Yong; Liu Xiang; Zhao Hailin

2014-01-01

In this proceeding, the results of the in-situ absolute intensity calibration for ECE measurements on EAST are presented. A 32-channel heterodyne radiometer system and a Michelson interferometer on EAST have been calibrated independently, and preliminary results from plasma operation indicate a good agreement between the electron temperature profiles obtained with different systems. (author)

Journal of East African Natural History: Editorial Policies

African Journals Online (AJOL)

Focus and Scope. The Journal of East African Natural History is published jointly by the East Africa Natural History Society and the National Museums of Kenya. The Journal publishes papers and notes in the field of natural history, broadly defined as the study of organisms in their natural state, relevant to the eastern African ...

The cryogenic control system of EAST

International Nuclear Information System (INIS)

Zhuang, M.; Hu, L.B.; Zhow, Z.W.; Xia, G.H.

2012-01-01

Highlights: ► A reliable and flexible duplex control system is required for cryogenic system. ► The cryogenic control system is based on Delta-V DCS. ► It has been proved to be an effective way to control cryogenic process. ► It will provide useful experience and inspiration for the development in the cryogenic control engineering. - Abstract: A large scale helium cryogenic system is one of the key components for the EAST tokamak device for the cooling of PF and TF coils, structures, thermal shields, buslines, current leads and cryopumps. Since the cooling scheme of the EAST cryogenic system is fairly complicated, a reliable and flexible control system is required for cryogenic system. The cryogenic control system is based on DeltaV DCS which is the process control software developed by Emerson Company. The EAST cryogenic system has been in operation for four years and has been proved to be safe, stable and energy saving by the past 7 experiments. This paper describes the redundant control network, hardware configuration, software structure, auxiliary system and the new development in the future.

Hopeful Chungnam Of The Miracle In The East Sea

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-15

This reports Herbei spirit oil spill incident and overcoming the accident, which includes congratulatory address and the reason of publishing, summary of the Herbei spirit oil spill incident, starting the oil spill, spreading oil and restoration, trouble of creature ecology and fishing industry, the worst pollution and effort to restore and to prevent, public sentiment and executive measurement, volunteer work for prevention, donation, hopeful wave in the east sea, new jump for the clean east sea, report of passion on oil spill incident and culture tour cluster of Chungnam east sea.

Hopeful Chungnam Of The Miracle In The East Sea

International Nuclear Information System (INIS)

2008-07-01

This reports Herbei spirit oil spill incident and overcoming the accident, which includes congratulatory address and the reason of publishing, summary of the Herbei spirit oil spill incident, starting the oil spill, spreading oil and restoration, trouble of creature ecology and fishing industry, the worst pollution and effort to restore and to prevent, public sentiment and executive measurement, volunteer work for prevention, donation, hopeful wave in the east sea, new jump for the clean east sea, report of passion on oil spill incident and culture tour cluster of Chungnam east sea.

Microbial keratitis in West and East Malaysia

OpenAIRE

Vanitha Ratnalingam; Thiageswari Umapathy; Kala Sumugam; Hanida Hanafi; Shamala Retnasabapathy

2017-01-01

AIM: To evaluate the epidemiological and etiological factors of microbial keratitis seen in tertiary hospitals in West and East Malaysia.METHODS: A total of 207 patients were enrolled. Patients referred for microbial keratitis to Sungai Buloh Hospital and Kuala Lumpur Hospital in West Malaysia and Queen Elizabeth Hospital and Kuching General Hospital in East Malaysia were recruited. Risk factors were documented. Corneal scrapings for microscopy and culture were performed.RESULTS: The most com...

Cross-national differences in the holistic use of traditional East Asian medicine in East Asia.

Science.gov (United States)

Shim, Jae-Mahn; Kim, Jibum

2016-12-23

Complementary and alternative medicine (CAM) has been one of the popular strategies for health promotion. Traditional East Asian medicine (TEAM) is one of the most popular CAM practices in the world and there are suggestions that its holistic utilization is important for users to gain its effects for health promotion. In this context, this study investigates the extent to which TEAM users in East Asian countries utilize various modalities of TEAM holistically. It provides a model that explains cross-national differences in the extent of the holistic use of TEAM between China, Japan, Korea and Taiwan. Using the 2010 East Asian Social Survey, regression models specify the relationship between the holistic use of TEAM and the geographical location (country). The presence of TEAM doctors who hold the comprehensive and exclusive practice rights over TEAM is found to be conducive to the holistic utilization of various TEAM modalities. Thus, Taiwanese and Koreans use TEAM more holistically than Chinese and even more so than Japanese. The result suggests that the manner in which TEAM is institutionalized affect the extent to which TEAM users utilize various TEAM modalities together and potentially the health promotion effects of TEAM. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from the Near East/South Asia, Algeria, Egypt, Sudan, Tunisia, Israel, Lebanon, Afghanistan, Bangladesh, Iran and Pakistan, contains articles on Politics, Economics, Regional Affairs and Military Affairs...

At the Crossroads : ICT Policy Making in East Africa | CRDI - Centre ...

International Development Research Centre (IDRC) Digital Library (Canada)

At the Crossroads : ICT Policy Making in East Africa. Couverture du livre At the Crossroads : ICT Policymaking in East Africa. Directeur(s) : Florence Etta et Laurent Elder. Maison(s) d'édition : East African Educational Publishers, CRDI. 1 janvier 2005. ISBN : 9966254390. 336 pages. e-ISBN : 1552502198. Téléchargez le ...

Near East/South Asia Report

National Research Council Canada - National Science Library

1986-01-01

.... This report from the Near East/South Asia, Egypt, Libya, Tunisa, Iraq, Israel, Kuwait, Oman, Saudi Arabia, Syria, United Arab Emirates, Iran and Pakistan, the articles are on Politics, Economics...

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.

African Journals Online (AJOL)

Hp 630 Dual Core

she went abroad to South East Asia to seek better medical care. ... developed deep venous thrombosis and pulmonary thrombo embolism eventually ... lengthy procedures, change in nursing staff during procedures and failure to count surgical ...

Investment, stability and the politics of Middle-East embargoes

International Nuclear Information System (INIS)

Hollis, R.

1996-01-01

This paper reviews the political situation in the Middle East and considers the current level of energy investment in the region. The factors affecting the stability of countries in the Middle East are examined, and the politics of western embargoes is explored. (author)

Real-time virtual EAST physical experiment system

Energy Technology Data Exchange (ETDEWEB)

Li, Dan, E-mail: lidan@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Xiao, B.J., E-mail: bjxiao@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui (China); Xia, J.Y., E-mail: jyxia@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Yang, Fei, E-mail: fyang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Department of Computer Science, Anhui Medical University, Hefei, Anhui (China)

2014-05-15

Graphical abstract: - Highlights: • 3D model of experimental advanced superconducting tokamak is established. • Interaction behavior is created that the users can get information from database. • The system integrates data acquisition, plasma shape visualization and simulation. • Browser-oriented system is web-based and more interactive, immersive and convenient. • The system provides the framework for virtual physical experimental environment. - Abstract: As a large fusion reaction device, experimental advanced superconducting tokamak (EAST)’s internal structure is complicated and not easily accessible. Moreover, various diagnostic systems and complicated configuration bring about the inconveniency to the scientists who are unfamiliar with the system but interested in the data. We propose a virtual system to display the 3D model of EAST facility and enable people to view its inner structure and get access to the information of its components in various view sights. We would also provide most of the diagnostic configuration details together with their signal names and physical properties. Compared to the previous ways of viewing information by reference to collected drawings and videos, virtual EAST system is more interactive and immersive. We constructed the browser-oriented virtual EAST physical experiment system, integrated real-time experiment data acquisition, plasma shape visualization and experiment result simulation in order to reproduce physical experiments in a web browser. This system used B/S (Browser/Server) structure in combination with the technology of virtual reality – VRML (Virtual Reality Modeling Language) and Java 3D. In order to avoid the bandwidth limit across internet, we balanced the rendering speed and the precision of the virtual model components. Any registered user can view the experimental information visually and efficiently by logining the system through a web browser. The establishment of the system provides the

Real-time virtual EAST physical experiment system

International Nuclear Information System (INIS)

Li, Dan; Xiao, B.J.; Xia, J.Y.; Yang, Fei

2014-01-01

Graphical abstract: - Highlights: • 3D model of experimental advanced superconducting tokamak is established. • Interaction behavior is created that the users can get information from database. • The system integrates data acquisition, plasma shape visualization and simulation. • Browser-oriented system is web-based and more interactive, immersive and convenient. • The system provides the framework for virtual physical experimental environment. - Abstract: As a large fusion reaction device, experimental advanced superconducting tokamak (EAST)’s internal structure is complicated and not easily accessible. Moreover, various diagnostic systems and complicated configuration bring about the inconveniency to the scientists who are unfamiliar with the system but interested in the data. We propose a virtual system to display the 3D model of EAST facility and enable people to view its inner structure and get access to the information of its components in various view sights. We would also provide most of the diagnostic configuration details together with their signal names and physical properties. Compared to the previous ways of viewing information by reference to collected drawings and videos, virtual EAST system is more interactive and immersive. We constructed the browser-oriented virtual EAST physical experiment system, integrated real-time experiment data acquisition, plasma shape visualization and experiment result simulation in order to reproduce physical experiments in a web browser. This system used B/S (Browser/Server) structure in combination with the technology of virtual reality – VRML (Virtual Reality Modeling Language) and Java 3D. In order to avoid the bandwidth limit across internet, we balanced the rendering speed and the precision of the virtual model components. Any registered user can view the experimental information visually and efficiently by logining the system through a web browser. The establishment of the system provides the

A regional cooperative clinical study of radiotherapy for cervical cancer in east and south-east Asian countries

International Nuclear Information System (INIS)

Nakano, Takashi; Kato, Shingo; Cao, Jianping; Zhou Juying; Susworo, Raden; Supriana, Nana; Sato, Shinichiro; Ohno, Tatsuya; Suto, Hisao; Nakamura, Yuzuru; Cho, Chul-Koo; Ismail, Fuad B.; Calaguas, Miriam J.C.; Reyes, Rey H. de los; Chansilpa, Yaowalak; Thephamongkhol, Kullathom; Nguyen Ba Duc; To Anh Dung; Tsujii, Hirohiko

2007-01-01

Purpose: Radiotherapy differed widely in east and south-east Asia because of technical, cultural, and socio-economic differences. With the purpose of standardizing radiotherapy for cervical cancer in the region, an international clinical study was conducted. Materials and methods: Eleven institutions in eight Asian countries participated in the study. Between 1996 and 1998, 210 patients with stage IIIB cervical cancer were enrolled. Patients were treated with a combination of external beam radiotherapy (total dose, 50 Gy) and either high-dose-rate (HDR) or low-dose-rate (LDR) intracavitary brachytherapy (ICBT) according to the institutional practice. The planned point A dose was 20-28 Gy/4 fractions for HDR-ICBT and 30-40 Gy/1-2 fractions for LDR-ICBT. Results: Hundred patients were treated with HDR-ICBT and 110 were treated with LDR-ICBT. The ICBT doses actually delivered to point A ranged widely: 12-32 Gy in the HDR group and 26-52.7 Gy in the LDR group. The 5-year follow-up rate among the countries differed greatly, from 29% to 100%. The 5-year major complication rates were 6% in the HDR group and 10% in the LDR group. The 5-year overall survival rates were 51.1% in the HDR group and 57.5% in the LDR group. Conclusions: Although there were several problems with treatment compliance and patients' follow-up, the study suggests that the protocols provided favorable outcomes with acceptable rates of late complications in the treatment of advanced cervical cancer in east and south-east Asia

Research on energy strategy and Chinese energy investment in the middle east

Science.gov (United States)

Huang, Yiling

2017-08-01

The Middle East is a key node of “One Belt and One Road strategy”. Energy investment is an important part of Chinese investment in the Middle East. The political turmoil in the Middle East has brought the political risks to Chinese investors. In the future, with the globalization of Chinese resource distribution and the expansion of Chinese outward investment, it is significant for China to ensure its energy security. Based on the analysis of the situation of Chinese energy strategy in the Middle East, this paper tries to put forward some suggestion about Chinese energy investment in the Middle East in order to protect Chinese energy security effectively.

East Antarctic rifting triggers uplift of the Gamburtsev Mountains

Science.gov (United States)

Ferraccioli, F.; Finn, Carol A.; Jordan, Tom A.; Bell, Robin E.; Anderson, Lester M.; Damaske, Detlef

2011-01-01

The Gamburtsev Subglacial Mountains are the least understood tectonic feature on Earth, because they are completely hidden beneath the East Antarctic Ice Sheet. Their high elevation and youthful Alpine topography, combined with their location on the East Antarctic craton, creates a paradox that has puzzled researchers since the mountains were discovered in 1958. The preservation of Alpine topography in the Gamburtsevs may reflect extremely low long-term erosion rates beneath the ice sheet, but the mountains’ origin remains problematic. Here we present the first comprehensive view of the crustal architecture and uplift mechanisms for the Gamburtsevs, derived from radar, gravity and magnetic data. The geophysical data define a 2,500-km-long rift system in East Antarctica surrounding the Gamburtsevs, and a thick crustal root beneath the range. We propose that the root formed during the Proterozoic assembly of interior East Antarctica (possibly about 1 Gyr ago), was preserved as in some old orogens and was rejuvenated during much later Permian (roughly 250 Myr ago) and Cretaceous (roughly 100 Myr ago) rifting. Much like East Africa, the interior of East Antarctica is a mosaic of Precambrian provinces affected by rifting processes. Our models show that the combination of rift-flank uplift, root buoyancy and the isostatic response to fluvial and glacial erosion explains the high elevation and relief of the Gamburtsevs. The evolution of the Gamburtsevs demonstrates that rifting and preserved orogenic roots can produce broad regions of high topography in continental interiors without significantly modifying the underlying Precambrian lithosphere.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...

African Journals Online (AJOL)

Hp 630 Dual Core

COSECSA/ASEA Publication East and Central African ... the one hand on medical technology and equipment and on the other hand on the medical .... traumatic brain injury was the main cause of death amongst emergency admissions at the.

Recent progress of the ECE diagnostics on EAST

International Nuclear Information System (INIS)

Liu, Y.; Ling, B.L.; Han, X.

2013-01-01

On EAST, a 32-channel radiometer system with wider frequency range and better spatial resolution has been commissioned in 2012, and a Michelson interferometer system from JET was relocated very recently. These systems together with the systems we already have, satisfy the requirement of the electron cyclotron emission measurements on EAST for a wide range of toroidal magnetic field. (author)

The implementation of virtualization technology in EAST data system

International Nuclear Information System (INIS)

Wang, Feng; Sun, Xiaoyang; Li, Shi; Wang, Yong; Xiao, Bingjia; Chang, Sidi

2014-01-01

Highlights: • The server virtualization based on XenServer has been used in EAST data center for common servers and software development platform. • The application virtualization based on XenApp has been demonstrated in EAST to provide an easy and unified data browser method. • The desktop virtualization based on XenDesktop has been adopted for desktop virtualization in the new EAST central control room. - Abstract: The virtualization technology is very popular in many fields at present which has many advantages such as reducing costs, unified management, mobile applications, cross platform, etc. We have also implemented the virtualization technology in EAST control and data system. There are primarily four kinds of technology providers in virtualization technology including VMware, Citrix, Microsoft Hyper-V as well as open source solutions. We have chosen the Citrix solution to implement our virtualization system which mainly includes three aspects. Firstly, we adopt the XenServer technology to realize virtual server for EAST data management and service system. Secondly, we use XenApp technology to realize cross platform system for unify data access. Thirdly, in order to simplify the management of the client computers, we adopt the XenDesktop technology to realize virtual desktops for new central control room. The details of the implementation are described in this paper

Disarmament and security measures in South-East Asia

International Nuclear Information System (INIS)

Hasmy Bin Agam

1992-01-01

The situation in South-East Asia is something of a paradox wrought by the end of the cold war and super Power rivalry. As a subregion and integral part of the great Pacific region in cannot be considered in isolation. On the other hand South-East Asia is one of great complexity in terms of its history, peoples and cultures, as well as in its political social and economic systems and orientation. Security picture in South-east Asia in the coming decades depends on a number of impoderables, mainly the situation in Indochina, notably Cambodia, the kind of relationship that will develop between the ASEAN member states and the Indochina countries, as well as with China, as nuclear owning regional Power

Progress of the EAST project in China

International Nuclear Information System (INIS)

Wan, Y.X.; Wu, S.T.; Weng, P.D.; Li, J.G.; Gao, D.M.

2005-01-01

The Experimental Advanced Superconducting Tokamak (EAST) project is one of the National Mega-Projects of Science Research of China, which was approved by Chinese government in 1998. EAST is a full superconducting tokamak with an elongated plasma cross-section. The mission of the project is to widely investigate both of the physics and the technologies of advanced tokamak operations, especially the mechanism of power and particle handling for steady-state operations. The basic requirements for the EAST tokamak are full superconducting coils, suitable inductive current system, continuous working non-inductive current driven and heating systems, flexible operation scenarios, flexible J(r) and P(r) control, reliable and fast plasma positioning and shaping control, changeable plasma facing components, advanced divertor and diagnostics. Significant progress of the EAST project has been achieved during last two years. The R and D programs, mainly focused on the superconducting magnets, have processed successfully. The prototypes of main parts have been fabricated and qualified. Most of the key parts of the machine have been delivered to the assembly site. The assembly of the device has begun. It is planned to obtain the first plasma in 2005. The detail information of the testing results of superconducting magnets will be given in this paper. The assembly plan and the experimental plan will be introduced, too. (author)

Recent LHCD experiments in EAST

International Nuclear Information System (INIS)

Ding, B.J.

2013-01-01

LHCD system of 2.45 GHz in EAST has been updated to 4MW in last campaign. Aimed at high confinement (H-mode) plasma in EAST, the LHW-plasma coupling and current drive experiments were continued. Experiments of local gas puffing near LHW antenna shows that gas puffing from electron side is better to improve LHW-plasma coupling than that from ion side. LHCD experiments at high density are also performed, demonstrating that the decrease of current efficiency at high density may be related to the parametric decay instability (PDI) effect. Lithiation and local gas puffing near LHW antenna are utilized so as to sustain H-mode plasma. H-mode plasma is obtained by LHCD with a wide range of parameters: Ip=0.4∼0.8MA, B_t=1.35∼1.81T, n_e=1.5∼2.5x10"1"9 m"-"3, P_L_H_W>=0.5MW. LHW power deposition and driven current profile with C3PO/LUKE are calculated with the experimental parameters, showing that central and large driven current seems not a necessary condition for the H-mode plasma. H-mode is reproduced with CRONOS. Long pulse plasmas, >400s L mode fully driven by LHCD and >30s H-mode with LHCD and ICRF, have been achieved and demonstrated in EAST. (author)

Interkultuurilised võimalused ja ohud turunduses / Kristel Kaljund

Index Scriptorium Estoniae

Kaljund, Kristel

2002-01-01

Kasut. kirj. lk. 27. - Kokkuvõte ingl. k. lk. 28. Artiklis põhjendatakse kultuuritausta mõju majanduslikule edule ning tuuakse ära kõige sagedasemad vigade põhjused ning pakutakse välja, kuidas Eesti majandusspetsialistidel oleks võimalik neid vigu vältida

Chemical composition profiling and antifungal activity of the ...

African Journals Online (AJOL)

Background: Essential oil from Mesembryanthemum edule leaves have been used by the Eastern Cape traditional healers for the treatment of respiratory tract infections, tuberculosis, dysentery, diabetic mellitus, laryngitis and vaginal infections. The investigation of bioactive compounds in the essential oil of this plant could ...

East Asian welfare regime

DEFF Research Database (Denmark)

Abrahamson, Peter

2017-01-01

The paper asks if East Asian welfare regimes are still productivist and Confucian? And, have they developed public care policies? The literature is split on the first question but (mostly) confirmative on the second. Care has to a large, but insufficient extent, been rolled out in the region...

East is east and west is west and never the twain shall meet: Work engagement and workaholism across Eastern and Western cultures

NARCIS (Netherlands)

Hu, Q.; Schaufeli, Wilmar; Taris, Toon; Hessen, Dave; Hakanen, J.J.; Salanova, M.; Shimazu, Akihito

2014-01-01

This article compares the mean levels of work engagement and workaholism across two cultures (East Asia and Western Europe) by using a latent variable approach. Data were collected in Western Europe in the Netherlands (N = 10,162), Spain (N = 3,481), and Finland (N = 3,472) and in East Asia in China

Observation and analysis of halo current in EAST

Science.gov (United States)

Chen, Da-Long; Shen, Biao; Qian, Jin-Ping; Sun, You-Wen; Liu, Guang-Jun; Shi, Tong-Hui; Zhuang, Hui-Dong; Xiao, Bing-Jia

2014-06-01

Plasma in a typically elongated cross-section tokamak (for example, EAST) is inherently unstable against vertical displacement. When plasma loses the vertical position control, it moves downward or upward, leading to disruption, and a large halo current is generated helically in EAST typically in the scrape-off layer. When flowing into the vacuum vessel through in-vessel components, the halo current will give rise to a large J × B force acting on the vessel and the in-vessel components. In EAST VDE experiment, part of the eddy current is measured in halo sensors, due to the large loop voltage. Primary experimental data demonstrate that the halo current first lands on the outer plate and then flows clockwise, and the analysis of the information indicates that the maximum halo current estimated in EAST is about 0.4 times the plasma current and the maximum value of TPF × Ih/IP0 is 0.65, furthermore Ih/Ip0 and TPF × Ih/Ip0 tend to increase with the increase of Ip0. The test of the strong gas injection system shows good success in increasing the radiated power, which may be effective in reducing the halo current.

East African Cenozoic vegetation history.

Science.gov (United States)

Linder, Hans Peter

2017-11-01

The modern vegetation of East Africa is a complex mosaic of rainforest patches; small islands of tropic-alpine vegetation; extensive savannas, ranging from almost pure grassland to wooded savannas; thickets; and montane grassland and forest. Here I trace the evolution of these vegetation types through the Cenozoic. Paleogene East Africa was most likely geomorphologically subdued and, as the few Eocene fossil sites suggest, a woodland in a seasonal climate. Woodland rather than rainforest may well have been the regional vegetation. Mountain building started with the Oligocene trap lava flows in Ethiopia, on which rainforest developed, with little evidence of grass and none of montane forests. The uplift of the East African Plateau took place during the middle Miocene. Fossil sites indicate the presence of rainforest, montane forest and thicket, and wooded grassland, often in close juxtaposition, from 17 to 10 Ma. By 10 Ma, marine deposits indicate extensive grassland in the region and isotope analysis indicates that this was a C 3 grassland. In the later Miocene rifting, first of the western Albertine Rift and then of the eastern Gregory Rift, added to the complexity of the environment. The building of the high strato-volcanos during the later Mio-Pliocene added environments suitable for tropic-alpine vegetation. During this time, the C 3 grassland was replaced by C 4 savannas, although overall the extent of grassland was reduced from the mid-Miocene high to the current low level. Lake-level fluctuations during the Quaternary indicate substantial variation in rainfall, presumably as a result of movements in the intertropical convergence zone and the Congo air boundary, but the impact of these fluctuations on the vegetation is still speculative. I argue that, overall, there was an increase in the complexity of East African vegetation complexity during the Neogene, largely as a result of orogeny. The impact of Quaternary climatic fluctuation is still poorly understood

East and Central African Journal of Surgery: About this journal

African Journals Online (AJOL)

East and Central African Journal of Surgery: About this journal. Journal Home > East and Central African Journal of Surgery: About this journal. Log in or Register to get access to full text downloads.

Recent progress with ICRF heating on EAST

International Nuclear Information System (INIS)

Zhang Xinjun; Zhao, Y.P.; Mao, Y.Z.

2014-01-01

Radio Frequency (RF) power in the ion cyclotron range of frequencies (ICRF) is one of the primary auxiliary heating techniques for Experimental Advanced Superconducting Tokamak (EAST). The ICRF system for the EAST has been developed to support long-pulse, high-β, advanced tokamak fusion physics experiments. The ICRF system can deliver 12 MW of RF power to the plasma for 1000 seconds through two antennas located in B- and I-ports. Each ICRF transmitter with high power up to 1.5 MW has been successfully tested on a dummy load. The main technical features of the ICRF system is described. Two simulation codes, TORIC (a full wave solver) and SSFPQL (the quasilinear Fokker-Planck solver), are combined to simulate the ICRF heating in the EAST 2D magnetic configuration. The fast wave propagation and absorption characteristics, power partitions among the plasma species and the RF driven energetic tails have been analyzed. (author)

GROWTH AFTER THE ASIAN CRISIS: WHAT REMAINS OF THE EAST ASIAN MODEL?

OpenAIRE

JOMO K.S.

2001-01-01

This paper focuses on the prospects for sustained development in the four East Asian economies most adversely affected by the crises of 1997/98. These include all three second-tier South-East Asian newly industrializing countries (NICs) – Indonesia, Malaysia and Thailand – as well as the Republic of Korea, the most adversely affected of the first-generation newly industrialized economies (NIEs). The first section critically examines the East Asian model presented by the World Bank’s “East Asi...

NASA's East and Southeast Asia Initiatives: BASE-ASIA and EAST-AIRE

Science.gov (United States)

Tsay, S.; Maring, H.

2005-01-01

Airborne dust from northern China influences air quality and regional climate in Asia during springtime. However, with the economic growth in China, increased emission of particulate air pollutants from industrial and vehicular sources will not only impact the earth's radiation balance, but also adversely affect human health year round. In addition, both of dust and aerosol pollutants can be transported swiftly across the Pacific affecting North America within a few days. Asian dust and pollutant aerosols can be detected by their colored appearance using current Earth observing satellites (e.g., MODIS, SeaWiFS, TOMS, etc.) and by sunphotometers deployed on the surface of the earth. Biomass burning has been a regular practice for land clearing and conversion in many countries, especially those in Africa, South America, and Southeast Asia. However, the climatology of Southeast Asia is very different than that of Africa and South America, such that large-scale biomass burning causes smoke to interact extensively with clouds during the peak-burning season of March to April. Globally significant sources of greenhouse gases (eg., CO2, CH4), chemically active gases (e.g., NO, CO, HC, CH3Br), and atmospheric aerosols are produced by biomass burning. These gases influence the Earth-atmosphere system, impacting both global climate and tropospheric chemistry. Some aerosols can serve as cloud condensation nuclei, which play a role in determining cloud lifetime and precipitation, altering the earth's radiation and water budgets. Biomass burning also affects the biogeochemical cycling of nitrogen and carbon compounds; the hydrological cycle; land surface reflectivity and emissivity; and ecosystem biodiversity and stability. Two NASA initiatives, EAST-AIRE (East Asian Study of Tropospheric Aerosols: an International Regional Experiment) and BASE-ASIA (Biomass-burning Aerosols in South East-Asia: Smoke Impact Assessment) will be presented. The objectives of these initiatives is to

The U.S.A. and the energy safety in East Asia

International Nuclear Information System (INIS)

Harmat, K.

2006-01-01

In the contribution under consideration the author reports on the impact of the United States of America (U.S.A.) in East Asia. The American policy in East Asia is based on two fundamental principles: providing, that no regional authority may provoke the position of the U.S.A., as well as protection of the access to regional markets for the American economy. The U.S.A. fulfill their protective function of their Asiatic partners by means of their maritime superiority with the pacific fleet. Strong-points and safety contracts with Japan and the Republic of Korea form the support of the presence of the U.S. American military. The According to energy security, the interests of the U.S.A. in East Asia are: (a) Secure supply of the national economies in East Asia; (b) Security of the maritime supply systems; (c) Stability and liberalization of the international oil markets; (d) Responsible handling of nuclear energy; (e) Environmental protection. Furthermore, the author describes the conflict potentials between the U.S.A. and the energy safety in East Asia as well as the long-term significance of the energy safety in East Asia

The German East-West Mortality Difference: Two Crossovers Driven by Smoking.

Science.gov (United States)

Vogt, Tobias; van Raalte, Alyson; Grigoriev, Pavel; Myrskylä, Mikko

2017-06-01

Before the fall of the Berlin Wall, mortality was considerably higher in the former East Germany than in West Germany. The gap narrowed rapidly after German reunification. The convergence was particularly strong for women, to the point that Eastern women aged 50-69 now have lower mortality despite lower incomes and worse overall living conditions. Prior research has shown that lower smoking rates among East German female cohorts born in the 1940s and 1950s were a major contributor to this crossover. However, after 1990, smoking behavior changed dramatically, with higher smoking intensity observed among women in the eastern part of Germany. We forecast the impact of this changing smoking behavior on East-West mortality differences and find that the higher smoking rates among younger East German cohorts will reverse their contemporary mortality advantage. Mortality forecasting methods that do not account for smoking would, perhaps misleadingly, forecast a growing mortality advantage for East German women. Experience from other countries shows that smoking can be effectively reduced by strict anti-smoking policies. Instead, East Germany is becoming an example warning of the consequences of weakening anti-smoking policies and changing behavioral norms.

The Middle East, OPEC and oil

International Nuclear Information System (INIS)

Roberts, J.

1996-01-01

The importance of the Middle East to the oil industry, was discussed. The unresolved Arab-Israeli dispute and the ongoing conflicts in the Gulf are the two main reasons for political instability in the Middle East. This in turn, shapes the security of the region and its oil supplies. The factors which will shape the future of OPEC, including the Arab-Israeli conflict, the issue of the return of Iraqi crude to the market, and production decisions by Saudi Arabia were discussed in the context of their impact on OPEC's role as a coordinator of oil policies and of market stabilisation through price control

Soviet and East European energy databook

International Nuclear Information System (INIS)

Wilson, D.C.

1991-01-01

For the USSR, energy data is assembled under the following main headings: energy and the economy; production; engineering; exploration; transport of fuel; refining; consumption by sector; employment; finance; trade; electricity. There are 162 tables. Five tables of data on Eastern Europe as a region cover production of energy, consumption, and exports of crude and oil products. Using similar broad headings as these for the USSR, a further 184 tables give data for the following individual countries: Bulgaria; Czechoslovakia; East Germany; Hungary; Poland; Romania; Yugoslavia. The data has been accumulated from Soviet and East European sources, mainly newspapers, journals, annual yearbooks and private contacts and the chief of these are listed. (UK)

Improved density measurement by FIR laser interferometer on EAST tokamak

Energy Technology Data Exchange (ETDEWEB)

Shen, Jie, E-mail: shenjie1988@ipp.ac.cn; Jie, Yinxian; Liu, Haiqing; Wei, Xuechao; Wang, Zhengxing; Gao, Xiang

2013-11-15

Highlights: • In 2012, the water-cooling Mo wall was installed in EAST. • A schottky barrier diode detector is designed and used on EAST for the first time. • The three-channel far-infrared laser interferometer can measure the electron density. • The improved measurement and latest experiment results are reported. • The signal we get in this experiment campaign is much better than we got in 2010. -- Abstract: A three-channel far-infrared (FIR) hydrogen cyanide (HCN) laser interferometer is in operation since 2010 to measure the line averaged electron density on experimental advanced superconducting tokamak (EAST). The HCN laser signal is improved by means of a new schottky barrier diode (SBD) detector. The improved measurement and latest experiment results of the three-channel FIR laser interferometer on EAST tokamak are reported.

Improved density measurement by FIR laser interferometer on EAST tokamak

International Nuclear Information System (INIS)

Shen, Jie; Jie, Yinxian; Liu, Haiqing; Wei, Xuechao; Wang, Zhengxing; Gao, Xiang

2013-01-01

Highlights: • In 2012, the water-cooling Mo wall was installed in EAST. • A schottky barrier diode detector is designed and used on EAST for the first time. • The three-channel far-infrared laser interferometer can measure the electron density. • The improved measurement and latest experiment results are reported. • The signal we get in this experiment campaign is much better than we got in 2010. -- Abstract: A three-channel far-infrared (FIR) hydrogen cyanide (HCN) laser interferometer is in operation since 2010 to measure the line averaged electron density on experimental advanced superconducting tokamak (EAST). The HCN laser signal is improved by means of a new schottky barrier diode (SBD) detector. The improved measurement and latest experiment results of the three-channel FIR laser interferometer on EAST tokamak are reported

Energy market integration and regional institutions in east Asia

International Nuclear Information System (INIS)

Aalto, Pami

2014-01-01

This article assesses the case made for energy market integration in East Asia by comparing the role of institutions in South East Asia and North East Asia. The types and functions of institutions and their overall structure are examined in light of global energy market trends. In South East Asia, the shift attempted by ASEAN towards more competitive markets is hampered by the remaining statist variants of the trade institution and bilateral energy diplomacy, which, as regards transaction cost functions, are sub-optimal. As for institutions with order-creating functions, the unresolved status of sovereignty within ASEAN hampers regulatory harmonisation; the great power management institution has since ASEAN's establishment reduced conflicts without providing decisive leadership conducive to integration. North East Asia's dependence on global energy markets overshadows the regional integration potential of the diverse liberalisation efforts and interconnection projects. Bilateral energy diplomacies, new trilateral institutions combined with ‘Track Two’ institutions and remaining great power competition co-exist. In both regions the institutional structure allows for step-wise, technical infrastructure integration. The environmental stewardship institution co-exists with statist energy security and development objectives while it supports cooperation on green energy. The overall structure of informal institutions constrains deeper energy market integration in several ways. - Highlights: • The structures of institutions explain East Asian energy market integration. • Transaction costs are increased by statist trade institutions and bilateralism. • Order-creating institutions are sub-optimal for energy market integration. • Multi-level great power management offers limited leadership for integration. • The environmental stewardship institution supports cooperation on green energy

East India Company Logbooks - Images

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — This collection consists of images of 1,235 ship logbooks created during British East India Company voyages. Period of record 1786-1834, peaking in 1804. The...

Middle East political stability

OpenAIRE

2008-01-01

Henry Siegman asks whether the next US President can rescue a two-state solution to the Israel–Palestine conflict; Lakhdar Brahimi discusses Iran – war or peace in the Middle East?; Eric Rouleau assesses the Iranian nuclear threat; Walid Khadduri looks at concerns over the future of Iraq and regional implications.

EAST93: Geophysical traverse from the Transantarctic Mountains to the Wilkes Basin, East Antarctica

Science.gov (United States)

ten Brink, Uri S.; Bannister, Stephen

1995-01-01

The East Antarctic Seismic Traverse (EAST93) was a geophysical traverse designed to image the bedrock under the East Antarctic ice cap. The traverse started 10 km west of the Taylor Dome drill site and 25 km west of the exposed bedrock of the Transantarctic Mountains at Lashly Mt. and ended 323 km west of the drill site over the Wilkes subglacial basin (Fig. 1). The traverse was located subparallel to latitude 78° S starting 30-50 km north of the Victoria Land Traverse (1958-1959). It was carried out jointly by the U.S. Geological Survey and Stanford University, U.S.A., together with the Institute of Geological and Nuclear Sciences, and Victoria University, New Zealand, during December 1993 and January 1994. The geophysical traverse included 236 km of multichannel seismic reflection data at 150 m shot intervals, 312.5 km of gravity data collected at intervals of 2.1 km, 312.5 km of magnetic data (total field intensity) collected at average intervals of 0.5 km, and 205 km of ground penetrating radar at intervals of 77 m. Relative locations and elevations of the entire traverse were measured at intervals of 150 m by traditional surveying methods, and tied to three absolute locations measured by the Global Positioning System (GPS). EAST93 is the first large-scale geophysical traverse on the polar plateau to our knowledge since the early 1960s. As such, the experiment presented several logistical challenges: (1) how to collect regional seismic profiles during the short Antarctic summer; (2) how to keep the scientific instruments running with minimal protection in harsh conditions; and (3) how to combine daily moves of camp with full days of work. The scientific and logistical aspects of the project proceeded, in general, according to plan despite the harsh conditions and our lack of previous experience on the polar plateau. Two unanticipated problems affected the progress of the work: the strong wind which slowed seismic acquisition, and the break-down of one of the

Operational region and sawteeth oscillation in the EAST tokamak

International Nuclear Information System (INIS)

Liu, H Q; Gao, X; Zhao, J Y; Hu, L Q; Jie, Y X; Ling, B L; Xu, Q; Ti, A; Ming, T F; Yang, Y; Wu, Z W; Wang, J; Xu, G S; Gao, W; Zhong, G Q; Zang, Q; Shi, Y J; Shen, B; Zhou, Q; Li, Y D; Gong, X Z; Hu, J S; Sun, Y W; Zhao, Y P; Luo, J R; Mao, J S; Weng, P D; Wan, Y X; Zhang, X D; Wan, B N; Li, J

2007-01-01

The first plasma discharges were successfully achieved on the experimental advanced superconducting tokamak (EAST) in 2006. The sawteeth behaviours were observed by means of soft x-ray diagnostics and ECE signals in the EAST. The displacement and radius of the q = 1 surface was studied and compared with the result of equilibrium calculation. The density sawtooth oscillation was also observed by the HCN laser interferometer diagnostics. The structure of the EAST operational region was studied in detail. Plasma performance was obviously improved by the boronization and wall conditioning. It was observed that lower q a and a wider stable operating region is extended by the GDC boronization

Variations of Terrestrial Net Primary Productivity in East Asia

Directory of Open Access Journals (Sweden)

Fangmin Zhang

2012-01-01

Full Text Available Due to the heterogeneity and complexity of terrestrial ecosystems of East Asia, a better understanding of relationships between climate change and net primary productivity (NPP distribution is important to predict future carbon dynamics. The objective of this study is to analyze the temporal-spatial patterns of NPP in East Asia (10°S - 55°N, 60 - 155°E from 1982 to 2006 using the process-based Boreal Ecosystem Productivity Simulator (BEPS model. Prior to the regional simulation, the annual simulated NPP was validated using field observed NPP demonstrating the ability of BEPS to simulate NPP in different ecosystems of East Asia.

Elders Point East Marsh Island Restoration Monitoring Data Analysis

Science.gov (United States)

2017-09-21

accounting for more than 90% of the measured biomass on average, indicative of a well-established marsh (Figure 12). For Elders East the data indicated...61 3.3 Other Biological and Physical Measures ...Figure 9. Growth measurements at Elders East and JoCo Marsh. ....................................................... 20 Figure 10. Stem survival at

East Africa Evaluation Hub - Institute of Rural Reconstruction (IIRR ...

International Development Research Centre (IDRC) Digital Library (Canada)

Outcome Mapping is a planning, monitoring and evaluation methodology developed by IDRC and its partners. There is an active global community of Outcome Mapping users, but few of them are in East Africa. A survey of evaluation experts and development organizations in East Africa showed some familiarity with and ...

The new great game : international oil markets; Middle East domination or regionalisation

International Nuclear Information System (INIS)

Odell, P.R.

1998-01-01

The dynamics of international supply and demand for oil and its effect on world oil prices are discussed. The impact of stagnant prices over the past 15 years on the Middle East, Russia, China and OPEC members was described, together with an attempt to explain the reasons for: (1) Middle East domination or regionalisation, (2) the emergence of a regionalized oil industry, (3) the Middle East as the residual supplier, and (4) the future of Middle East oil and of traded markets. 3 tabs., 5 figs

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

African Journals Online (AJOL)

DELL

2005-04-12

Apr 12, 2005 ... East and Central African Journal of Surgery. .... Any man who is over 40 years with a positive family history (Especially one with HPC-1 gene) warrants a ..... effects of fluid retention, venous & arterial thrombosis, cardiac toxicity, stroke. .... with insertion of an indwelling catheter or intermittent catheterization ...

Looking East: Yin and Yang of an Academic Exchange

Science.gov (United States)

La Roche, Claire Reeves

2011-01-01

Intended as a brief guide to the cultural differences associated with an East-West academic exchange, this paper discusses customs and cultural norms likely to be encountered. Chinese economic growth has been accompanied by rapidly increasing East-West study abroad opportunities. Over the past decade, China has sent more students to study abroad…

Maritime Halophyte Species from Southern Portugal as Sources of Bioactive Molecules

DEFF Research Database (Denmark)

Rodrigues, Maria João; Gangadhar, Katkam N.; Vizetto-Duarte, Catarina

2014-01-01

-ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical was obtained in the ether extract of J. acutus (IC50 = 0.4 mg/mL) and H. portulacoides (IC50 = 0.9 mg/mL). The maximum total phenolic content (TPC) was found in the methanol extract of M. edule (147 mg gallic acid equivalents (GAE)/g) and in the ether extract of J......,1-diphenyl-2-picrylhydrazyl (DPPH) radical were the methanol extracts of M. edule (IC50 = 0.1 mg/mL) and J. acutus (IC50 = 0.4 mg/mL), and the ether extracts of J. acutus (IC50 = 0.2 mg/mL) and A. macrostachyum (IC50 = 0.3 mg/mL). The highest radical scavenging activity (RSA) against the 2,2'-azino-bis (3...... activity and selectivity was obtained with the ether extract of J. acutus. Juncunol was identified as the active compound and for the first time was shown to display selective in vitro cytotoxicity towards various human cancer cells....

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica.

Science.gov (United States)

Castro, Ruth M; Moreira, Lisela; Rojas, María R; Gilbertson, Robert L; Hernández, Eduardo; Mora, Floribeth; Ramírez, Pilar

2013-09-01

Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1) was obtained from a chayote (S. edule) leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV) and Pepper golden mosaic virus (PepGMV) were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV) infecting chayote in the Western Hemisphere.

Occurrence of Squash yellow mild mottle virus and Pepper golden mosaic virus in Potential New Hosts in Costa Rica

Directory of Open Access Journals (Sweden)

Ruth M. Castro

2013-09-01

Full Text Available Leaf samples of Solanum lycopersicum, Capsicum annuum, Cucurbita moschata, Cucurbita pepo, Sechium edule and Erythrina spp. were collected. All samples were positive for begomoviruses using polymerase chain reaction and degenerate primers. A sequence of ∼1,100 bp was obtained from the genomic component DNA-A of 14 samples. In addition, one sequence of ∼580 bp corresponding to the coat protein (AV1 was obtained from a chayote (S. edule leaf sample. The presence of Squash yellow mild mottle virus (SYMMoV and Pepper golden mosaic virus (PepGMV were confirmed. The host range reported for SYMMoV includes species of the Cucurbitaceae, Caricaceae and Fabaceae families. This report extends the host range of SYMMoV to include the Solanaceae family, and extends the host range of PepGMV to include C. moschata, C. pepo and the Fabaceae Erythrina spp. This is the first report of a begomovirus (PepGMV infecting chayote in the Western Hemisphere.

Right: Left:: East: West. Evidence that individuals from East Asian and South Asian cultures emphasize right hemisphere functions in comparison to Euro-American cultures.

Science.gov (United States)

Rozin, Paul; Moscovitch, Morris; Imada, Sumio

2016-09-01

We present evidence that individuals from East or South Asian cultures (Japanese college students in Japan and East or South Asian born and raised college students in the USA) tend to exhibit default thinking that corresponds to right hemisphere holistic functions, as compared to Caucasian individuals from a Western culture (born and raised in the USA). In two lateralized tasks (locating the nose in a scrambled face, and global-local letter task), both Asian groups showed a greater right hemisphere bias than the Western group. In a third lateralized task, judging similarity in terms of visual form versus functional/semantic categorizations, there was not a reliable difference between the groups. On a classic, ambiguous face composed of vegetables, both Eastern groups displayed a greater right hemisphere (holistic face processing) bias than the Western group. These results support an "East - Right Hemisphere, West - Left Hemisphere" hypothesis, as originally proposed by Ornstein (1972). This hypothesis is open as to the degree to which social-cultural forces were involved in hemispheric specialization, or the opposite, or both. Our aim is to encourage a more thorough analysis of this hypothesis, suggesting both lateralization studies corresponding to documented East-West differences, and East-West studies corresponding to lateralization differences. Copyright © 2016 Elsevier Ltd. All rights reserved.

Sef-interest vs altruism in East Asia's development aid

DEFF Research Database (Denmark)

Müller, Anders Riel

2013-01-01

Criticism of East Asia’s alleged self-interest-led development aid can also be applied to Western donors. This may teach us lessons about our own history.......Criticism of East Asia’s alleged self-interest-led development aid can also be applied to Western donors. This may teach us lessons about our own history....

Design and thermal-hydraulic calculation for EAST PFCs' baking

International Nuclear Information System (INIS)

Wan Xiaogang; Yao Damao

2006-01-01

According to the vacuum requirements for fusion in a tokamak device, the authors adopted a kind of gas flow baking technique in EAST. This paper presented the sketch design for EAST PFCs' baking, selected the specifications for the working gas. Calculated the hydraulic and thermal conditions in PFCs under baking, and simulated the results. (authors)

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. s 9990 East Cent. Afr.

African Journals Online (AJOL)

Hp 630 Dual Core

2016-08-01

Aug 1, 2016 ... Congenital Diaphragmatic Hernia Outcomes in East frica: The Ethiopian Experience. Miliard Derbew ... One child was diagnosed with congenital pulmonary airway malformation (CPAM). In total, 10 (83.3%) of our patients were initially misdiagnosed. Only one patient .... Superficial Surgical Site infection. 2.

Cultural influences on stigmatization of problem gambling: East Asian and Caucasian canadians.

Science.gov (United States)

Dhillon, Jasmin; Horch, Jenny D; Hodgins, David C

2011-12-01

Cultural influences on problem gambling stigma were examined using a between subject vignette study design. Students of East Asian (n = 64) and Caucasian (n = 50) ancestry recruited from a Canadian University rated a vignette describing either an East Asian problem gambler or a Caucasian problem gambler on a measure of attitudinal social distance. In accordance with the hypothesis, a factorial ANOVA revealed that East Asian Canadians stigmatize problem gambling more than Caucasian Canadians. Moreover, East Asian participants stigmatized the East Asian individual described in the vignette more than they did the Caucasian individual. Individuals with gambling problems were generally not perceived as being dangerous. However, participants who perceived problem gambling as a dangerous condition wanted more social distance than those who did not perceive individuals with a gambling problem as dangerous.

Prostate cancer in East Asia: evolving trend over the last decade

Directory of Open Access Journals (Sweden)

Yao Zhu

2015-02-01

Full Text Available Prostate cancer is now becoming an emerging health priority in East Asia. Most of our current knowledge on Prostate cancer has been generated from studies conducted in Western population; however, there is considerable heterogeneity of Prostate cancer between East and West. In this article, we reviewed epidemiologic trends, risk factors, disease characteristics and management of Prostate cancer in East Asian population over the last decade. Growing evidence from East Asia suggests an important role of genetic and environmental risk factors interactions in the carcinogenesis of Prostate cancer. Exposure to westernized diet and life style and improvement in health care in combination contribute substantially to the increasing epidemic in this region. Diagnostic and treatment guidelines in East Asia are largely based on Western knowledge. Although there is a remarkable improvement in the outcome over the last decade, ample evidence suggests an inneglectable difference in diagnostic accuracy, treatment efficacy and adverse events between different populations. The knowledge from western countries should be calibrated in the Asian setting to provide a better race-based treatment approach. In this review, we intend to reveal the evolving trend of Prostate cancer in the last decade, in order to gain evidence to improve Prostate cancer prevention and control in East Asia.

Fleet Readiness Center East

Science.gov (United States)

ability to take care of our Customers, our People, and our Business. WHAT'S NEW ON FACEBOOK? weather icon S o cial Media Navy Twitter US Navy Pinterest US Navy Instagram FRC East Facebook US Navy Google FRCE ADVERSE WEATHER INFO Severe Weather Number: 252-464-8333 Visit us on Facebook for up-to-date

The Jurassic of North-East Greenland: Jurassic dinoflagellate cysts from Hochstetter Forland, North-East Greenland

Directory of Open Access Journals (Sweden)

Piasecki, Stefan

2004-11-01

Full Text Available Three sections in Hochstetter Forland, North-East Greenland, referred to the Jurassic Payer Dal and Bernbjerg Formations, have been analysed for dinoflagellate cysts. The dinoflagellate cysts,new finds of ammonites and previously recorded marine faunas form the basis for improved dating of the succession. The basal strata of the Payer Dal Formation at Kulhus is here dated as Late Callovian, Peltoceras athleta Chronozone, based on the presence of relatively abundant Limbicysta bjaerkei, Mendicodinium groenlandicum, Rhychoniopsis cladophora and Tubotuberella dangeardii in an otherwise poor Upper Callovian dinoflagellate assemblage. Ammoniteshave not been recorded from these strata. The upper Payer Dal Formation at Agnetesøelven is dated as Late Oxfordian, Amoeboceras glosense – Amoeboceras serratum Chronozones, based onthe presence of Sciniodinium crystallinum, together with Cribroperidinium granuligera and Stephanelytron sp. The age is in accordance with ammonites present in the uppermost part ofthe formation at Søndre Muslingebjerg. New ammonites in the Bernbjerg Formation at Agnetesøelven together with dinoflagellate cysts indicate an earliest Kimmeridgian age, Raseniacymodoce and Aulacostephanoides mutabilis Chronozones.The Upper Callovian dinoflagellate cysts from Hochstetter Forland belong to a local brackish to marginal marine assemblage, which only allows a fairly broad correlation to coeval assemblagesin central East Greenland. In contrast, the Oxfordian and Kimmeridgian assemblages are fully marine and can be correlated from Milne Land in central East Greenland via Hochstetter Forland to Peary Land in eastern North Greenland.

Diagnosing indicators of large-scale forcing of east-coast cyclogenesis

International Nuclear Information System (INIS)

Dowdy, Andrew J; Mills, Graham A; Timbal, Bertrand

2010-01-01

Extra-tropical cyclones that develop near the east coast of Australia often have severe consequences such as flash flooding and damaging winds and seas, as well as beneficial consequences such as being responsible for heavy rainfall events that contribute significantly to total rainfall and runoff. There is subjective evidence that the development of most major events, commonly known as East Coast Lows, is associated with the movement of a high amplitude upper-tropospheric trough system over eastern Australia. This paper examines a number of upper-tropospheric diagnostic quantities that might provide a basis for preparing a climatology of the large-scale drivers of east-coast cyclogenesis. A preliminary climatology of these diagnostic quantities, based on ECMWF interim reanalyses, is compared with a database of observed East Coast Low events. The potential application of these diagnostics to global climate model simulations of past and future climates is also discussed.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr ...

African Journals Online (AJOL)

Hp 630 Dual Core

East & Central African Journal of Surgery. Nov/Dec 2014 Vol. 19 (3). Pattern and and Outcome of Surgical Management of Postrenal cute Renal Failure Over. Three Years Period at Tikur nbessa Specialized Hospital. L. Samodai, D. ndualem, . Getasew. Addis Ababa University, School of Medicine, Department of Surgery.

ISSN 2073 ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 90 East ...

African Journals Online (AJOL)

DELL

East and Central African Journal of Surgery. ... as the 3D cone beam CT machines which reduce exposure to irradiations, .... effect is closely related to the depth of impaction and height of the body of the mandible. ... extraction based on mere speculation or expectation of a sequelae, however a joint committee on third molar.

Overview of EAST progress and near future plan

International Nuclear Information System (INIS)

Gong, X.; Li, J.; Wan, B.N.; Qian, J.P.; Cao, L.

2015-01-01

Full text of publication follows. The Experimental Advanced Superconducting Tokamak (EAST) is a fully superconducting tokamak with a flexible poloidal field system to accommodate both single null (SN) and double null (DN) divertor configurations, and its main mission is to establish steady-state high performance plasma and study related physics and technologies. Significant progress has recently been made on EAST with the following key issues. Developments of PFMs and improvements of the actively water-cooled PFCs and other in-vessel components, such as VS coils and diagnostics, have been carried out in the past few years to have the highest priority suitable for long pulse operation. Large pumping capacity (inner cryo-pump) and a new CW Pellet Injection system and Supersonic Molecule Beam Injection (SMBI) system to enhance fueling efficiency for particle control have been validated. ICRH and LHCD systems have been upgraded to a total power of 8 MW. Integrated operation scenarios (plasma startup, and ramp up/down) with advanced Plasma Control are focused on superconducting tokamak to avoid the huge thermal energy impact on the first wall. With these newly augmented capabilities, EAST have demonstrated long pulse divertor plasma up to 411 s, fully driven by LHCD of 1.0 MW, and further extended long pulse H-modes over 30 s with LHCD and ICRH, much longer than several tens of the current diffusion time. When LHCD is applied to the H-mode plasmas with ICRH, strong mitigation of ELMs has been observed due to the formation of Helical Current Filaments (HCFs) flowing along field lines in the SOL induced by LHCD. Highly efficient ELM pacing is demonstrated by using innovative Li pellet injection. ELMs mitigation with multi-pulse of SMBI also has been demonstrated in EAST in quasi-steady state over current diffusion time. Several experiments have addressed the importance of zonal flow and zonal flow-driven limit-cycle oscillations in H-mode physics. A new small-ELM regime

Seasonal prediction of East Asian summer rainfall using a multi-model ensemble system

Science.gov (United States)

Ahn, Joong-Bae; Lee, Doo-Young; Yoo, Jin‑Ho

2015-04-01

Using the retrospective forecasts of seven state-of-the-art coupled models and their multi-model ensemble (MME) for boreal summers, the prediction skills of climate models in the western tropical Pacific (WTP) and East Asian region are assessed. The prediction of summer rainfall anomalies in East Asia is difficult, while the WTP has a strong correlation between model prediction and observation. We focus on developing a new approach to further enhance the seasonal prediction skill for summer rainfall in East Asia and investigate the influence of convective activity in the WTP on East Asian summer rainfall. By analyzing the characteristics of the WTP convection, two distinct patterns associated with El Niño-Southern Oscillation developing and decaying modes are identified. Based on the multiple linear regression method, the East Asia Rainfall Index (EARI) is developed by using the interannual variability of the normalized Maritime continent-WTP Indices (MPIs), as potentially useful predictors for rainfall prediction over East Asia, obtained from the above two main patterns. For East Asian summer rainfall, the EARI has superior performance to the East Asia summer monsoon index or each MPI. Therefore, the regressed rainfall from EARI also shows a strong relationship with the observed East Asian summer rainfall pattern. In addition, we evaluate the prediction skill of the East Asia reconstructed rainfall obtained by hybrid dynamical-statistical approach using the cross-validated EARI from the individual models and their MME. The results show that the rainfalls reconstructed from simulations capture the general features of observed precipitation in East Asia quite well. This study convincingly demonstrates that rainfall prediction skill is considerably improved by using a hybrid dynamical-statistical approach compared to the dynamical forecast alone. Acknowledgements This work was carried out with the support of Rural Development Administration Cooperative Research

Ultrasound-Assisted Extraction: Effect of Extraction Time and Solvent ...

African Journals Online (AJOL)

Purpose: To investigate the influence of extraction conditions assisted by ultrasound on the quality of extracts obtained from Mesembryanthemum edule shoots. Methods: The extraction procedure was carried out in an ultrasonic bath. The effect of two solvents (methanol and ethanol) and two extraction times (5 and 10 min) ...

The Middle East population puzzle.

Science.gov (United States)

Omran, A R; Roudi, F

1993-07-01

An overview is provided of Middle Eastern countries on the following topics; population change, epidemiological transition theory and 4 patterns of transition in the middle East, transition in causes of death, infant mortality declines, war mortality, fertility, family planning, age and sex composition, ethnicity, educational status, urbanization, labor force, international labor migration, refugees, Jewish immigration, families, marriage patterns, and future growth. The Middle East is geographically defined as Bahrain, Egypt, Iraq, Jordan, Kuwait, Lebanon, Oman, Qatar, Saudi Arabia, Syria, United Arab Emirates, Yemen, Gaza and the West Bank, Iran, Turkey, and Israel. The Middle East's population grew very little until 1990 when the population was 43 million. Population was about doubled in the mid-1950s at 80 million. Rapid growth occurred after 1950 with declines in mortality due to widespread disease control and sanitation efforts. Countries are grouped in the following ways: persistent high fertility and declining mortality with low to medium socioeconomic conditions (Jordan, Oman, Syria, Yemen, and the West Bank and Gaza), declining fertility and mortality in intermediate socioeconomic development (Egypt, Lebanon, Turkey, and Iran), high fertility and declining mortality in high socioeconomic conditions (Bahrain, Iraq, Kuwait, Qatar, Saudi Arabia, and the United Arab Emirates), and low fertility and mortality in average socioeconomic conditions (Israel). As birth and death rates decline, there is an accompanying shift from communicable diseases to degenerative diseases and increases in life expectancy; this pattern is reflected in the available data from Egypt, Kuwait, and Israel. High infant and child mortality tends to remain a problem throughout the Middle East, with the exception of Israel and the Gulf States. War casualties are undetermined, yet have not impeded the fastest growing population growth rate in the world. The average fertility is 5 births

Measuring Entrepreneurial Activity in the Middle East and North Africa

International Development Research Centre (IDRC) Digital Library (Canada)

Total funding. CA$ 678,500. Country(s). Middle East, North of Sahara, South of Sahara, Central Asia, Far East Asia, South Asia. Project Leader. Dr. Mohamed Derrabi. Institution. Al Akhawayn University. Institution Country. Morocco. Institution Website. http://www.aui.ma. Project Leader. Abedou Abderrahamne. Institution.

Glimpses of East Antarctica: Aeromagnetic and satellite magnetic view from the central Transantarctic Mountains of East Antarctica

Science.gov (United States)

Finn, Carol A.; Goodge, John W.

2010-01-01

Aeromagnetic and satellite magnetic data provide glimpses of the crustal architecture within the Ross Sea sector of the enigmatic, ice-covered East Antarctic shield critical for understanding both global tectonic and climate history. In the central Transantarctic Mountains (CTAM), exposures of Precambrian basement, coupled with new high-resolution magnetic data, other recent aeromagnetic transects, and satellite magnetic and seismic tomography data, show that the shield in this region comprises an Archean craton modified both by Proterozoic magmatism and early Paleozoic orogenic basement reactivation. CTAM basement structures linked to the Ross Orogeny are imaged 50–100 km farther west than previously mapped, bounded by inboard upper crustal Proterozoic granites of the Nimrod igneous province. Magnetic contrasts between craton and rift margin sediments define the Neoproterozoic rift margin, likely reactivated during Ross orogenesis and Jurassic extension. Interpretation of satellite magnetic and aeromagnetic patterns suggests that the Neoproterozoic rift margin of East Antarctica is offset by transfer zones to form a stepwise series of salients tracing from the CTAM northward through the western margin of the Wilkes Subglacial Basin to the coast at Terre Adélie. Thinned Precambrian crust inferred to lie east of the rift margin cannot be imaged magnetically because of modification by Neoproterozoic and younger tectonic events.

Project Radiation protection East. Status Report, July 1997

Energy Technology Data Exchange (ETDEWEB)

Snihs, J.O.; Sundewall, H.; Grapengiesser, S. [STEGRA Consultants (Sweden); Bennerstedt, T. [TeknoTelje (Sweden)

1997-12-01

Project Radiation Protection East is a Swedish program for radiation protection work in Central and Eastern Europe. The projects are assessed, planned and performed in close cooperation with partner organizations in the East. Since 1994 radiation protection cooperation concerning the former Soviet Navy training reactors in Paldiski, Estonia, is included in the project. This report presents a summary over some 140 projects, their status, allocated funds and their distribution over countries and project areas. 12 tabs.

High-altitude wind resources in the Middle East

KAUST Repository

Yip, Chak Man Andrew; Gunturu, Udaya; Stenchikov, Georgiy L.

2017-01-01

In the Middle East, near-surface wind resources are intermittent. However, high-altitude wind resources are abundant, persistent, and readily available and may provide alternative energy resources in this fossil-fuel-dependent region. Using wind field data from the Modern-Era Retrospective Analysis for Research and Applications Version 2 (MERRA-2), this study identifies areas favorable to the deployment of airborne wind energy (AWE) systems in the Middle East and computes the optimal heights at which such systems would best operate. AWE potential is estimated using realistic AWE system specifications and assumptions about deployment scenarios and is compared with the near-surface wind generation potential with respect to diurnal and seasonal variability. The results show the potential utility of AWE in areas in the Middle East where the energy demand is high. In particular, Oman and Saudi Arabia have a high level of the potential power generation with low annual variability.

Culture and comorbidity in East and West berliners.

Science.gov (United States)

Fechner, Mary J

2010-03-01

Following the collapse of socialism, fluctuations in cardiac mortality rates in East Germany and a West-to-East cardiac health gradient became topics of interest. Researchers suggested possible causes for these phenomena, including stress from postsocialism. I proposed that a cultural investigation of heart disease comorbid with depression could inform our understanding of the potential health effects of the postsocialist transition. I conducted ethnographic and survey research. In the study described here, I administered a depression scale (CES-D) and an ethnographically derived measure of cultural stress (Good Life Survey) to over 200 East and West Berliners with cardiovascular disease. Comparison of the groups' depression means revealed no difference. However, correlation of the Good Life Survey and the CES-D revealed unique profiles of cultural variables associated with depression in the two groups, suggesting that culture shapes depression and cardiac risk. I discuss the value of cultural studies to comorbidity research.

Analysis of East Tank Farms Contamination Survey Frequency

International Nuclear Information System (INIS)

ELDER, R.E.

2000-01-01

This document provides the justification for the change in survey frequency in East Tank Farms occupied contamination areas from weekly to monthly. The Tank Farms Radiological Control Organization has performed radiological surveys of its Contamination Area (CA) Double Shell Tank (DST) farms in 200 East Area on a weekly basis for several years. The task package (DST-W012) controlling these routines designates specific components, at a minimum, that must be surveyed whenever the task is performed. This document documents the evaluation of these survey requirements and provides the recommendation and basis for moving DST tank farms in the 200 East Area from a weekly to monthly contamination survey. The contamination surveys for occupied contamination areas in West Tank Farms (WTF) were changed from a weekly frequency to a monthly frequency in 1997. Review of contamination survey data in WTF indicates a monthly interval remains satisfactory

High-altitude wind resources in the Middle East

KAUST Repository

Yip, Chak Man Andrew

2017-08-23

In the Middle East, near-surface wind resources are intermittent. However, high-altitude wind resources are abundant, persistent, and readily available and may provide alternative energy resources in this fossil-fuel-dependent region. Using wind field data from the Modern-Era Retrospective Analysis for Research and Applications Version 2 (MERRA-2), this study identifies areas favorable to the deployment of airborne wind energy (AWE) systems in the Middle East and computes the optimal heights at which such systems would best operate. AWE potential is estimated using realistic AWE system specifications and assumptions about deployment scenarios and is compared with the near-surface wind generation potential with respect to diurnal and seasonal variability. The results show the potential utility of AWE in areas in the Middle East where the energy demand is high. In particular, Oman and Saudi Arabia have a high level of the potential power generation with low annual variability.

Crowdfunding in Emerging Markets : Lessons from East African Startups

OpenAIRE

World Bank Group

2015-01-01

The purpose of this paper is to capture lessons learned from East African entrepreneurs who were some of crowdfunding’s first adopters. Their experiences can serve as a practical guide for entrepreneurs looking to more effectively utilize crowdfunding across all emerging markets. In order to gather this data, the World Bank conducted interviews with a number of East African technology entr...

African Muslim Youth and the Middle East

DEFF Research Database (Denmark)

Ihle, Annette Haaber

this African tradition of religious scholarship in the Middle East. The paper will, with the help of Pierre Bourdieu's notion of forms of capital related to various fields, analyse the challenges which Muslim students encounter during their stay in the Middle East and the forms of capital they bring back......, marked by economic decline and political instability. In Africa a weak or even failed state often means that young people have in reality no access to political, educational or economic positions and resources. In some countries like Nigeria, Ghana and the Ivory Coast the marginalisation of the youth...

JPRS Report, Near East & South Asia

National Research Council Canada - National Science Library

1992-01-01

This report covers international issues relating to the Near East: regional affairs, Palestinian affairs, Iraq, Jordan, Mauritania, Morocco, Sudan, United Arab Emirates, and the Republic of Yemen; and South Asia...

Ky’osimba Onaanya: understanding productivity of East African Highland banana

NARCIS (Netherlands)

Taulya, G.

2015-01-01

Over 30 million people in East Africa depend on East African highland bananas for food and income. The bananas are grown with limited additions of nutrients and no irrigation, despite widespread poor soil fertility and regular dry seasons. This thesis describes the effect of increasing rainfall

A South-East Asian perspective.

Science.gov (United States)

Koh, D; Chia, S E; Jeyaratnam, J

2000-01-01

In order to discuss the subject of occupational medicine in the next century, changes in the present demographic profile and work activity must be considered first. Only then can the challenges be identified, and appropriate strategies be formulated to respond to them. In the diverse countries of South-East Asia, improved health and work conditions, the advent of new technology, a redistribution of work activity, and an ageing workforce can be expected. Two other factors that have specific impact in the region are the recent financial crisis and the occurrence of an international environmental haze from forest fires. The various countries in South-East Asia, which are in different stages of development, and have different problems and priorities, will respond differently to the demands for occupational health. It is likely that there will be a shift in the focus of current health care activities towards specific work sectors, the recognition of new hazards at work, the identification of newly emerging work related diseases, and an increase in health promotion in the workplace. Hopefully, there will be improved training of health professionals to ensure that there are adequate numbers and that they are well prepared to face these changes. Responsive, appropriate and well enforced labour legislation to protect the health of all workers, and international cooperation in occupational and environmental health are also required. As global and regional economic conditions continue to remain unstable and the impact of the crisis further takes its course, the final effect on occupational health in South-East Asia remains to be seen.

The Implementation of Computer Data Processing Software for EAST NBI

International Nuclear Information System (INIS)

Zhang Xiaodan; Hu Chundong; Sheng Peng; Zhao Yuanzhe; Wu Deyun; Cui Qinglong

2014-01-01

One of the most important project missions of neutral beam injectors is the implementation of 100 s neutral beam injection (NBI) with high power energy to the plasma of the EAST superconducting tokamak. Correspondingly, it's necessary to construct a high-speed and reliable computer data processing system for processing experimental data, such as data acquisition, data compression and storage, data decompression and query, as well as data analysis. The implementation of computer data processing application software (CDPS) for EAST NBI is presented in this paper in terms of its functional structure and system realization. The set of software is programmed in C language and runs on Linux operating system based on TCP network protocol and multi-threading technology. The hardware mainly includes industrial control computer (IPC), data server, PXI DAQ cards and so on. Now this software has been applied to EAST NBI system, and experimental results show that the CDPS can serve EAST NBI very well. (fusion engineering)

Pipelines to power South East Asia

Energy Technology Data Exchange (ETDEWEB)

Scholes, W

1994-07-01

European, North American and Australian pipeline companies are busy building pipelines to transport natural gas to power stations throughout South East Asia. Many countries, such as Thailand, Malaysia, Singapore and Indonesia, have economies expanding at more than eight percent a year. Cambodia and Laos are awaiting energy development. Myanmar will not only benefit from the global economic expansion but from the flourishing economies of nearby Thailand and Malaysia which are now investing in neighbouring countries, while their national petroleum companies are starting to operate worldwide. It is the ever expanding rush of industrialisation, urbanisation and the move to raise living standards throughout the region that is accelerating the need for more power stations, both gas and coal-fired, throughout South East Asia. (author)

Pipelines to power South East Asia

International Nuclear Information System (INIS)

Scholes, W.

1994-01-01

European, North American and Australian pipeline companies are busy building pipelines to transport natural gas to power stations throughout South East Asia. Many countries, such as Thailand, Malaysia, Singapore and Indonesia, have economies expanding at more than eight percent a year. Cambodia and Laos are awaiting energy development. Myanmar will not only benefit from the global economic expansion but from the flourishing economies of nearby Thailand and Malaysia which are now investing in neighbouring countries, while their national petroleum companies are starting to operate worldwide. It is the ever expanding rush of industrialisation, urbanisation and the move to raise living standards throughout the region that is accelerating the need for more power stations, both gas and coal-fired, throughout South East Asia. (author)

Steps toward a Middle East free of nuclear weapons

International Nuclear Information System (INIS)

Leonard, J.

1991-01-01

In the aftermath of the Gulf War, all eyes are focused on the dangers of proliferation in the Middle East. President Bush, in his postwar address to Congress, called for immediate action to control the proliferation of weapons of mass destruction and the missiles used to deliver them, warning that it would be tragic if the nations of the Middle East and Persian Gulf were now, in the wake of war, to embark on a new arms race. Secretary of State James Baker has recently returned from a tour of the region, and consultations on proliferation were reportedly high on his agenda. At the same time, the fierce political antagonisms and unbridled military competitions that have long characterized the Middle East leave many skeptical as to what can realistically be done. While all states in the region - including Israel - have publicly supported the idea of establishing a nuclear-weapon-free zone (NWFZ) in the Middle East, doubt over the feasibility of the proposal runs high. Why on earth, it is asked, would Israelis give up the protection of their nuclear monopoly? What assurances from their Arab adversaries or from the US could possibly replace this ultimate deterrent?

Transferring the Malaria Epidemic Prediction Model to Users in East ...

International Development Research Centre (IDRC) Digital Library (Canada)

Transferring the Malaria Epidemic Prediction Model to Users in East Africa. In the highlands of East Africa, epidemic malaria is an emerging climate-related hazard that urgently needs addressing. Malaria incidence increased by 337% during the 1987 epidemic in Rwanda. In Tanzania, Uganda and Kenya, malaria incidence ...

Ky'osimba Onaanya: Understanding Productivity of East African Highland Banana

NARCIS (Netherlands)

Taulya, G.

2016-01-01

Drought stress, potassium (K) and nitrogen (N) deficiencies are major constraints to East African highland banana (Musa spp. AAA-EA; hereafter referred to as ‘highland banana’), a primary staple food crop for over 30 million people in East Africa. This study explored the main and interactive effects

Design, R&D and commissioning of EAST tungsten divertor

Science.gov (United States)

Yao, D. M.; Luo, G. N.; Zhou, Z. B.; Cao, L.; Li, Q.; Wang, W. J.; Li, L.; Qin, S. G.; Shi, Y. L.; Liu, G. H.; Li, J. G.

2016-02-01

After commissioning in 2005, the EAST superconducting tokamak had been operated with its water cooled divertors for eight campaigns up to 2012, employing graphite as plasma facing material. With increase in heating power over 20 MW in recent years, the heat flux going to the divertors rises rapidly over 10 MW m-2 for steady state operation. To accommodate the rapid increasing heat load in EAST, the bolting graphite tile divertor must be upgraded. An ITER-like tungsten (W) divertor has been designed and developed; and firstly used for the upper divertor of EAST. The EAST upper W divertor is modular structure with 80 modules in total. Eighty sets of W/Cu plasma-facing components (PFC) with each set consisting of an outer vertical target (OVT), an inner vertical target (IVT) and a DOME, are attached to 80 stainless steel cassette bodies (CB) by pins. The monoblock W/Cu-PFCs have been developed for the strike points of both OVT and IVT, and the flat type W/Cu-PFCs for the DOME and the baffle parts of both OVT and IVT, employing so-called hot isostatic pressing (HIP) technology for tungsten to CuCrZr heat sink bonding, and electron beam welding for CuCrZr to CuCrZr and CuCrZr to other material bonding. Both monoblock and flat type PFC mockups passed high heat flux (HHF) testing by means of electron beam facilities. The 80 divertor modules were installed in EAST in 2014 and results of the first commissioning are presented in this paper.

EAST OJAI HYDROLOGY, VENTURA COUNTY, USA

Data.gov (United States)

Federal Emergency Management Agency, Department of Homeland Security — The basis of the hydrologic data for East Ojai FIS is the HSPF study for Ventura River watershed documented in a report entitled...

Environmental monitoring in the Middle East. Special evaluation review

International Nuclear Information System (INIS)

1995-01-01

After the Chernobyl accident some Middles East countries approached the IAEA with their concerns about contamination. Therefore, a regional project (RER/9/003, Environmental Monitoring in the Middle East) was established in 1987. The present document is a progress report of this project. It discusses project design, project management, its implementation and achievements. Certain conclusions and recommendations are given based on the evaluation of the findings

Environmental monitoring in the Middle East. Special evaluation review

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-01-19

After the Chernobyl accident some Middles East countries approached the IAEA with their concerns about contamination. Therefore, a regional project (RER/9/003, Environmental Monitoring in the Middle East) was established in 1987. The present document is a progress report of this project. It discusses project design, project management, its implementation and achievements. Certain conclusions and recommendations are given based on the evaluation of the findings.

Turkish Vector of German Policy in the Middle East

Directory of Open Access Journals (Sweden)

A A Dvoryadkina

2014-12-01

Full Text Available The article considers the Middle East policy of modern Germany, taking Turkish vector as an example. The foreign EU policy in the Middle East, as a whole and cooperation of modern Germany with Turkey in attempt to join the European Union are examined. Attention is given to the modern crisis and difficulties that stand on the way of cooperation between the two states.

Power, slavery, and spirit possession in East Africa: A few reflections

Directory of Open Access Journals (Sweden)

Beatrice Nicolini

2014-02-01

Full Text Available Spirit possession and its relationship with power aims to offer here a better understanding not only of East African societies, but, most of all, of their historical role in numerous political and military conflicts and also within peace-building processes that represent a continuation of a topic of longstanding concern in East African history. The relationships between religions, local cultures and institutional powers throughout contemporary East African history will be re-read through regional and transnational, as well as international dynamics.

East African Orthopaedic Journal: Submissions

African Journals Online (AJOL)

Author Guidelines. The East African Orthopaedic Journal is published biannually by the Kenya Orthopaedics Association. Its primary objective is to give researchers in orthopaedics and ... Format should be as follows; Details of authors as for original articles, summary of not more than 200 words, introduction, case report,

Women Engagement with Power and Authority in Re-writing East ...

African Journals Online (AJOL)

From the relative absence of serious women writing in the early mainstream East African literature in English, starting the last quarter of the twentieth century, women writing has flourished to gain deserved space in the East African literary canon. In the writing of Kenya's Marjorie Oludhe Macgoye, Uganda's Mary Karooro ...

Energy supply in East Germany

Energy Technology Data Exchange (ETDEWEB)

Shimoyama, Tsutomu

1988-07-10

East Germany has abundant brown coal, about 90.4% of primary energy production in 1986. The high dependence upon brown coal has been established since its reevaluation in 1980 and the production is reaching a peak. Its share in power generation is also as high as 83.3% in the year. Therefore, the energy sufficiency of East Germany is about 80%. Problems are arising, however, in deterioration of excavation conditions and coal quality. Domestic energy resources such as the uranium and natural gas are also used to the maximum extent. The nuclear power has about 10% of share in the power generation. The share expansion policy is seemingly maintained even after the accident of Chernoble. Exploration, excavation and reprocessing of the uranium are conducted under the leadership of USSR. The country depends upon the oil in a very low level, less than 1%, as a result of the energy conservation policy in 1980's. (1 fig, 5 tabs)

The post-war Middle East

International Nuclear Information System (INIS)

Tempest, P.

1992-01-01

The Middle East remains today the global energy fulcrum. One year after the Persian Gulf war, the region is in greater turmoil and political uncertainty than it has known in modern times. The Iraqi invasion of Kuwait and subsequent external military intervention forced neighboring states to question the need for a foreign military presence in the future. The rift between the secular revolutionary states in the region led by Iraq, Libya, Yemen, Algeria, and Syria and the traditional monarchy of Saudi Arabia and the emirates of the gulf has widened. Egypt provides, at present, an uncomfortable bridge. The balance of political forces may be shifting. This paper attempts to answer the following questions: Where will we see the new leadership in the Middle East? Will it again play a role through the Organization of Petroleum Exporting Countries and determination of the oil price in shaping the structure of global energy supply and demand?

East African Journal of Sciences: Submissions

African Journals Online (AJOL)

Aims The East African Journal of Sciences (EAJS) publishes original scientific ... of ideas among scientists engaged in research and development activities; and ... font size 12, Times New Roman), including tables, figures and illustrations.

ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.

African Journals Online (AJOL)

Hp 630 Dual Core

Countries in the Afro Asian stone belt (stretching from Egypt and Sudan, through the Middle East, India, Pakistan, Burma, Thailand, Indonesia and the Philippines) falling within the .... BJU International, 89(suppl.1): 62 68,. 2002. 10. J.U.V. Monu, Pattern of urolithiasis in Benin City, Nigeria. Journal of the national medical.

ISSN 2073-9990 East Cent. Afr. J. s 9990 East Cent. Afr. J. s

African Journals Online (AJOL)

Prof Kakande

COSECSA/ASEA Publication -East and Central African Journal of Surgery. .... Only the manner of skin closure varied. ... Table 1. Wound Closure Time. Mean wound closure time in group A was 244+8.20 seconds whereas mean wound ... They have been used on skin, bone, cartilage graft, and middle ear surgery, repair of.

Comparison of East Asian winter monsoon indices

Directory of Open Access Journals (Sweden)

Gao Hui

2007-01-01

Full Text Available Four East Asian winter monsoon (EAWM indices are compared in this paper. In the research periods, all the indices show similar interannual and decadal-interdecadal variations, with predominant periods centering in 3–4 years, 6.5 years and 9–15 years, respectively. Besides, all the indices show remarkable weakening trends since the 1980s. The correlation coefficient of each two indices is positive with a significance level of 99%. Both the correlation analyses and the composites indicate that in stronger EAWM years, the Siberian high and the higher-level subtropical westerly jet are stronger, and the Aleutian low and the East Asia trough are deeper. This circulation pattern is favorable for much stronger northwesterly wind and lower air temperature in the subtropical regions of East Asia, while it is on the opposite in weaker EAWM years. Besides, EAWM can also exert a remarkable leading effect on the summer monsoon. After stronger (weaker EAWM, less (more summer precipitation is seen over the regions from the Yangtze River valley of China to southern Japan, while more (less from South China Sea to the tropical western Pacific.

A new tool for virtual scientific and autostereoscopic visualization of EAST

International Nuclear Information System (INIS)

Li, Dan; Xiao, B.J.; Xia, J.Y.; Wang, K.R.; Chen, S.L.; Luo, W.L.

2016-01-01

Highlights: • 3D effect of the virtual EAST has been improved and data visualization has been realized in the ASEAST system. • Interaction behavior is created that the users can get information from database. • The system integrates data acquisition, data visualization and model visualization. • QT libraries are adopted to realize the cross-platform and impressive graphical interface. • In order to manage the models, the web-based model manager system is constructed. - Abstract: The Experimental Advanced Superconducting Tokamak (EAST) Device began operation in 2006. EAST visualization work has been paid more and more attention for simulating its running state and inner structure. The VEAST system had been developed to display the 3D model of EAST facility and some diagnostic data based on Java3D. Compared with the VEAST system, a new system named autosterescopic scientific EAST (ASEAST) using C/S (Client/Server) structure in combination with the technology of OpenGL and an open-source software system for 3D computer graphics and visualization called VTK (Visualization Toolkit) and the Qt5 libraries for the graphical user interface (GUI) has been developed to improve the 3D effect of the virtual EAST and visualize the experimental data. The ASEAST can be used to get access to the information of EAST and physical properties. In addition, as a general system, ASEAST supports a wide variety of 3D formats. The visualization result can be output in the corresponding format of the input. In order to improve the rendering speed, we used the classic QEM algorithm to simplify the models in preprocess stage. As for the 3D effect, we made an investigation and the survey revealed that the system had good 3D effect.

A new tool for virtual scientific and autostereoscopic visualization of EAST

Energy Technology Data Exchange (ETDEWEB)

Li, Dan, E-mail: lidan@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Xiao, B.J.; Xia, J.Y.; Wang, K.R. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China); Chen, S.L. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Luo, W.L. [709th Research lnstitute, China Shipbuilding lndustry Corporation, Wuhan, Hubei (China)

2016-11-15

Highlights: • 3D effect of the virtual EAST has been improved and data visualization has been realized in the ASEAST system. • Interaction behavior is created that the users can get information from database. • The system integrates data acquisition, data visualization and model visualization. • QT libraries are adopted to realize the cross-platform and impressive graphical interface. • In order to manage the models, the web-based model manager system is constructed. - Abstract: The Experimental Advanced Superconducting Tokamak (EAST) Device began operation in 2006. EAST visualization work has been paid more and more attention for simulating its running state and inner structure. The VEAST system had been developed to display the 3D model of EAST facility and some diagnostic data based on Java3D. Compared with the VEAST system, a new system named autosterescopic scientific EAST (ASEAST) using C/S (Client/Server) structure in combination with the technology of OpenGL and an open-source software system for 3D computer graphics and visualization called VTK (Visualization Toolkit) and the Qt5 libraries for the graphical user interface (GUI) has been developed to improve the 3D effect of the virtual EAST and visualize the experimental data. The ASEAST can be used to get access to the information of EAST and physical properties. In addition, as a general system, ASEAST supports a wide variety of 3D formats. The visualization result can be output in the corresponding format of the input. In order to improve the rendering speed, we used the classic QEM algorithm to simplify the models in preprocess stage. As for the 3D effect, we made an investigation and the survey revealed that the system had good 3D effect.

Model, Proxy and Isotopic Perspectives on the East African Humid Period

Science.gov (United States)

Tierney, Jessica E.; Lewis, Sophie C.; Cook, Benjamin I.; LeGrande, Allegra N.; Schmidt, Gavin A.

2011-01-01

Both North and East Africa experienced more humid conditions during the early and mid-Holocene epoch (11,000-5000yr BP; 11-5 ka) relative to today. The North African Humid Period has been a major focus of paleoclimatic study, and represents a response of the hydrological cycle to the increase in boreal summer insolation and associated ocean, atmosphere and land surface feedbacks. Meanwhile, the mechanisms that caused the coeval East African Humid Period are poorly understood. Here, we use results from isotopeenabled coupled climate modeling experiments to investigate the cause of the East African Humid Period. The modeling results are interpreted alongside proxy records of both water balance and the isotopic composition of rainfall. Our simulations show that the orbitally-induced increase in dry season precipitation and the subsequent reduction in precipitation seasonality can explain the East African Humid Period, and this scenario agrees well with regional lake level and pollen paleoclimate data. Changes in zonal moisture flux from both the Atlantic and Indian Ocean account for the simulated increase in precipitation from June through November. Isotopic paleoclimate data and simulated changes in moisture source demonstrate that the western East African Rift Valley in particular experienced more humid conditions due to the influx of Atlantic moisture and enhanced convergence along the Congo Air Boundary. Our study demonstrates that zonal changes in moisture advection are an important determinant of climate variability in the East African region.

STRATEGI PEMASARAN PAKET WISATA FULL DAY DI PT. TOUR EAST INDONESIA

Directory of Open Access Journals (Sweden)

Putu Geni Jaya Ksamawan

2017-01-01

Full Text Available he development of increasing tourist arrivals to Bali led to the development of business and tourism in the world of business, one business trip in Bali. PT. Tour East Tours and Travel is the one of the travel agents in Bali in this to win the competition with other companies, the need for proper marketing strategy and correct. This study aims to determine the marketing strategy Full Day tour packages PT. Tour East Indonesia and what strategies can be implemented in the PT. Tour East Tours and Travel to boost sales of tour packages to tourists as well as winning the competition with other companies. In this study using Qualitative descriptive data analysis techniques combined with a SWOT analysis to figure out what the right strategy is used to market tour packages Full Day of PT. Tour East Indonesia. Based on the SWOT matrix analysis obtained a marketing strategy that can be applied to PT. Tour East Tours and Travel is a strategy creation and development of tourism products, increased promotion strategies, human resource development strategy, market segmentation strategy development, and strategies for improving the quality of products and services. From the results of this study can be given advice to the PT. Tour East Tours and Travel is improving service process management and define market segments and maintain the image of the internal and external environment, while maintaining a cooperative relationship, and held training to staff meetings.

Conceptual design main progress of EAST Articulated Maintenance Arm (EAMA) system

Energy Technology Data Exchange (ETDEWEB)

Shi, Shanshuang, E-mail: shiss@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Laboratory of Intelligent Machines, Lappeenranta University of Technology (Finland); Song, Yuntao; Cheng, Yong [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Villedieu, Eric; Bruno, Vincent [CEA-IRFM, F-13108 Saint-Paul-Lez-Durance (France); Feng, Hansheng [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Wu, Huapeng [Laboratory of Intelligent Machines, Lappeenranta University of Technology (Finland); Wang, Peng [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Hao, Zhiwei; Li, Yang; Wang, Kun; Pan, Hongtao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China)

2016-03-15

Highlights: • EAST Articulated Maintenance Arm (EAMA) system is being collaboratively developed by ASIPP and CEA-IRFM. • Conceptual design for a 3-DOF wrist end effector with gripper has been finished. • Kinematic design can reach 90% of the workspace inside EAST tokamak vessel. • A prototype of EAMA arm segment has been built to validate the design. - Abstract: EAST articulated maintenance arm (EAMA) system is being collaboratively developed by ASIPP and CEA-IRFM for the purpose of remote inspection and simple maintenance operations in EAST vacuum vessel during physical experiments without breaking the ultra-high vacuum condition. The EAMA system design is based on a similar articulated inspection arm robot successfully demonstrated in Tore Supra in 2008. In order to better meet EAST configurations and maintenance requirements, optimized mechanisms and dimensions are considered for EAMA robot as upgrades. Besides, the segmented arm is equipped with a 3-DOF wrist end effector and gripper for gripping operation as well as inspection. Some calculations and simulations on statics, kinematics and workspace of EAMA have been presented to validate the feasibility. This paper introduces the overall design of the EAMA robot and presents implementation progress.

Conceptual design main progress of EAST Articulated Maintenance Arm (EAMA) system

International Nuclear Information System (INIS)

Shi, Shanshuang; Song, Yuntao; Cheng, Yong; Villedieu, Eric; Bruno, Vincent; Feng, Hansheng; Wu, Huapeng; Wang, Peng; Hao, Zhiwei; Li, Yang; Wang, Kun; Pan, Hongtao

2016-01-01

Highlights: • EAST Articulated Maintenance Arm (EAMA) system is being collaboratively developed by ASIPP and CEA-IRFM. • Conceptual design for a 3-DOF wrist end effector with gripper has been finished. • Kinematic design can reach 90% of the workspace inside EAST tokamak vessel. • A prototype of EAMA arm segment has been built to validate the design. - Abstract: EAST articulated maintenance arm (EAMA) system is being collaboratively developed by ASIPP and CEA-IRFM for the purpose of remote inspection and simple maintenance operations in EAST vacuum vessel during physical experiments without breaking the ultra-high vacuum condition. The EAMA system design is based on a similar articulated inspection arm robot successfully demonstrated in Tore Supra in 2008. In order to better meet EAST configurations and maintenance requirements, optimized mechanisms and dimensions are considered for EAMA robot as upgrades. Besides, the segmented arm is equipped with a 3-DOF wrist end effector and gripper for gripping operation as well as inspection. Some calculations and simulations on statics, kinematics and workspace of EAMA have been presented to validate the feasibility. This paper introduces the overall design of the EAMA robot and presents implementation progress.

Selection of vaccine strains for serotype O foot-and-mouth disease viruses (2007-2012) circulating in Southeast Asia, East Asia and Far East.

Science.gov (United States)

Mahapatra, Mana; Upadhyaya, Sasmita; Aviso, Sharie; Babu, Aravindh; Hutchings, Geoff; Parida, Satya

2017-12-18

Foot-and-mouth disease (FMD) is endemic in Southeast Asia (SEA) and East Asia with circulation of multiple serotypes and multiple genotypes within each serotype of the virus. Although countries like Japan and South Korea in the Far East were free of FMD, in 2010 FMD serotype O (O/Mya-98) outbreaks were recorded and since then South Korea has experienced several FMD outbreaks despite regular vaccination. In this study a total of 85 serotype O FMD viruses (FMDV) isolated from 2007 to 2012 from SEA, East Asia and Far East were characterized by virus neutralisation tests using antisera to four existing (O/HKN/6/83, O/IND/R2/75, O/SKR/2010 and O/PanAsia-2) and one putative (O/MYA/2009) vaccine strains, and by full capsid sequencing. Serological studies revealed broad cross-reactivity with the vaccine strains; O/PanAsia-2 exhibited a good match with 95.3%, O/HKN/6/83 with 91.8%, O/IND/R2/75 with 80%, and the putative strain O/MYA/2009 with 89.4% isolates employed in this study. Similarly O/PanAsia-2 and O/IND/R2/75 vaccines showed a good match with all eight viruses belonging to O-Ind-2001d sublineage whereas the vaccines of O/Mya-98 lineage, O/MYA/2009 and O/SKR/2010 exhibited the lowest match indicating their unsuitability to protect infections from O-Ind-2001d viruses. A Bayesian analysis of the capsid sequence data indicated these circulating viruses (n = 85) to be of either SEA or Middle East-South Asian (ME-SA) topotype. The ME-SA topotype viruses were mainly detected in Lao PDR, Vietnam, Myanmar and Thailand reflecting the trade links with the Indian subcontinent, and also within the SEA countries. Implications of these results in the context of FMD control in SEA and East Asian countries are discussed. Copyright © 2017 The Author(s). Published by Elsevier Ltd.. All rights reserved.

Gas export potential of Russia's East: Will it match Asia-Pacific markets?

International Nuclear Information System (INIS)

Khartukov, E.; Starostina, E.

2002-01-01

Russia's Far East and East Siberia are emerging as new major sources of gas supplies for East Asian energy markets. Thanks to ongoing and earmarked resource and infrastructure developments in Sakhalin, Yakutia (Sakha) and Irkutsk, by around 2020 these poorly developed but naturally endowed areas of the country's East can provide between 50 and 70 Bcm/yr (5-7 Bcfd) of natural gas, including up to 10 Mt/yr of LNG, available for exports to neighbouring Pacific countries (primarily to the PRC, Japan, South Korea as well as to Taiwan and the U.S. West Coast). This can noticeably reshape today's matrix of the Asia-Pacific energy flows and even destabilize the regional gas market. (author)

33 CFR 110.70a - Northeast River, North East, Md.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Northeast River, North East, Md. 110.70a Section 110.70a Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.70a Northeast River, North East, Md. The water...

Management of Water Demand in Africa and the Middle East ...

International Development Research Centre (IDRC) Digital Library (Canada)

Management of Water Demand in Africa and the Middle East : Current Practices and Future Needs. Couverture du livre Management of Water Demand in Africa and the Middle East : Current Practices. Directeur(s) : David B. Brooks, Eglal Rached et Maurice Saade. Maison(s) d'édition : CRDI. 1 janvier 1997. ISBN : Épuisé.

Management of Water Demand in Africa and the Middle East ...

International Development Research Centre (IDRC) Digital Library (Canada)

1997-01-01

Management of Water Demand in Africa and the Middle East : Current Practices and Future Needs. Couverture du livre Management of Water Demand in Africa and the Middle East : Current Practices. Editor(s):. David B. Brooks, Eglal Rached et Maurice Saade. Publisher(s):. CRDI. January 1, 1997. ISBN: Épuisé. 78 pages.

Language Education Policy and Practice in East and Southeast Asia

Science.gov (United States)

Kirkpatrick, Andy; Liddicoat, Anthony J.

2017-01-01

East and Southeast Asia represents a linguistically and culturally diverse region. For example, more than 700 languages are spoken in Indonesia alone. It is against this backdrop of diversity that the ten countries that comprise Association of South East Asian Nations (ASEAN) have recently signed the ASEAN Charter which, while calling for respect…

K-East and K-West Reactors

Data.gov (United States)

Federal Laboratory Consortium — Hanford's "sister reactors", the K-East and the K-West Reactors, were built side-by-side in the early 1950's. The two reactors went operational within four months of...

After the Wall: Parental Attitudes to Child Rearing in East and West Germany

Science.gov (United States)

Uhlendorff, Harald

2004-01-01

In the years following German reunification, East and West German parents (282 mothers and 207 fathers) were interviewed about attitudes to the rearing of their 7- to 13-year-old children and about their social networks. Path analyses show that East German parents engage in more protective and less permissive parenting, and that East German…

Nuclear age in the Middle East

Energy Technology Data Exchange (ETDEWEB)

Yiftah, S

1976-01-01

The book analyses, clarifies and summarises, from various aspects, some of the many questions concerning the motivation, the meaning, the economics, the dangers and the risks of introducing nuclear technology into the Middle East area following the recent agreements between some Mid Eastern countries and the United States, France, Germany and the U.S.S.R. about the supply of nuclear power reactors and nuclear fuel to the Middle East. The recent strong nuclear prgrams of countries such as India and Iran, who have wide-ranging ties with the Mid-Eastern countries, coupled with the huge revenues of petrodollars by the Arab countries of the area, together with the dangers of another 1973-type oil embargo are discussed and the triple crises of energy, ecology and nuclear weapons proliferation are considered.

Collaboration with East African security organisations

DEFF Research Database (Denmark)

Nordby, Johannes Riber; Jacobsen, Katja L.

2012-01-01

of the concept. At the same time the three organisations represent different constellations of member nations and thus different national interests, and locally they have different legitimacy and political strength. Thus, when choosing collaboration partners for a security project it is not simply a question......When it comes to understanding the concept of security and the way fragile security situations should be solved, the difference is big. While EASF – the East African Standby Force – is a regular military force with a rather traditional, military perception of the concept of security, EAC (East...... African Community) and IGAD (Intergovernmental Authority on Development) have broader perceptions of the concept. According to EAC, security also concerns matters such as policy reform, legislation, education and infrastructure. IGAD considers food security and environmental and economic issues as part...

A traditional boats and navigational history of Odisha, East coast of India

Digital Repository Service at National Institute of Oceanography (India)

Tripati, S.

Environ., vol.40(2); 2015; 80-93 A study of Traditional Boats and Navigational History of Odisha, East coast of India Sila Tripati Marine Archaeology Centre CSIR- National Institute of Oceanography Dona Paula, Goa 403 004... parts of the east coast of India and navigational technology. Keywords: Traditional boats, Navigation, Maritime trade, Odisha, East coast of India 2    Introduction The history of boatbuilding is as old as the relationship between man...

Captagon: use and trade in the Middle East.

Science.gov (United States)

Al-Imam, Ahmed; Santacroce, Rita; Roman-Urrestarazu, Andres; Chilcott, Robert; Bersani, Giuseppe; Martinotti, Giovanni; Corazza, Ornella

2017-05-01

Fenetheylline, a psychostimulant drug, often branded as Captagon, is a combination of amphetamine and theophylline. Since the cessation of its legal production in 1986, counterfeited products have been produced illicitly in south-east Europe and far-east Asia. Its profitable trade has been linked to terrorist organizations, including Islamic State of Iraq and the Levant. This study aims to reach up-to-date data, concerning the Captagon e-commerce and use in the Middle East. A multi-staged and multi-lingual literature search was carried out. A list of prespecified keywords was applied across medical and paramedical databases, web and Dark web, search engines, social communication media, electronic commerce websites, media networks, and the Global Public Health Intelligence Network database. The use of Captagon as a stimulant in terrorist settings has been marginally covered in the literature. Data can widely be retrieved from Google and AOL search engines, YouTube, and Amazon e-commerce websites, and to a lesser extent from Alibaba and eBay. On the contrary, Middle Eastern e-commerce websites yielded almost no results. Interestingly, the Dark web generated original data for Captagon e-commerce in the Middle East. Further investigations are needed on the role that psychoactive drugs play in terrorist attacks and civil war zones. Unless a comprehensive methodological strategy, inclusive of unconventional methods of research, is implemented, it will not be feasible to face such a threat to humanity. Copyright © 2016 John Wiley & Sons, Ltd.

77 FR 43167 - Safety Zone; Electric Zoo Fireworks, East River, Randall's Island, NY

Science.gov (United States)

2012-07-24

... establishes a temporary safety zone on the waters of the East River in the vicinity of Randall's Island, NY.... This temporary safety zone will restrict vessels from a portion of the East River around the location... area is a temporary safety zone: all navigable waters of the East River within a 164-yard radius of the...

Towards a nuclear-weapon-free zone in the Middle East

International Nuclear Information System (INIS)

1991-01-01

Every year since 1974 the General Assembly adopted a resolution on the subject ''Establishment of a nuclear-weapon-free zone in the Middle East''. By that resolution, the General Assembly requested the Secretary-General to undertake a study on effective and verifiable measures which would facilitate the establishment of a nuclear-weapon-free zone in the Middle East, taking into account the circumstances and characteristics of the Middle East, as well as the views and the suggestions of the parties of the region, and to submit this study to the General Assembly. The study was carried out between July 1989 and August 1990. The study discusses a number of steps and measures that could ease the process leading to the establishment of a nuclear-weapon-free zone in the Middle East. Those measures could be undertaken independently or in conjunction with each other, as well as by individual States or jointly by several, and also on a reciprocal basis; each of them would move the States concerned closer to their ultimate objective - the establishment of a zone free of nuclear weapons

Far East LPG sales will grow faster than in West

International Nuclear Information System (INIS)

Anon.

1996-01-01

LPG sales through 2010 in regions east of the Suez Canal (East of Suez) will grow at more than twice those in regions west of the canal. East-of-Suez sales will grow at more than 4.0%/year, compared to slightly less than 2.0%/year growth in sales West of Suez. East-of-Suez sales will reach 92 million tons/year (tpy) by 2010, accounting for 39% of the worldwide total. This share was 31% in1995 and only 27% in 1990. LPG sales worldwide will reach 192 million tons in 2000 and 243 million tpy by 2010. In 1995, they were 163 million tons. These are some of the major conclusions of a recent study by Frank R. Spadine, Christine Kozar, and Rudy Clark of New York City-based consultant Poten and Partners Inc. Details of the study are in the fall report ''World Trade in LPG 1990--2010''. This paper discusses demand segments, seaborne balance, Western sources, largest trading region, North American supplies, and other supplies

Petroleum and gas stakes in the Middle-East

International Nuclear Information System (INIS)

Mabro, R.

1996-01-01

In this article is explained the policy situation in the Middle-East and how it has an influence upon the petroleum market. The different situations of Israel and Arab countries, Iran, Iraq and Turkey are reviewed and some speculations are made to understand how things can evolve and their impact on the economic life of this area( for example: if Turkey wants to play a role in the Middle-East policy). If it is obvious that changes can arise the direction of these changes is not clearly established. (N.C.)

New achievements in the EAST plasma control system

Energy Technology Data Exchange (ETDEWEB)

Yuan, Q.P., E-mail: qpyuan@ipp.ac.c [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Xiao, B.J. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Penaflor, B.G.; Piglowski, D.A. [General Atomics, DIII-D National Fusion Facility, San Diego, CA (United States); Liu, L.Z. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Johnson, R.D.; Walker, M.L.; Humphreys, D.A. [General Atomics, DIII-D National Fusion Facility, San Diego, CA (United States)

2010-07-15

In order to realize the low latency and distortion-free signal transmission between the plasma control system (PCS) and servo systems, the digital output structure configured with reflective memory board (RFM) was adopted in EAST PCS. And the enhanced performances are reported. Another achievement made in the latest EAST PCS was the implementation of density control algorithm, which controlled the line average density in either voltage or width modulation mode. The new integrated algorithm improved the precision of density calculation and control performance greatly. The details and experiment results are presented in this paper.

Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

Index Scriptorium Estoniae

Lehtsaar, Heli, 1976-

2008-01-01

Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

The Business of Politics Commerce, and Culture in East Asia

DEFF Research Database (Denmark)

Ooi, Can-Seng

2016-01-01

Review of: "Cultural Policies in East Asia: Dynamics Between the State, Arts and Creative Industries". Edited by Hye-Kyung Lee and Lorraine Lim. Basingstoke: Palgrave, Macmillan, 2014. 229 pp.......Review of: "Cultural Policies in East Asia: Dynamics Between the State, Arts and Creative Industries". Edited by Hye-Kyung Lee and Lorraine Lim. Basingstoke: Palgrave, Macmillan, 2014. 229 pp....

Data monitoring system of technical diagnosis system for EAST

International Nuclear Information System (INIS)

Qian Jing; Weng Peide; Chen Zhuomin; Wu Yu; Xi Weibin; Luo Jiarong

2010-01-01

Technical diagnosis system (TDS) is an important subsystem to monitor status parameters of EAST (experimental advanced superconducting tokamak). The upgraded TDS data monitoring system is comprised of management floor, monitoring floor and field floor.. Security protection, malfunction record and analysis are designed to make the system stable, robust and friendly. During the past EAST campaigns, the data monitoring system has been operated reliably and stably. The signal conditioning system and software architecture are described. (authors)

77 FR 28253 - Safety Zone; America's Cup World Series, East Passage, Narragansett Bay, RI

Science.gov (United States)

2012-05-14

...-AA00 Safety Zone; America's Cup World Series, East Passage, Narragansett Bay, RI AGENCY: Coast Guard... navigable waters of the East Passage, Narragansett Bay, Rhode Island, during the America's Cup World Series... rulemaking (NPRM) entitled ``Safety Zones; America's Cup World Series, East Passage, Narragansett Bay, RI...

East African Agricultural and Forestry Journal

African Journals Online (AJOL)

East African Agricultural and Forestry Journal is published by the Kenya ... water resource base to meet the challenges of poverty alleviation and food security. ... on maize growth, nitrogen uptake and yield in a semi-arid Kenyan environment ...

Implementation of GPU parallel equilibrium reconstruction for plasma control in EAST

Energy Technology Data Exchange (ETDEWEB)

Huang, Yao, E-mail: yaohuang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Xiao, B.J. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); School of Nuclear Science & Technology, University of Science & Technology of China (China); Luo, Z.P.; Yuan, Q.P.; Pei, X.F. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Yue, X.N. [School of Nuclear Science & Technology, University of Science & Technology of China (China)

2016-11-15

Highlights: • We described parallel equilibrium reconstruction code P-EFIT running on GPU was integrated with EAST plasma control system. • Compared with RT-EFIT used in EAST, P-EFIT has better spatial resolution and full algorithm of EFIT per iteration. • With the data interface through RFM, 65 × 65 spatial grids P-EFIT can satisfy the accuracy and time feasibility requirements for plasma control. • Successful control using ISOFLUX/P-EFIT was established in the dedicated experiment during the EAST 2014 campaign. • This work is a stepping-stone towards versatile ISOFLUX/P-EFIT control, such as real-time equilibrium reconstruction with more diagnostics. - Abstract: Implementation of P-EFIT code for plasma control in EAST is described. P-EFIT is based on the EFIT framework, but built with the CUDA™ architecture to take advantage of massively parallel Graphical Processing Unit (GPU) cores to significantly accelerate the computation. 65 × 65 grid size P-EFIT can complete one reconstruction iteration in 300 μs, with one iteration strategy, it can satisfy the needs of real-time plasma shape control. Data interface between P-EFIT and PCS is realized and developed by transferring data through RFM. First application of P-EFIT to discharge control in EAST is described.

"East is East and West is West and never the twain shall meet" Work engagement and workaholism across Eastern and Western cultures

OpenAIRE

Hu, Q; Schaufeli, Wilmar; Taris, T.W; Hessen, D.J; Hakanen, J; Salanova, M; Shimazu, A

2014-01-01

This article compares the mean levels of work engagement and workaholism across two cultures (East Asia and Western Europe) by using a latent variable approach. Data were collected in Western Europe in the Netherlands (N = 10,162), Spain (N = 3,481), and Finland (N = 3,472) and in East Asia in China (N = 2,977) and in Japan (N =2,520). It was assumed that, based on cultural differences, in individualistic and Christian Europe work is associated with self-enhancement and personal development, ...

Characterising East Antarctic Lithosphere and its Rift Systems using Gravity Inversion

Science.gov (United States)

Vaughan, Alan P. M.; Kusznir, Nick J.; Ferraccioli, Fausto; Leat, Phil T.; Jordan, Tom A. R. M.; Purucker, Michael E.; Golynsky, A. V. Sasha; Rogozhina, Irina

2013-04-01

Since the International Geophysical Year (1957), a view has prevailed that East Antarctica has a relatively homogeneous lithospheric structure, consisting of a craton-like mosaic of Precambrian terranes, stable since the Pan-African orogeny ~500 million years ago (e.g. Ferracioli et al. 2011). Recent recognition of a continental-scale rift system cutting the East Antarctic interior has crystallised an alternative view of much more recent geological activity with important implications. The newly defined East Antarctic Rift System (EARS) (Ferraccioli et al. 2011) appears to extend from at least the South Pole to the continental margin at the Lambert Rift, a distance of 2500 km. This is comparable in scale to the well-studied East African rift system. New analysis of RadarSat data by Golynsky & Golynsky (2009) indicates that further rift zones may form widely distributed extension zones within the continent. A pilot study (Vaughan et al. 2012), using a newly developed gravity inversion technique (Chappell & Kusznir 2008) with existing public domain satellite data, shows distinct crustal thickness provinces with overall high average thickness separated by thinner, possibly rifted, crust. Understanding the nature of crustal thickness in East Antarctica is critical because: 1) this is poorly known along the ocean-continent transition, but is necessary to improve the plate reconstruction fit between Antarctica, Australia and India in Gondwana, which will also better define how and when these continents separated; 2) lateral variation in crustal thickness can be used to test supercontinent reconstructions and assess the effects of crystalline basement architecture and mechanical properties on rifting; 3) rift zone trajectories through East Antarctica will define the geometry of zones of crustal and lithospheric thinning at plate-scale; 4) it is not clear why or when the crust of East Antarctica became so thick and elevated, but knowing this can be used to test models of

Measurement of Radiated Power Loss on EAST

International Nuclear Information System (INIS)

Duan Yanmin; Hu Liqun; Mao Songtao; Xu Ping; Chen Kaiyun; Lin Shiyao; Zhong Guoqiang; Zhang Jizong; Zhang Ling; Wang Liang

2011-01-01

A type of silicon detector known as AXUV (absolute extreme ultraviolet) photodiodes is successfully used to measure the radiated power in EAST. The detector is characterized by compact structure, fast temporal response (<0.5 s) and flat spectral sensitivity in the range from ultra-violet to X-ray. Two 16-channel AXUV arrays are installed in EAST to view the whole poloidal cross-section of plasma. Based on the diagnostic system, typical radiation distributions for both limiter and divertor plasma are obtained and compared. As divertor detachment occurs, the radiation distribution in X-point region is observed to vary distinctly. The total radiation power losses in discharges with different plasma parameters are briefly analyzed.

Differences in sexual guilt and desire in east Asian and Euro-Canadian men.

Science.gov (United States)

Brotto, Lori A; Woo, Jane S T; Gorzalka, Boris B

2012-01-01

Differences in sexual desire between individuals of East Asian and European descent are well-documented, with East Asian individuals reporting lower sexual desire. The mechanisms that underlie this disparity have received little empirical attention. Recent research has found that sex guilt, "a generalized expectancy for self-mediated punishment for violating or for anticipating violating standards of proper sexual conduct" (Mosher & Cross, 1971 , p. 27), mediates the relationship between culture and sexual desire in East Asian and Euro-Canadian women. The goal of this study was to explore this role of sex guilt in men. Male Euro-Canadian (n = 38) and East Asian (n = 45) university students completed online questionnaires. The East Asian men reported significantly lower sexual desire and significantly higher sex guilt. Sex guilt was a significant mediator of the relationship between ethnicity and sexual desire, as well as a significant mediator between mainstream acculturation and sexual desire. Among the East Asian men, mainstream acculturation was significantly and negatively correlated with sex guilt such that increasing mainstream acculturation was associated with less sex guilt. The diagnostic and clinical implications of the findings are discussed.

Late Holocene anti-phase change in the East Asian summer and winter monsoons

Science.gov (United States)

Kang, Shugang; Wang, Xulong; Roberts, Helen M.; Duller, Geoff A. T.; Cheng, Peng; Lu, Yanchou; An, Zhisheng

2018-05-01

Changes in East Asian summer and winter monsoon intensity have played a pivotal role in the prosperity and decline of society in the past, and will be important for future climate scenarios. However, the phasing of changes in the intensity of East Asian summer and winter monsoons on millennial and centennial timescales during the Holocene is unclear, limiting our ability to understand the factors driving past and future changes in the monsoon system. Here, we present a high resolution (up to multidecadal) loess record for the last 3.3 ka from the southern Chinese Loess Plateau that clearly demonstrates the relationship between changes in the intensity of the East Asian summer and winter monsoons, particularly at multicentennial scales. At multimillennial scales, the East Asian summer monsoon shows a steady weakening, while the East Asian winter monsoon intensifies continuously. At multicentennial scales, a prominent ∼700-800 yr cycle in the East Asian summer and winter monsoon intensity is observed, and here too the two monsoons are anti-phase. We conclude that multimillennial changes are driven by Northern Hemisphere summer insolation, while multicentennial changes can be correlated with solar activity and changing strength of the Atlantic meridional overturning circulation.

Middle East respiratory syndrome in children. Dental considerations

Directory of Open Access Journals (Sweden)

Fares S. Al-Sehaibany

2017-04-01

Full Text Available As of January 2016, 1,633 laboratory-confirmed cases of Middle East Respiratory Syndrome Coronavirus (MERS-CoV infection and 587 MERS-related deaths have been reported by the World Health Organization globally. Middle East Respiratory Syndrome Coronavirus may occur sporadically in communities or may be transmitted within families or hospitals. The number of confirmed MERS-CoV cases among healthcare workers has been increasing. Middle East Respiratory Syndrome Coronavirus may also spread through aerosols generated during various dental treatments, resulting in transmission between patients and dentists. As MERS-CoV cases have also been reported among children, pediatric dentists are at risk of MERS-CoV infection. This review discusses MERS-CoV infection in children and healthcare workers, especially pediatric dentists, and considerations pertaining to pediatric dentistry. Although no cases of MERS-CoV transmission between a patient and a dentist have yet been reported, the risk of MERS-CoV transmission from an infected patient may be high due to the unique work environment of dentists (aerosol generation.

The East Asian Office of Astronomy for Development

Science.gov (United States)

de Grijs, Richard; Zhang, Ziping

2015-08-01

At the 2012 General Assembly of the International Astronomical Union (IAU), the Office of Astronomy for Development (OAD) programme announced a number of exciting new partnerships to assist with the IAU's decadal strategic plan (2010-2020). These landmark decisions included establishing a new coordinating centre that aims at using astronomy as a tool for development in East Asia. The agreement covers two important functions. One is known as a Regional Node, which entails the coordination of astronomy-for-development activities in countries within the general geographical region of East Asia (in first instance China, Mongolia and the DPRK, but without placing firm geographical limits on the region). The other is known as a Language Expertise Centre which will deal with all aspects relating to (mainly) the Chinese language and culture. The impact of the latter may obviously spread well beyond the geographical region to other parts of the world. At this next General Assembly, we aim at updating the community of the achievements and aims of the East Asian Office of Astronomy for Development.

Permanent Changes in the Wage Structure and the East German Fertility Crisis

OpenAIRE

Arntz, Melanie; Gathmann, Christina

2014-01-01

After the fall of the Berlin wall, the total fertility rate in East Germany tumbled from 1.7 (1989) to a stunning 0.7 children per woman (1994). While this fact is well-documented, little is still known about the crisis underlying causes. We propose a new explanation: permanent shifts in the East German wage structure that are plausibly exogenous from the individual s perspective. Economic transition dramatically increased the returns to human capital in East Germany. Economic theory suggests...

Observations of the southern East Madagascar Current and undercurrent and countercurrent system

Science.gov (United States)

Nauw, J. J.; van Aken, H. M.; Webb, A.; Lutjeharms, J. R. E.; de Ruijter, W. P. M.

2008-08-01

In April 2001 four hydrographic sections perpendicular to the southern East Madagascar Current were surveyed as part of the Agulhas Current Sources Experiment. Observations with a vessel mounted and a lowered ADCP produced information on the current field while temperature, salinity, oxygen and nutrient data obtained with a CTD-Rosette system, gave information on the water mass structure of the currents southeast of Madagascar. The peak velocity in the pole-ward East Madagascar Current through these four sections had a typical magnitude of ˜110 cm/s, while the width of this current was of the order of 120 km. The mean pole-ward volume transport rate of this current during the survey above the 5°C isotherm was estimated to be 37 ± 10 Sv. On all four sections an undercurrent was observed at intermediate depths below the East Madagascar Current. Its equator-ward transport rate amounted to 2.8 ± 1.4 Sv. Offshore of the East Madagascar Current the shallow South Indian Ocean Countercurrent was observed. This eastward frontal jet coincided with the barotropic and thermohaline front that separates the saline Subtropical Surface Water from the fresher Tropical Surface Water in the East Madagascar Current. The near-surface geostrophic flow of the East Madagascar Current, derived from satellite altimetry data from 1992 to 2005, suggests a strong variability of this transport due to eddy variability and interannual changes. The long-term pole-ward mean transport of the East Madagascar Current, roughly estimated from those altimetry data amounts to 32 Sv. The upper-ocean water mass of the East Madagascar Current was very saline in 2001, compared to WOCE surveys from 1995. Comparison of our undercurrent data with those of the WOCE surveys in 1995 confirms that the undercurrent is a recurrent feature. Its water mass properties are relatively saline, due to the presence of water originating from the Red Sea outflow at intermediate levels. The saline water was advected from the

Upgrade of ICRF heating system on EAST

International Nuclear Information System (INIS)

Chen Gen; Zhao Yanpin; Mao Yuzhou

2013-01-01

ICRF (Ion Cyclotron Range of Frequency) heating is an essential heating and current drive tool on EAST (Experimental Advanced Superconducting Tokamak). The high-power steady-state transmitters were designed as a part of research and development of ICRF heating system which aimed at output power of 1.5 MW for 1000 s in a frequency range of 25 to 70 MHz. There are 3 stage power amplifiers for each transmitter. Tube TH525A and TH535 were chosen for drive power amplifier (DPA) and final power amplifier (FPA), respectively. The power supply system of DPA and FPA were upgraded by using reliable PSM high voltage sources, whose response time is less than 5 μs. The ICRF system, which consists of 8 transmitters, will give out more than 10 MW total output power in the future. Four of them have been already fabricated, and another four are under construction. Three liquid stub tuners are used for impedance matching between antennas and transmitters, which can be only tuned shot to shot. There are two fast wave heating antennas which are assembled at I port and B port on EAST. Several projects are in progress including fast response impedance matching, distributed data acquisition and control system and so on for EAST ICRF heating system. (author)

Destination 2010: regional economic strategy for the East Midlands 2003-2010

OpenAIRE

East Midlands Development Agency

2003-01-01

Destination 2010 is the second regional economic strategy for the East Midlands. The strategy is a high level framework that sets out a vision for the East Midlands economy in 2010 and provides a blueprint for economic development activity in the region for the period 2003-2010.

Franchising in the Middle East: The Example of Egypt

OpenAIRE

Elsaman, Radwa S.

2017-01-01

With the largest population in the Arab Middle East and a central location between Europe and East Asia, Egypt offers one of the biggest sources of franchising markets in the world for new business opportunities. Egypt, however, does not have specialized laws regulating franchising, which results in real challenges for investors who are seeking to franchise their businesses in Egypt, along with their legal advisors. It also creates problems for the courts who must rule on disputes arising fro...

The East Asian Regional Office of Astronomy for Development

Science.gov (United States)

de Grijs, Richard; Zhang, Ziping; He, Jinhua

2016-10-01

At the 2012 General Assembly of the International Astronomical Union (IAU), the Office of Astronomy for Development announced a number of exciting new partnerships to assist with the IAU's decadal strategic plan (2010-2020). These landmark decisions included establishing a new coordinating centre that aims at using astronomy as a tool for development in East Asia. The agreement covers two important functions. One is known as a Regional Node, which entails the coordination of astronomy-for-development activities in countries within the general geographical region of East Asia. The other is known as a Language Expertise Centre which deals with all aspects relating to (mainly) the Chinese language and culture. The impact of the latter may obviously spread well beyond the geographical region to other parts of the world. Here we provide an update of the achievements and aims of the East Asian Office of Astronomy for Development.

Identification of Detrital Carbonate in East Cepu High

Science.gov (United States)

Sari, R.; Andika, I. K.; Haris, A.; Miftah, A.

2018-03-01

East Cepu High is a part of horst – graben series which formed by extensional tectonic processes during Paleogene in North East Java Basin. Due to excellent paleogeography position, the carbonate build-up was growth very well and as the main reservoir in East Cepu High. Sea level change have important factor to provide variation of facies in each carbonate buildup, one of emerging facies is detrital carbonate. Detrital carbonate indicated by onlap horizon featured with carbonate build up body. Based on paleogeography, fluctuation of sea level change and sediment source, detrital carbonate formed in leeward area in lowstand or highstand phases. Distinguish between detrital carbonate facies with other facies, advanced seismic processing performed by using continuous wavelet transform (CWT) and seismic inversion. CWT is one method of spectral decomposition used to find the frequency that represent a facies. The result from seismic inversion will support the interpretation for facies distribution. As the result, seismic data which have interval frequency 10 – 45 Hz and Acoustic Impedance (AI) value above 35000 (from cross plot between acoustic impedance and gamma ray) can be interpreted as detrital carbonate. Based on seismic interpretation, detrital carbonate facies distributed along leeward area with geometrical spreading. The lateral facies change from detrital carbonate to shale was identified which causing this facies become potential as hydrocarbon reservoir with stratigraphic trap. Based on the earlier studies, North East Java Basin have a strong hydrocarbon migration to fill the reservoir, therefore the detrital carbonate have high chance to be a new hydrocarbon prospect in this area.

East African Journal of Public Health

African Journals Online (AJOL)

The East African Journal of Public Health is a multi-disciplinary journal publishing scientific research work from a range of public health related disciplines including community medicine, epidemiology, nutrition, behavioural sciences, health promotion, health education, communicable and non-communicable disease.

Financing Technological Upgrading in East Asia

NARCIS (Netherlands)

Rasiah, Rajah; Mubarik, Shujaat; Yap, Xiao-Shan

2017-01-01

There has been considerable discussion on the drivers of economic growth in East Asia. While most studies recognize that capital accumulation and macroeconomic management were critical in hastening growth, few have examined systematically and comparatively how policy frameworks – spearheaded through

An Overview of the EAST Project

International Nuclear Information System (INIS)

Songtao Wu

2006-01-01

The China national project of Experimental Advanced Superconducting Tokamak (EAST) has been in its final engineering phase in the Institute of Plasma Physics, the Chinese Academy of Sciences (ASIPP). The year of 2006 is the important year for the EAST project. After six years hard work, the first engineering commissioning of EAST superconducting tokamak began with vacuum pumping on 7, Feb. The first charge of one of the PF coils was made on 13, Mar. The EAST superconducting tokamak is a full superconducting tokamak with a non-circle cross-section of the vacuum vessel and active cooling plasma facing components. The scientific and the engineering missions of the EAST project are to study physics issues of the advanced steady-state tokamak operations and to establish technology basis of full superconducting tokamaks. The EAST project features both superconducting toroidal field (TF) coils and poloidal field (PF) coils, continuous working (CW) non-inductive plasma current drive and heating systems, flexible and reliable PF system design to shape and control plasmas with big elongations and triangularity, real time data collection and feedback for steady-state profile control, active cooling and changeable plasma facing components (PFC) and advanced diagnostic measurements. During the past five years, the main R (and) D mainly focused on the design, fabrication and test of 16 kA CICC (Cable-in-Conduit Conductor) and the large scale superconducting magnet has been completed. The test results shown the performances of all superconducting magnets are well acceptable. For the deadlock configuration among the main components of the superconducting tokamak, the first commissioning was taken without the vacuum vessel ducts for easily disassembling if some important problems were found. In the commissioning, the TF system was charged up to 8 kA in 5000 s and the toroidal field at the major radius of 1.7 m is 2 T, which is 60% of the designed value. The reason why the TF system

EAST-AIA deployment under vacuum: Calibration of laser diagnostic system using computer vision

Energy Technology Data Exchange (ETDEWEB)

Yang, Yang, E-mail: yangyang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); Song, Yuntao; Cheng, Yong; Feng, Hansheng; Wu, Zhenwei; Li, Yingying; Sun, Yongjun; Zheng, Lei [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); Bruno, Vincent; Eric, Villedieu [CEA-IRFM, F-13108 Saint-Paul-Lez-Durance (France)

2016-11-15

Highlights: • The first deployment of the EAST articulated inspection arm robot under vacuum is presented. • A computer vision based approach to measure the laser spot displacement is proposed. • An experiment on the real EAST tokamak is performed to validate the proposed measure approach, and the results shows that the measurement accuracy satisfies the requirement. - Abstract: For the operation of EAST tokamak, it is crucial to ensure that all the diagnostic systems are in the good condition in order to reflect the plasma status properly. However, most of the diagnostic systems are mounted inside the tokamak vacuum vessel, which makes them extremely difficult to maintain under high vacuum condition during the tokamak operation. Thanks to a system called EAST articulated inspection arm robot (EAST-AIA), the examination of these in-vessel diagnostic systems can be performed by an embedded camera carried by the robot. In this paper, a computer vision algorithm has been developed to calibrate a laser diagnostic system with the help of a monocular camera at the robot end. In order to estimate the displacement of the laser diagnostic system with respect to the vacuum vessel, several visual markers were attached to the inner wall. This experiment was conducted both on the EAST vacuum vessel mock-up and the real EAST tokamak under vacuum condition. As a result, the accuracy of the displacement measurement was within 3 mm under the current camera resolution, which satisfied the laser diagnostic system calibration.

Nutritional composition and antioxidant activities of Curculigo pilosa ...

African Journals Online (AJOL)

ajl yemi

2011-11-28

Nov 28, 2011 ... Phenolic, flavonoids and proanthocyanidin contents were 65.17, 23.17 and 4.23 mg/g .... The total phenol content in the extract was determined by the modified Folin-Ciocalteu method (Wolfe et al., 2003). 0.5 ml ( ..... activities of Sechium edule (Jacq.) Swart extracts. Food Chem. 97: 452–458. Palazzino G ...

An Analysis of Estimated Versus Actual Development Costs for an Electronics State-of-the-Art (SOA) Extension.

Science.gov (United States)

1987-12-01

DOWNGPAONG SC-EDULE distributiJ-_ _ . 1.,1J=.ted 4 PERFORMING ORGANZA ;ON REPORT NuMBERIS) S MONiTORING ORGANIZATION REP(CRT %L%𔄂ERS, 6a NAME OF PERFORMING...process. It is the one where assistance of other technical experts may be required. It may also require some restructuring of the program merely to

Confidence- and security-building in South-East Asia. Working group II

International Nuclear Information System (INIS)

Alagappa, M.

1991-01-01

Discussion in the Working Group II focused on the following subjects: the establishment of a zone of peace, freedom and neutrality in South-East Asia; the establishment of a nuclear weapon-free zone in South-East Asia; the Cambodian conflict; regional co-operation; military security confidence-building measures

The development of Middle-East natural gas markets

International Nuclear Information System (INIS)

Bahgat, G.

2001-01-01

The economic, political and strategic environment under which plans to explore and develop gas fields in the Middle East have been drawn and implemented are reviewed. The topic is of particular importance in view of the fact that the Middle East holds more than one third of the world's proven reserves of natural gas, largely underdeveloped and under utilized as of the beginning of the second millennium. Particular attention is paid to Saudi Arabia, Iran and Israel, where despite serious challenges and political uncertainties, significant developments are underway to develop the region's natural gas potential. 27 refs., 1 tab

Measurement of the deuterium Balmer series line emission on EAST

Energy Technology Data Exchange (ETDEWEB)

Wu, C. R.; Xu, Z.; Jin, Z.; Zhang, P. F. [Institute of Plasma Physics, Chinese Academy of Sciences, P.O. Box 1126, Hefei, Anhui 230031 (China); Science Island Branch of Graduate School, University of Science and Technology of China, Hefei, Anhui 230031 (China); Huang, J., E-mail: juan.huang@ipp.ac.cn; Gao, W.; Gao, W.; Chang, J. F.; Xu, J. C.; Duan, Y. M.; Chen, Y. J.; Zhang, L.; Wu, Z. W.; Li, J. G. [Institute of Plasma Physics, Chinese Academy of Sciences, P.O. Box 1126, Hefei, Anhui 230031 (China); Hou, Y. M. [Institute of Plasma Physics, Chinese Academy of Sciences, P.O. Box 1126, Hefei, Anhui 230031 (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei, Anhui 230026 (China)

2016-11-15

Volume recombination plays an important role towards plasma detachment for magnetically confined fusion devices. High quantum number states of the Balmer series of deuterium are used to study recombination. On EAST (Experimental Advanced Superconducting Tokamak), two visible spectroscopic measurements are applied for the upper/lower divertor with 13 channels, respectively. Both systems are coupled with Princeton Instruments ProEM EMCCD 1024B camera: one is equipped on an Acton SP2750 spectrometer, which has a high spectral resolution ∼0.0049 nm with 2400 gr/mm grating to measure the D{sub α}(H{sub α}) spectral line and with 1200 gr/mm grating to measure deuterium molecular Fulcher band emissions and another is equipped on IsoPlane SCT320 using 600 gr/mm to measure high-n Balmer series emission lines, allowing us to study volume recombination on EAST and to obtain the related line averaged plasma parameters (T{sub e}, n{sub e}) during EAST detached phases. This paper will present the details of the measurements and the characteristics of deuterium Balmer series line emissions during density ramp-up L-mode USN plasma on EAST.

JPRS Report, East Europe

Science.gov (United States)

1990-05-04

ments, they actively advertise their readiness to enter 90GE0031A East Berlin A USSENWIRTSCHAFT a barter deal and they will accept it as long as...AG it comprises the following aspects: has set up two joint ventures in the USSR producing shoes; Adidas has one joint venture in Hungary.) Joint...administration until product development, advertising , and marketing. In the repayment of long-term credits. Consortiums addition, the Soviet firm is interested

Forests of East Texas, 2014

Science.gov (United States)

Thomas J. Brandeis

2015-01-01

This resource update provides an overview of forest resources in east Texas derived from an inventory conducted by the U.S. Forest Service, Forest Inventory and Analysis (FIA) Program at the Southern Research Station in cooperation with the Texas A&M Forest Service. These estimates are based on field data collected using the FIA annualized sample design and are...

Forests of east Texas, 2013

Science.gov (United States)

K.J.W. Dooley; T.J. Brandeis

2014-01-01

This resource update provides an overview of forest resources in east Texas based on an inventory conducted by the U.S. Forest Service, Forest Inventory and Analysis (FIA) program at the Southern Research Station in cooperation with the Texas A&M Forest Service. Forest resource estimates are based on field data collected using the FIA annualized sample design and...

Strategy for thermo-gravimetric analysis of K East fuel samples

International Nuclear Information System (INIS)

Lawrence, L.A.

1997-01-01

A strategy was developed for the Thermo-Gravimetric Analysis (TGA) testing of K East fuel samples for oxidation rate determinations. Tests will first establish if there are any differences for dry air oxidation between the K West and K East fuel. These tests will be followed by moist inert gas oxidation rate measurements. The final series of tests will consider pure water vapor i.e., steam

Hydrography, 2004, East Baton Rouge Parish, Louisiana

Data.gov (United States)

Louisiana Geographic Information Center — The Hydrography layer is an area geometry depicting the various water features that include the rivers, streams, creeks, lakes, etc of East Baton Rouge Parish.

Interactive WebGL-based 3D visualizations for EAST experiment

International Nuclear Information System (INIS)

Xia, J.Y.; Xiao, B.J.; Li, Dan; Wang, K.R.

2016-01-01

Highlights: • Developing a user-friendly interface to visualize the EAST experimental data and the device is important to scientists and engineers. • The Web3D visualization system is based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. • The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. • The original CAD model was discretized into different layers with different simplification to enable realistic rendering and improve performance. - Abstract: In recent years EAST (Experimental Advanced Superconducting Tokamak) experimental data are being shared and analyzed by an increasing number of international collaborators. Developing a user-friendly interface to visualize the data, meta data and the relevant parts of the device is becoming more and more important to aid scientists and engineers. Compared with the previous virtual EAST system based on VRML/Java3D [1] (Li et al., 2014), a new technology is being adopted to create a 3D visualization system based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. It offers a highly interactive interface allowing scientists to roam inside EAST device and view the complex 3-D structure of the machine. It includes technical details of the device and various diagnostic components, and provides visualization of diagnostic metadata with a direct link to each signal name and its stored data. In order for the quick access to the device 3D model, the original CAD model was discretized into different layers with different simplification. It allows users to search for plasma videos in any experiment and analyze the video frame by frame. In this paper, we present the implementation details to enable realistic rendering and improve performance.

Interactive WebGL-based 3D visualizations for EAST experiment

Energy Technology Data Exchange (ETDEWEB)

Xia, J.Y., E-mail: jyxia@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China); Xiao, B.J. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China); Li, Dan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); Wang, K.R. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui (China)

2016-11-15

Highlights: • Developing a user-friendly interface to visualize the EAST experimental data and the device is important to scientists and engineers. • The Web3D visualization system is based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. • The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. • The original CAD model was discretized into different layers with different simplification to enable realistic rendering and improve performance. - Abstract: In recent years EAST (Experimental Advanced Superconducting Tokamak) experimental data are being shared and analyzed by an increasing number of international collaborators. Developing a user-friendly interface to visualize the data, meta data and the relevant parts of the device is becoming more and more important to aid scientists and engineers. Compared with the previous virtual EAST system based on VRML/Java3D [1] (Li et al., 2014), a new technology is being adopted to create a 3D visualization system based on HTML5 and WebGL, which runs without the need for plug-ins or third party components. The interactive WebGL-based 3D visualization system is a web-portal integrating EAST 3D models, experimental data and plasma videos. It offers a highly interactive interface allowing scientists to roam inside EAST device and view the complex 3-D structure of the machine. It includes technical details of the device and various diagnostic components, and provides visualization of diagnostic metadata with a direct link to each signal name and its stored data. In order for the quick access to the device 3D model, the original CAD model was discretized into different layers with different simplification. It allows users to search for plasma videos in any experiment and analyze the video frame by frame. In this paper, we present the implementation details to enable realistic rendering and improve performance.

Effect of heating scheme on SOL width in DIII-D and EAST

Directory of Open Access Journals (Sweden)

L. Wang

2017-08-01

Full Text Available Joint DIII-D/EAST experiments in the radio-frequency (RF heated H-mode scheme with comparison to that of neutral beam (NB heated H-mode scheme were carried out on DIII-D and EAST under similar conditions to examine the effect of heating scheme on scrape-off layer (SOL width in H-mode plasmas for application to ITER. A dimensionally similar plasma equilibrium was used to match the EAST shape parameters. The divertor heat flux and SOL widths were measured with infra-red camera in DIII-D, while with divertor Langmuir probe array in EAST. It has been demonstrated on both DIII-D and EAST that RF-heated plasma has a broader SOL than NB-heated plasma when the edge electrons are effectively heated in low plasma current and low density regime with low edge collisionality. Detailed edge and pedestal profile analysis on DIII-D suggests that the low edge collisionality and ion orbit loss effect may account for the observed broadening. The joint experiment in DIII-D has also demonstrated the strong inverse dependence of SOL width on the plasma current in electron cyclotron heated (ECH H-mode plasmas.

Sesame Synchrotron Light for Experimental Sciences and Application in the Middle East

International Nuclear Information System (INIS)

El-Khalafawy, T.A.

2003-01-01

Anew international center for synchrotron radiation for research excellence for scientists from throughout the Middle East as well as other parts of the world could do for science what CERN has done for science in Europe. SESAME Project (Synchrotron Light for Experimental Sciences and Application in the Middle East ) under the umbrella for UNESCO establish the first major international research center as a cooperative venture by the scientists and governments of the Middle East, opened to all qualified scientists. It will be propeller for the regional economy while promoting the peaceful development of science and technology in the Middle East. SESAME will have as its centerpiece a synchrotron radiation based on a gift from Germany of the 0.8 GeV BESSYI storage ring and injector system which stopped operation at the end of November 1999

Poland’s Trade with East Asia: An Outlier Approach

Directory of Open Access Journals (Sweden)

Tseng Shoiw-Mei

2015-12-01

Full Text Available Poland achieved an excellent reputation for economic transformation during the recent global recession. The European debt crisis, however, quickly forced the reorientation of Poland’s trade outside of the European Union (EU, especially toward the dynamic region of East Asia. This study analyzes time series data from 1999 to 2013 to detect outliers in order to determine the bilateral trade paths between Poland and each East Asian country during the events of Poland’s accession to the EU in 2004, the global financial crisis from 2008 to 2009, and the European debt crisis from 2010 to 2013. From the Polish standpoint, the results showed significantly clustering outliers in the above periods and in the general trade paths from dependence through distancing and improvement to the chance of approaching East Asian partners. This study also shows that not only China but also several other countries present an excellent opportunity for boosting bilateral trade, especially with regard to Poland’s exports.

Enhancement of EAST plasma control capabilities

Energy Technology Data Exchange (ETDEWEB)

Xiao, Bingjia, E-mail: bjxiao@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei (China); Yuan, Qiping; Luo, Zhengping; Huang, Yao; Liu, Lei; Guo, Yong; Pei, Xiaofang; Chen, Shuliang [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Humphreys, D.A.; Hyatt, A.W. [General Atomics, P.O. Box 85608, San Diego, CA 92186-5608 (United States); Mueller, Dennis [Princeton Plasma Physics Laboratory, Princeton, NJ (United States); Calabró, G.; Crisanti, F. [ENEA UnitàTecnicaFusione, C.R. Frascati, Via E. Fermi 45, 00044 Frascati, Roma (Italy); Albanese, R.; Ambrosino, R. [CREATE, Università di Napoli Federicao II, Università di Cassino and Università di Napoli Parthenope, Via Claudio 19, 80125 Napoli (Italy)

2016-11-15

Highlights: • Parallel plasma equilibrium reconstruction using GPU for real-time control on EAST. • Vertical control using Bang-bang + PID method to improve the response and minimize the oscillation caused by the latency. • Quasi-snow flake divertor plasma configuration has been demonstrated on EAST. - Abstract: In order to improve the plasma control performance and enhance the capability for advanced plasma control, new algorithms such as PEFIT/ISOFLUX plasma shape feedback control, quasi-snowflake plasma shape development and vertical control under new vertical control power supply, have been implemented and experimentally tested and verified in EAST 2014 campaign. P-EFIT is a rewritten version of EFIT aiming at fast real-time equilibrium reconstruction by using GPU for parallelized computation. Successful control using PEFIT/ISOFLUX was established in dedicated experiment. Snowfldivertor plasma shape has the advantage of spreading heat over the divertor target and a quasi-snowflake (QSF) configuration was achieved in discharges with I{sub p} = 0.25 MA and B{sub t} = 1.8T, κ∼1.9, by plasma position feedback control. The shape feedback control to achieve QSF shape has been preliminary implemented by using PEFIT and the initial experimental test has been done. For more robust vertical instability control, the inner coil (IC) and its power supply have been upgraded. A new control algorithm with the combination of Bang-bang and PID controllers has been developed. It is shown that new vertical control power supply together with the new control algorithms results in higher vertical controllability.

Natural hybrids in the genus of Aloe (Aloeaceae) in East Africa ...

African Journals Online (AJOL)

Natural hybrids can arise in the genus Aloe because their chief pollinators, sunbirds, are not species-specific when feeding on nectar. From literature and the observations of the writer and others, 16 cases of known or suspected natural interspecific hybrids in East Africa are recorded. Journal of East African Natural History ...

Inexorable Conflict or Opportunity: The United States and the Middle East

Science.gov (United States)

2012-03-06

effects on Palestine and the rest of the Arab-Muslim Middle East, has been a “misjudgment of gigantic proportions,” according to Amin Saikal in his book...2009, but al-Qaeda still enjoys considerable support in the Muslim world.38 Additionally, statistics show that Muslims in the Middle East want U.S

Archaeological Investigations on the East Fork of the Salmon River, Custer County, Idaho.

Science.gov (United States)

1984-01-01

coniferous environment in addition to pine marten (Martes americana), red squirrel (Tamiasciurus hudsonicus), porcupine (Erithizon dorsatum), mountain vole...can be seen in small herds throughout the East Fork valley from the Salmon River to Big Boulder Creek. Two bands of Rocky Mountain bighorn sheep...utilize the Challis Planning Unit, one on the East Fork and the other in the Birch Creek area. The East Fork herd is comprised of approximately 50-70

East Africa’s Fragmented Security Cooperation

DEFF Research Database (Denmark)

Nordby, Johannes Riber; Jacobsen, Katja

2013-01-01

Since the 1990s, East Africa has developed what appears to be an impressive security architecture. Katja Lindskov Jacobsen and Johannes Riber Nordby warn, however, that appearances can be deceptive. The region’s security institutions remain too nationalistic and self-interested for their own good....

Sponges from Clipperton Island, East Pacific

NARCIS (Netherlands)

van Soest, R.W.M.; Kaiser, K.L.; van Syoc, R.

2011-01-01

Twenty sponge species (totalling 190 individuals) were collected during the 1938, 1994 and 2004/5 expeditions to the remote island of Clipperton in the East Pacific Ocean. Seven species are widespread Indo-Pacific sponges; nine species comprise sponges new to science; four species were represented

Middle East gas utilization and export potential

International Nuclear Information System (INIS)

Cornet-Gandolphe, S.

1995-01-01

There is huge gas supply potential in the Middle East, which possesses over one third of the world's natural gas reserves. However, marketed production represents only 6% of the world total, demonstrating that gas resources in the Middle East are under utilized. The value of these resources will be realized only if the gas finds a commercial outlet that guarantees proper return on investments for gas producers and the best possible use of this nonrenewable resource for governments. Apart from the chemical sector, which has provided a good outlet for natural gas, the development of natural gas resources in the region has been very limited historically, inhibited by many factors linked to the resource itself and to the characteristics of the region. However, natural gas in the Middle East is now at a crossroads, facing both major challenges and significant opportunities. The region, which currently plays only a marginal role on the world gas market, has the potential to become a leading world supplier, provided a number of political and economic conditions are fulfilled. This paper discusses some of the challenges that Middle Eastern countries face in trying to develop their natural gas resources. It reviews development potential for Middle Eastern gas reserves, whether for local use and/or exports, and it highlights future opportunities. (Author)

Crustal heat production and estimate of terrestrial heat flow in central East Antarctica, with implications for thermal input to the East Antarctic ice sheet

Science.gov (United States)

Goodge, John W.

2018-02-01

Terrestrial heat flow is a critical first-order factor governing the thermal condition and, therefore, mechanical stability of Antarctic ice sheets, yet heat flow across Antarctica is poorly known. Previous estimates of terrestrial heat flow in East Antarctica come from inversion of seismic and magnetic geophysical data, by modeling temperature profiles in ice boreholes, and by calculation from heat production values reported for exposed bedrock. Although accurate estimates of surface heat flow are important as an input parameter for ice-sheet growth and stability models, there are no direct measurements of terrestrial heat flow in East Antarctica coupled to either subglacial sediment or bedrock. As has been done with bedrock exposed along coastal margins and in rare inland outcrops, valuable estimates of heat flow in central East Antarctica can be extrapolated from heat production determined by the geochemical composition of glacial rock clasts eroded from the continental interior. In this study, U, Th, and K concentrations in a suite of Proterozoic (1.2-2.0 Ga) granitoids sourced within the Byrd and Nimrod glacial drainages of central East Antarctica indicate average upper crustal heat production (Ho) of about 2.6 ± 1.9 µW m-3. Assuming typical mantle and lower crustal heat flux for stable continental shields, and a length scale for the distribution of heat production in the upper crust, the heat production values determined for individual samples yield estimates of surface heat flow (qo) ranging from 33 to 84 mW m-2 and an average of 48.0 ± 13.6 mW m-2. Estimates of heat production obtained for this suite of glacially sourced granitoids therefore indicate that the interior of the East Antarctic ice sheet is underlain in part by Proterozoic continental lithosphere with an average surface heat flow, providing constraints on both geodynamic history and ice-sheet stability. The ages and geothermal characteristics of the granites indicate that crust in central

Application of DNA barcodes in wildlife conservation in Tropical East Asia.

Science.gov (United States)

Wilson, John-James; Sing, Kong-Wah; Lee, Ping-Shin; Wee, Alison K S

2016-10-01

Over the past 50 years, Tropical East Asia has lost more biodiversity than any tropical region. Tropical East Asia is a megadiverse region with an acute taxonomic impediment. DNA barcodes are short standardized DNA sequences used for taxonomic purposes and have the potential to lessen the challenges of biodiversity inventory and assessments in regions where they are most needed. We reviewed DNA barcoding efforts in Tropical East Asia relative to other tropical regions. We suggest DNA barcodes (or metabarcodes from next-generation sequencers) may be especially useful for characterizing and connecting species-level biodiversity units in inventories encompassing taxa lacking formal description (particularly arthropods) and in large-scale, minimal-impact approaches to vertebrate monitoring and population assessments through secondary sources of DNA (invertebrate derived DNA and environmental DNA). We suggest interest and capacity for DNA barcoding are slowly growing in Tropical East Asia, particularly among the younger generation of researchers who can connect with the barcoding analogy and understand the need for new approaches to the conservation challenges being faced. © 2016 Society for Conservation Biology.

Cnooc's fourth bidding round offers first tracts in East China Sea

International Nuclear Information System (INIS)

Ganapathy, V.

1992-01-01

This paper reports that China National Offshore Oil Corp. (Cnooc) has unveiled details of China's fourth offshore bidding round. It features the first offering of acreage in the East China Sea. Cnooc, China's state agency for offshore oil cooperation with foreign firms, has sweetened fiscal and tax terms for operators in the fourth round, announced June 30 (OGJ, July 6, Newsletter). Cnooc put up for bids two groups of acreage in the East China Sea that cover a total area of almost 73,000 sq km. The northern acreage, consisting of four blocks, covers 18,800 sq km and is 230 km east of Shanghai. The southern acreage, consisting of 16 blocks, covers 54,000 sq km and is 110 km east of Wenzhou, Zhejiang province. The area waters are 50-100 m deep and relatively calm year round. Chines explorationists have conducted 60,000 line km of seismic surveys and drilled five wildcats in the two areas, Data indicate the two areas have thick sediments, good source rocks, and strong conditions for oil traps

Investing in Port Infrastructure to Lower Trade Costs in East Asia

Directory of Open Access Journals (Sweden)

Kazutomo Abe

2011-06-01

Full Text Available We examine how port infrastructure affects trade and role of transport costs in driving exports and imports for East Asia. Existing studies use survey indexes to explain transport costs. These do not link investment in port infrastructure to transport costs. We include in our estimates a variable to represent the congestion of the ports to explain the transport costs. We find that the port congestion has significantly increased the transport costs from East Asia to the United States. Our analysis suggests that increase in port capacity by 10 percent could cut transport cost in East Asia by up to three percent. This translates into a 0.3 to 0.5 percent across-the-board tariff cut.

The Empirical Evidence on Government Bond Market Integration in East Asia

Directory of Open Access Journals (Sweden)

Lian Liu

2016-03-01

Full Text Available This research intends to investigate the progress made in East Asian bond market integration thus far. Price-based measures (AAD indicator and beta-convergence measure, quantity-based measures and econometric techniques (co-integration test, error correction model based Granger causality test are employed in the analysis. Even though East Asian government bond markets have become more integrated since 2001, the differentials among the markets still remain significantly high. The bond market integration process seems slow. The convergence of bond markets sped up in 2003 and after the 2008 world financial crisis, implying the important role of government policies in integrating the regional bond markets. East Asian bond market integration may need more government-directed measures.

Observations of the sub-inertial, near-surface East India Coastal Current

Science.gov (United States)

Mukhopadhyay, S.; Shankar, D.; Aparna, S. G.; Mukherjee, A.

2017-09-01

We present surface current measurements made using two pairs of HF (high-frequency) radars deployed on the east coast of India. The radar data, used in conjunction with data from acoustic Doppler current profiler (ADCP) measurements on the shelf and slope off the Indian east coast, confirm that the East India Coastal Current (EICC) flows poleward as a deep current during February-March. During the summer monsoon, when the EICC flows poleward, and October-December, when the EICC flows equatorward, the current is shallow (art Ocean General Circulation Model, run at a resolution of 0.1 ° × 0.1 ° , shows that the model is able to simulate only the low-frequency variability.

Forests of east Texas, 2016

Science.gov (United States)

Kerry Dooley

2018-01-01

This resource update provides an overview of forest resources in east Texas based on an inventory conducted by the U.S. Forest Service, Forest Inventory and Analysis (FIA) program at the Southern Research Station (SRS) in cooperation with Texas A&M Forest Service. The 254 counties of Texas are consolidated into seven FIA survey units—Southeast (unit 1),...

VLF modal interference distance and nighttime D region VLF reflection height for west-east and east-west propagation paths to Fiji

Science.gov (United States)

Chand, Atishnal Elvin; Kumar, Sushil

2017-08-01

Very low frequency (VLF) signals from navigational transmitters propagate through the Earth-ionosphere waveguide formed by the Earth and the lower conducting ionosphere and show the pronounced minima during solar terminator transition between transmitter and receiver. Pronounced amplitude minima observed on 19.8 kHz (NWC transmitter) and 24.8 kHz (NLK transmitter) signals recorded at Suva (18.149°S, 178.446°E), Fiji, during 2013-2014, have been used to estimate the VLF modal interference distance (DMS) and nighttime D region VLF reflection height (hN). The NWC transmitter signal propagates mostly in west-east direction, and the NLK transmitter follows a transequatorial path propagating significantly in the east-west direction. The values of DMS calculated using midpath terminator speed are 2103 ± 172 km and 2507 ± 373 km for these paths having west-east and east-west components of VLF subionospheric propagation, respectively, which agree with previously published results and within 10% with theoretical values. We have also compared the DMS estimated using a terminator time method with that calculated using terminator speed for a particular day and found both the values to be consistent. The hN values were found to be maximum during winter of Southern Hemisphere for NWC signal and winter of Northern Hemisphere for NLK signal VLF propagation paths to Suva. The hN also shows significant day-to-day and seasonal variabilities with a maximum of about 10 km and 23 km for NWC and NLK signal propagation paths, respectively, which could be due to the atmospheric gravity waves associated with solar terminator transition, as well as meteorological factors such as strong lightnings.

Teaching Media and Culture of the Middle East to American Students

Science.gov (United States)

Muhtaseb, Ahlam; Algan, Ece; Bennett, Anne

2014-01-01

Americans know very little about the Middle East in general despite the fact that the region is at the heart of American foreign policy. While no one doubts the importance of teaching the history, culture, and politics of the Middle East in the United States, lack of basic knowledge coupled with the strong antipathy toward Arabs and Muslims make…

"(East) Asia" as a Platform for Debate: Grouping and Bioethics.

Science.gov (United States)

Sleeboom-Faulkner, Margaret

This article examines the use of the notions of "Asian" and "East Asian" in definitions of bioethics. Using examples from East Asia, I argue that the verbal Asianization of bioethics is based on the notion of "Asia" as a family metaphor and serves as a platform of bioethical debate, networking, and political change. I maintain that the use of "Asia" and "East Asia" to shape bioethics is not so much a sign of inward-looking regionalism, but an attempt to build bridges among Asian countries, while putting up a common stance against what educated elites interpret as undesirable global trends of Westernization through bioethics. Using the notions of "grouping" and "segmentary systems" to show the performative nature of characterizations of (East) Asian bioethics, allowing users to mark regional identity, share meanings, take political positions, and network. Deploying Peter Haas's notion of "epistemic communities," I argue that academic and political elites translate "home" issues into "Asia speak," while at the same time, introducing and giving shape to "new" bioethical issues. Although the "Asianisms" and group-marking activities of Asian networks of bioethics are ideological, thereby engaging in the politics of in/exclusion, they succeed in putting politically sensitive topics on the agenda.

Zoning, 2004, East Baton Rouge Parish, Louisiana

Data.gov (United States)

Louisiana Geographic Information Center — This is a graphical polygon dataset depicting the zoning boundaries of the East Baton Rouge Parish of the State of Louisiana. Zoning can be defined as the range of...

Decoupled warming and monsoon precipitation in East Asia over the last deglaciation

NARCIS (Netherlands)

Peterse, F.; Prins, M.A.; Beets, C.J.; Troelstra, S.R.; Zheng, H.B.; Gu, Z.Y.; Schouten, S.; Sinninghe Damsté, J.S.

2011-01-01

Our understanding of the continental climate development in East Asia is mainly based on loess-paleosol sequences and summer monsoon precipitation reconstructions based on oxygen isotopes (delta O-18) of stalagmites from several Chinese caves. Based on these records, it is thought that East Asian

The nuclear age in the Middle East

International Nuclear Information System (INIS)

Yiftah, Shimon.

1976-01-01

The book analyses, clarifies and summarises, from various aspects, some of the many questions concerning the motivation, the meaning, the economics, the dangers and the risks of introducing nuclear technology into the Middle East area following the recent agreements between some Mid Eastern countries and the United States, France, Germany and the U.S.S.R. about the supply of nuclear power reactors and nuclear fuel to the Middle East. The recent strong nuclear prgrams of countries such as India and Iran, who have wide-ranging ties with the Mid-Eastern countries, coupled with the huge revenues of petrodollars by the Arab countries of the area, together with the dangers of another 1973-type oil embargo are discussed and the triple crises of energy, ecology and nuclear weapons proliferation are considered. (B.G.)

Online Plasma Shape Reconstruction for EAST Tokamak

International Nuclear Information System (INIS)

Luo Zhengping; Xiao Bingjia; Zhu Yingfei; Yang Fei

2010-01-01

An online plasma shape reconstruction, based on the offline version of the EFIT code and MPI library, can be carried out between two adjacent shots in EAST. It combines online data acquisition, parallel calculation, and data storage together. The program on the master node of the cluster detects the termination of the discharge promptly, reads diagnostic data from the EAST mdsplus server on the completion of data storing, and writes the results onto the EFIT mdsplus server after the calculation is finished. These processes run automatically on a nine-nodes IBM blade center. The total time elapsed is about 1 second to several minutes, depending on the duration of the shot. With the results stored in the mdsplus server, it is convenient for operators and physicists to analyze the behavior of plasma using visualization tools.

Seismicity of the Earth 1900-2013 East African Rift

Science.gov (United States)

Hayes, Gavin P.; Jones, Eric S.; Stadler, Timothy J.; Barnhart, William D.; McNamara, Daniel E.; Benz, Harley M.; Furlong, Kevin P.; Villaseñor, Antonio; Hayes, Gavin P.; Jones, Eric S.; Stadler, Timothy J.; Barnhart, William D.; McNamara, Daniel E.; Benz, Harley M.; Furlong, Kevin P.; Villaseñor, Antonio

2014-01-01

The East African Rift system (EARS) is a 3,000-km-long Cenozoic age continental rift extending from the Afar triple junction, between the horn of Africa and the Middle East, to western Mozambique. Sectors of active extension occur from the Indian Ocean, west to Botswana and the Democratic Republic of the Congo (DRC). It is the only rift system in the world that is active on a continent-wide scale, providing geologists with a view of how continental rifts develop over time into oceanic spreading centers like the Mid-Atlantic Ridge.

Gas and LNG trading hubs, hub indexation and destination flexibility in East Asia

International Nuclear Information System (INIS)

Shi, Xunpeng; Padinjare Variam, Hari Malamakkavu

2016-01-01

In the East Asian gas markets, issues like gas trading hubs, hub indexed pricing, and destination flexibility are being debated. This paper examines the impact of a change in East Asia's pricing benchmark and contract flexibility on the regional and global gas markets. The paper uses the Nexant World Gas Model, a linear program with global cost minimization as the objective. To our knowledge, this study on hub competition, price benchmark change and contract flexibility improvement in East Asia will be the first in the literature and have real policy relevance. The results show that both price benchmark change and contract flexibility improvements will create an overall benefit for the world and East Asia importers, but the impacts are different among exporters and importers. However, there is no evidence of competition among different benchmark hubs and no evidence that destination restrictions cause the “Asia Premium”. It implies that removal of destination clauses has higher priority than the change to hub indexation for Japan, Korea and Chinese Taipei, but both should be treated equally in China. The study also suggests that East Asian importers should cooperate among themselves and with exporters to facilitate the hub creation and contract changes in East Asia. - Highlights: •Gas trading hubs in Japan and China are not mutually exclusive. •Both price benchmark changes and contract flexibility improvements are beneficial. •The “Asian Premium” is not caused by destination restriction. •Destination flexibility is much more important than hub indexation in East Asia except China. •Hub indexation is as important as destination flexibility in China due to pipeline imports.

Protected Areas: Mixed Success in Conserving East Africa's Evergreen Forests

OpenAIRE

Pfeifer, Marion; Burgess, Neil D.; Swetnam, Ruth D.; Platts, Philip J.; Willcock, Simon; Marchant, Robert

2012-01-01

In East Africa, human population growth and demands for natural resources cause forest loss contributing to increased carbon emissions and reduced biodiversity. Protected Areas (PAs) are intended to conserve habitats and species. Variability in PA effectiveness and 'leakage' (here defined as displacement of deforestation) may lead to different trends in forest loss within, and adjacent to, existing PAs. Here, we quantify spatial variation in trends of evergreen forest coverage in East Africa ...

YUCCA MOUNTAIN SITE CHARACTERIZATION PROJECT EAST-WEST DRIFT SYSTEM SAFETY ANALYSIS

Energy Technology Data Exchange (ETDEWEB)

NA

1999-06-08

The purpose of this analysis is to systematically identify and evaluate hazards related to the design of the Yucca Mountain Project Exploratory Studies Facility (ESF) East-West Cross Drift. This analysis builds upon prior ESF System Safety Analyses and incorporates TS Main Drift scenarios, where applicable, into the East-West Drift scenarios. This System Safety Analysis (SSA) focuses on the personnel safety and health hazards associated with the engineered design of the East-West Drift. The analysis also evaluates other aspects of the East-West Drift, including purchased equipment (e.g., scientific mapping platform) or Systems/Structures/Components (SSCs) and out-of-tolerance conditions. In addition to recommending design mitigation features, the analysis identifies the potential need for procedures, training, or Job Safety Analyses (JSAs). The inclusion of this information in the SSA is intended to assist the organization(s) (e.g., constructor, Safety and Health, design) responsible for these aspects of the East-West Drift in evaluating personnel hazards and augment the information developed by these organizations. The SSA is an integral part of the systems engineering process, whereby safety is considered during planning, design, testing, and construction. A largely qualitative approach is used which incorporates operating experiences and recommendations from vendors, the constructor and the operating contractor. The risk assessment in this analysis characterizes the scenarios associated with East-West Drift SSCs in terms of relative risk and includes recommendations for mitigating all identified hazards. The priority for recommending and implementing mitigation control features is: (1) Incorporate measures to reduce risks and hazards into SSC designs. (2) Add safety features and capabilities to existing designs. (3) Develop procedures and conduct training to increase worker awareness of potential hazards, reduce exposure to hazards, and inform personnel of the

Sub-seasonal prediction over East Asia during boreal summer using the ECCC monthly forecasting system

Science.gov (United States)

Liang, Ping; Lin, Hai

2018-02-01

A useful sub-seasonal forecast is of great societal and economical value in the highly populated East Asian region, especially during boreal summer when frequent extreme events such as heat waves and persistent heavy rainfalls occur. Despite recent interest and development in sub-seasonal prediction, it is still unclear how skillful dynamical forecasting systems are in East Asia beyond 2 weeks. In this study we evaluate the sub-seasonal prediction over East Asia during boreal summer in the operational monthly forecasting system of Environment and Climate Change Canada (ECCC).Results show that the climatological intra-seasonal oscillation (CISO) of East Asian summer monsoonis reasonably well captured. Statistically significant forecast skill of 2-meter air temperature (T2m) is achieved for all lead times up to week 4 (days 26-32) over East China and Northeast Asia, which is consistent with the skill in 500 hPa geopotential height (Z500). Significant forecast skill of precipitation, however, is limited to the week of days 5-11. Possible sources of predictability on the sub-seasonal time scale are analyzed. The weekly mean T2m anomaly over East China is found to be linked to an eastward propagating extratropical Rossby wave from the North Atlantic across Europe to East Asia. The Madden-Julian Oscillation (MJO) and El Nino-Southern Oscillation (ENSO) are also likely to influence the forecast skill of T2m at the sub-seasonal timescale over East Asia.

Scopus: Journal of East African Ornithology: Contact

African Journals Online (AJOL)

Principal Contact. Darcy Ogada Dr Bird Committee of the East Africa Natural History Society. Editors,. Scopus,. c/o Nature Kenya,. P.O. Box 44486,. G.P.O. 00100,. Nairobi, Kenya. Email: scopus@naturekenya.org ...

Paralysis at the Top of a Roaring Volcano: Israel and the Schooling of Palestinians in East Jerusalem

Science.gov (United States)

Yair, Gad; Alayan, Samira

2009-01-01

Conflicts over East Jerusalem are often thought to reflect larger conflicts in the Middle East. In this article, the authors focus on schooling in East Jerusalem in order to provide a better appreciation of the protracted conflict in the area. This close examination of schooling in East Jerusalem can illuminate reasons for the political paralysis…

Impact of the Dominant Large-scale Teleconnections on Winter Temperature Variability over East Asia

Science.gov (United States)

Lim, Young-Kwon; Kim, Hae-Dong

2013-01-01

Monthly mean geopotential height for the past 33 DJF seasons archived in Modern Era Retrospective analysis for Research and Applications reanalysis is decomposed into the large-scale teleconnection patterns to explain their impacts on winter temperature variability over East Asia. Following Arctic Oscillation (AO) that explains the largest variance, East Atlantic/West Russia (EA/WR), West Pacific (WP) and El Nino-Southern Oscillation (ENSO) are identified as the first four leading modes that significantly explain East Asian winter temperature variation. While the northern part of East Asia north of 50N is prevailed by AO and EA/WR impacts, temperature in the midlatitudes (30N-50N), which include Mongolia, northeastern China, Shandong area, Korea, and Japan, is influenced by combined effect of the four leading teleconnections. ENSO impact on average over 33 winters is relatively weaker than the impact of the other three teleconnections. WP impact, which has received less attention than ENSO in earlier studies, characterizes winter temperatures over Korea, Japan, and central to southern China region south of 30N mainly by advective process from the Pacific. Upper level wave activity fluxes reveal that, for the AO case, the height and circulation anomalies affecting midlatitude East Asian winter temperature is mainly located at higher latitudes north of East Asia. Distribution of the fluxes also explains that the stationary wave train associated with EA/WR propagates southeastward from the western Russia, affecting the East Asian winter temperature. Investigation on the impact of each teleconnection for the selected years reveals that the most dominant teleconnection over East Asia is not the same at all years, indicating a great deal of interannual variability. Comparison in temperature anomaly distributions between observation and temperature anomaly constructed using the combined effect of four leading teleconnections clearly show a reasonable consistency between

Intraplate Earthquakes and Deformation within the East Antarctic Craton

Science.gov (United States)

Lough, A. C.; Wiens, D.; Nyblade, A.

2017-12-01

The apparent lack of tectonic seismicity within Antarctica has long been discussed. Explanations have ranged from a lack of intraplate stress due to the surrounding spreading ridges and low absolute plate velocity (Sykes, 1978), to the weight of ice sheets increasing the vertical normal stress (Johnston, 1987). The 26 station GAMSEIS/AGAP array deployed in East Antarctica from late 2008 to early 2010 provides the first opportunity to study the intraplate seismicity of the Antarctic interior using regional data. Here we report 27 intraplate tectonic earthquakes that occurred during 2009. Depth determination together with their corresponding uncertainty estimates, show that most events originate in the shallow to middle crust, indicating a tectonic and not a cryoseismic origin. The earthquakes are primarily located beneath linear alignments of basins adjacent to the Gamburtsev Subglacial Mountains (GSM) that have been denoted as the East Antarctic rift system (Ferraccioli et al, 2011). The geophysical properties of the `rift' system contrast sharply with those of the GSM and Vostok Subglacial Highlands on either side. Crustal thickness, seismic velocity, and gravity anomalies all indicate large lateral variation in lithospheric properties. We propose the events outline an ancient continental rift, a terrain boundary feature, or a combination of the two where rifting exploited pre-existing weakness. It is natural to draw parallels between East Antarctica and the St. Lawrence depression where rifting and a collisional suture focus intraplate earthquakes within a craton (Schulte and Mooney, 2005). We quantify the East Antarctic seismicity by developing a frequency-magnitude relation, constraining the lower magnitudes with the 2009 results and the larger magnitudes with 1982-2012 teleseismic seismicity. East Antarctica and the Canadian Shield show statistically indistinguishable b-values (near 1) and seismicity rates as expressed as the number of events with mb > 4 per

78 FR 24677 - Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY

Science.gov (United States)

2013-04-26

... Final Rule This rule establishes a temporary safety zone on the navigable waters of the East River, in... Fireworks, Pier 34, East River, NY. (a) Regulated Area. The following area is a temporary safety zone: all... 1625-AA00 Safety Zone; XA The Experimental Agency Fireworks, Pier 34, East River, NY AGENCY: Coast...

Conceptual design of EAST multi-purpose maintenance deployer system

International Nuclear Information System (INIS)

Pan, Hongtao; He, Kaihui; Cheng, Yong; Song, Yuntao; Yang, Yang; Villedieu, Eric; Shi, Shanshuang; Yang, Songzhu

2017-01-01

Highlights: • A redundant 11-DOF articulated robot for EAST in-vessel maintenance is presented. • A new modular joint developed to optimize the yaw joint actuator for the robot is described. • A 3-DOF gripper integrated with cameras and torque sensor is developed. - Abstract: EAST multi-purpose maintenance deployer (EMMD) system, being collaboratively developed by ASIPP and CEA-IRFM, is built as upgrades for EAMA. Updated kinematics parameters such as DOF distribution and joint angle for EMMD robot are performed and verified in a simulation platform. A new modular joint has been developed to optimize the yaw joint actuator for easy assembly and flexibility reduction. A 3-DOF gripper with cameras and torque sensor has been designed to provide inspection and dexterous handling of small fragments inside the EAST chamber. A conceptual upgrade for EAMA-CASK has been developed for the purpose of protecting the end-effector's sensors which do not have temperature-resistant qualification. The high temperature and vacuum compatible solutions and validation experiments have been presented in this paper.

Conceptual design of EAST multi-purpose maintenance deployer system

Energy Technology Data Exchange (ETDEWEB)

Pan, Hongtao [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui 230022 (China); He, Kaihui, E-mail: hekh@iterchina.cn [China International Nuclear Fusion Energy Program Execution Center, Beijing 100862 (China); Cheng, Yong [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); Song, Yuntao [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); University of Science and Technology of China, Hefei, Anhui 230022 (China); Yang, Yang [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China); Villedieu, Eric [CEA-IRFM, F-13108 Saint-Paul-Lez-Durance (France); Shi, Shanshuang; Yang, Songzhu [Institute of Plasma Physics, Chinese Academy of Sciences, 350 Shushanhu Rd, Hefei, Anhui (China)

2017-05-15

Highlights: • A redundant 11-DOF articulated robot for EAST in-vessel maintenance is presented. • A new modular joint developed to optimize the yaw joint actuator for the robot is described. • A 3-DOF gripper integrated with cameras and torque sensor is developed. - Abstract: EAST multi-purpose maintenance deployer (EMMD) system, being collaboratively developed by ASIPP and CEA-IRFM, is built as upgrades for EAMA. Updated kinematics parameters such as DOF distribution and joint angle for EMMD robot are performed and verified in a simulation platform. A new modular joint has been developed to optimize the yaw joint actuator for easy assembly and flexibility reduction. A 3-DOF gripper with cameras and torque sensor has been designed to provide inspection and dexterous handling of small fragments inside the EAST chamber. A conceptual upgrade for EAMA-CASK has been developed for the purpose of protecting the end-effector's sensors which do not have temperature-resistant qualification. The high temperature and vacuum compatible solutions and validation experiments have been presented in this paper.

Different Aspects of Regional Development in East-Central Europe

Directory of Open Access Journals (Sweden)

PÁL SZABÓ

2014-12-01

Full Text Available The aim of this paper is to explore and analyze the main characteristics of East-Central Europe’s spatial structure, including its changes during the recent years. In many territorial researches, there is an intention to define different types of regions and to establish territorial regularities, create models, etc. In this case, we analysed the regions of East-Central Europe based on their comprehensive socio-economic data and described the most important characteristics of the spatial structure of this macroregion from different perspectives. Some results show that the social and economic core areas are highly separated from each other and the development “image” of East-Central Europe has remained the same viewing from the aspects of bigger, homogenous areas, but became more mosaic with the appearance of some separated and improving regions, strengthening the model of the “Bunch of Grapes”, not the "Boomerang". Other results show that it is difficult to create a spatial structure model for this macroregion, because the results may depend on the viewpoints.

GRB follow-up observations in the East-Asian region

International Nuclear Information System (INIS)

Tamagawa, T.; Urata, Y.; Tokyo Institute of Technology, Tokyo; Huang, K. Y.; Ip, W.H.; Qiu, Y.; Hu, J.Y.; Zhou, Xn.; Onda, K.; Tokyo Univ. of Sciences, Tokyo; Makishima, K.; Tokyo Univ., Tokyo

2005-01-01

In 2004, we established a Japan-Taiwan-China collaboration for GBR study in the East-Asian region. This serves as a valuable addiction to the world-wide optical and infrared follow-up network, because the East-Asia region would otherwise be blank. We have been carrying out imaging and spectroscopy follow-up observations at Lulin (Taiwan), Kiso (Japan), WIDGET (Japan) and Xinglong (China). From Xinglong and Kiso, we can locate candidates and obtain early time spectra for afterglows. While WIDGET provides early time observations before the bursts, the high-time resolution for multi-band light curves can be obtained at Lulin. With the data from these sites, we can obtain detailed information about the light curve and redshift of GRBs, which are important to understand the mechanism of the afterglows. Up to March 2005, ten follow-up observations have been provided by this East-Asia cooperation. Two optical afterglows were detected, GRB 040924 and GRB 041006. The results of the two detected afterglows are reported in this paper

GRB follow-up observations in the East-Asian region

Energy Technology Data Exchange (ETDEWEB)

Tamagawa, T. [RIKEN, Saitama (Japan); Urata, Y. [RIKEN, Saitama (Japan); Tokyo Institute of Technology, Tokyo (Japan). Department of Physics; Huang, K. Y.; Ip, W.H. [National Centre University, Tokyo (Japan). Institute of Astronomy; Qiu, Y.; Hu, J.Y.; Zhou, Xn. [Chinese Academy of Sciences, Beijing (China). National Astronomical Observatoires; Onda, K. [RIKEN, Saitama (Japan); Tokyo Univ. of Sciences, Tokyo (Japan). Department of Physics; Makishima, K. [RIKEN, Saitama (Japan); Tokyo Univ., Tokyo (Japan). Department of Physics

2005-07-15

In 2004, we established a Japan-Taiwan-China collaboration for GBR study in the East-Asian region. This serves as a valuable addiction to the world-wide optical and infrared follow-up network, because the East-Asia region would otherwise be blank. We have been carrying out imaging and spectroscopy follow-up observations at Lulin (Taiwan), Kiso (Japan), WIDGET (Japan) and Xinglong (China). From Xinglong and Kiso, we can locate candidates and obtain early time spectra for afterglows. While WIDGET provides early time observations before the bursts, the high-time resolution for multi-band light curves can be obtained at Lulin. With the data from these sites, we can obtain detailed information about the light curve and redshift of GRBs, which are important to understand the mechanism of the afterglows. Up to March 2005, ten follow-up observations have been provided by this East-Asia cooperation. Two optical afterglows were detected, GRB 040924 and GRB 041006. The results of the two detected afterglows are reported in this paper.

78 FR 46855 - Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY

Science.gov (United States)

2013-08-02

... 1625-AA00 Safety Zone; East End Maritime Foundation Fireworks Display, Greenport Harbor, Greenport, NY... temporary rule proposes to establish a safety zone for the East End Maritime Foundation fireworks display....1. 0 2. Add Sec. 165.T01-0600 to read as follows: Sec. 165.T01-0600 Safety Zone; East End Maritime...

Scientific Communication | Okolo | East African Medical Journal

African Journals Online (AJOL)

East African Medical Journal. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 92, No 2 (2015) >. Log in or Register to get access to full text downloads.

Ky'osimba Onaanya: Understanding Productivity of East African Highland Banana

OpenAIRE

Taulya, G.

2016-01-01

Over 30 million people in East Africa depend on East African highland bananas for food and income. The bananas are grown with limited additions of nutrients and no irrigation, despite widespread poor soil fertility and regular dry seasons. This thesis describes the effect of increasing rainfall and application of potassium and nitrogen fertilizers on banana growth and yields. In areas that receive less than 1100 mm of rainfall per year, additional rainfall increases yields by 65%. Application...

Managing the Noodle Bowl: The Fragility of East Asian Regionalism

OpenAIRE

Baldwin, Richard E.

2007-01-01

The paper argues that East Asian regionalism is fragile, since (i) each nation's industrial competitiveness depends on the smooth functioning of "Factory Asia" — in particular, on intra-regional trade; (ii) the unilateral tariff-cutting that created "Factory Asia" is not subject to WTO discipline (bindings); (iii) there is no "top-level management" to substitute for WTO discipline, i.e., to ensure that bilateral trade tensions — tensions that are inevitable in East Asia — do not spillover int...

The Chinese Economy and Income Inequality among East Asian Countries

OpenAIRE

Sumie Sato; Mototsugu Fukushige

2010-01-01

Using the Atkinson inequality measure of income distribution, we analyze the impact of China as a single country and examine the effect of its domestic income inequality on total income inequality among East Asian countries. First, we find that China's domestic income inequality exacerbated income inequality among East Asian countries from the 1980s, and this effect became even more pronounced from 1990. Second, the growth of China's per capita GDP had an equalizing effect on income distribut...

Hardware-in-the-loop simulation of the EAST PF converter for PF control system upgrade

Energy Technology Data Exchange (ETDEWEB)

Chen, Xiaojiao, E-mail: chenxj@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Science (ASIPP), P.O. Box 1126, Hefei, Anhui Province 230031 (China); Chinese University of Science and Technology, Hefei, Anhui Province 230022 (China); Fu, Peng [Institute of Plasma Physics, Chinese Academy of Science (ASIPP), P.O. Box 1126, Hefei, Anhui Province 230031 (China); Chinese University of Science and Technology, Hefei, Anhui Province 230022 (China); Huang, Liansheng, E-mail: huangls@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Science (ASIPP), P.O. Box 1126, Hefei, Anhui Province 230031 (China); Gao, Ge; He, Shiying [Institute of Plasma Physics, Chinese Academy of Science (ASIPP), P.O. Box 1126, Hefei, Anhui Province 230031 (China)

2016-11-15

Highlights: • The hardware in the loop simulation of the EAST PF system is presented. • The control functions and the protection logic have been tested and verified. • The major faults could be avoided and commissioning time could be saved on site. - Abstract: The EAST poloidal field (PF) control system was upgraded in 2015 and the new system has been in use for the 2015 EAST campaign. This paper presents the implementation of a hardware-in-the-loop (HIL) simulation platform of the EAST PF converter system based on the RT-LAB simulation environment, which was used to improve and evaluate the performance of the real controller. The EAST PF power supply system and its operational modes are presented in this paper. The experiments on HIL simulation platform show that the control algorithms and the over current protection of the controller meet the design requirements well. In addition, the effectiveness of the designed control system has been verified by actual application during the EAST campaign at 2015 for six months.

Hardware-in-the-loop simulation of the EAST PF converter for PF control system upgrade

International Nuclear Information System (INIS)

Chen, Xiaojiao; Fu, Peng; Huang, Liansheng; Gao, Ge; He, Shiying

2016-01-01

Highlights: • The hardware in the loop simulation of the EAST PF system is presented. • The control functions and the protection logic have been tested and verified. • The major faults could be avoided and commissioning time could be saved on site. - Abstract: The EAST poloidal field (PF) control system was upgraded in 2015 and the new system has been in use for the 2015 EAST campaign. This paper presents the implementation of a hardware-in-the-loop (HIL) simulation platform of the EAST PF converter system based on the RT-LAB simulation environment, which was used to improve and evaluate the performance of the real controller. The EAST PF power supply system and its operational modes are presented in this paper. The experiments on HIL simulation platform show that the control algorithms and the over current protection of the controller meet the design requirements well. In addition, the effectiveness of the designed control system has been verified by actual application during the EAST campaign at 2015 for six months.

FISHERMEN ALLEVIATION POVERTY MODEL IN THE NORTH COASTAL EAST JAVA

Directory of Open Access Journals (Sweden)

Roziana Ainul Hidayati

2011-12-01

Full Text Available Poverty is a multidimensional problem that the approach to eradicate poverty must also be multidimensional. The study aims to formulate a model of poverty alleviation in coastal fishing in the North Coast of East Java. Grounded research approach used to determine the causes, impacts and implications of poverty fishermen. The results showed that the main cause of poverty that occurred in the three districts in East Java's north coast is different from one another. In Gresik district, the major cause of poverty is law enforcements that do not support fishermen and overfishing. While Lamongan more due to low fish prices and capital problems. While in Tuban fishermen due to limited infrastructure and lazy and extravagant lifestyle of the fishermen. These differences lead to different coping strategies so that later can form a concept model of poverty alleviation North Coast fishermen in East Java.

The nuclear power development program of south-east asian countries

International Nuclear Information System (INIS)

Yang, Maeng Ho; Lee, Tae Jun; Lee, Byung Jun

1996-08-01

The objective of this study is to investigate the status of nuclear policy environments and nuclear power programmes of South-east Asian countries which are emerging as major markets in the international nuclear industry. To do this, the study investigated seven South-east Asian countries which are especially expected to strengthen nuclear cooperation with our country : China, Indonesia, Thailand, Malaysia, Vietnam, India and the Philippines. Considering the above, the study concentrated upon the status and the environment of nuclear development, as well as its planning and regulatory structure including energy resource environments, energy development policy and planning, and the major problems in nuclear power development encountered by those counties. This study could be used to develop the national policy of nuclear technological cooperation and nuclear business with South-east Asian countries, which will be expected to develop active nuclear power programmes int eh future. 41 tabs., 9 figs., 49 refs. (Author)

The nuclear power development program of south-east asian countries

Energy Technology Data Exchange (ETDEWEB)

Yang, Maeng Ho; Lee, Tae Jun; Lee, Byung Jun [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

1996-08-01

The objective of this study is to investigate the status of nuclear policy environments and nuclear power programmes of South-east Asian countries which are emerging as major markets in the international nuclear industry. To do this, the study investigated seven South-east Asian countries which are especially expected to strengthen nuclear cooperation with our country : China, Indonesia, Thailand, Malaysia, Vietnam, India and the Philippines. Considering the above, the study concentrated upon the status and the environment of nuclear development, as well as its planning and regulatory structure including energy resource environments, energy development policy and planning, and the major problems in nuclear power development encountered by those counties. This study could be used to develop the national policy of nuclear technological cooperation and nuclear business with South-east Asian countries, which will be expected to develop active nuclear power programmes int eh future. 41 tabs., 9 figs., 49 refs. (Author).

Culture and aesthetic preference: comparing the attention to context of East Asians and Americans.

Science.gov (United States)

Masuda, Takahiko; Gonzalez, Richard; Kwan, Letty; Nisbett, Richard E

2008-09-01

Prior research indicates that East Asians are more sensitive to contextual information than Westerners. This article explored aesthetics to examine whether cultural variations were observable in art and photography. Study 1 analyzed traditional artistic styles using archival data in representative museums. Study 2 investigated how contemporary East Asians and Westerners draw landscape pictures and take portrait photographs. Study 3 further investigated aesthetic preferences for portrait photographs. The results suggest that (a) traditional East Asian art has predominantly context-inclusive styles, whereas Western art has predominantly object-focused styles, and (b) contemporary members of East Asian and Western cultures maintain these culturally shaped aesthetic orientations. The findings can be explained by the relation among attention, cultural resources, and aesthetic preference.

Seroprevalence of Toxocariasis in Children in East- Azerbaijan Province, Iran

Directory of Open Access Journals (Sweden)

Yagoob Garedaghi

2013-08-01

Full Text Available Purpose: Toxocariasis is a zoonotic disease caused by the ascarid of dogs and cats, the main representative of which is a Toxocara canis. Distribution of the disease is world wide and is more prevalent in children. The present study was carried out in children of East Azerbaijan Province, Iran, to determine the toxocariasis seropositivity. Material and Methods: For the present seroepidemiological study, blood samples were collected at random from children of all the five districts of the East Azerbaijan Province. A total of 336 children, 187 males and 149 females in age group of 0-15 years were selected for the present study. ELISA was used for detection of IgG antibodies against Toxocara excretory secretary antigen. A questionnaire interview was conducted to obtain the data concerning their age, sex and habits. The particular points in the questionnaire asked were recorded on the format right on the spot. Results: Gender was found to be a significant risk factor for the Toxocara infection in children population. Male children were found more infected (41.71% as compared to females (24.16%. The total seroprevalence of T. canis antibodies in children of East Azerbaijan Province was 29.46 %. The risk factors that were found associated with the infection of toxocariasis in children population of East Azerbaijan Province include family back ground, status of living conditions, awareness, etc. Conclusion: The present study reveals high prevalence of T. canis infection in children of East Azerbaijan Province. It is important to raise the awareness of health professionals, public and educators to the fact that toxocariasis is a public health problem. Health promotion by means of a school based educational approach, diagnosis and continuous programme of treatment are necessary. [Cukurova Med J 2013; 38(4.000: 581-586

Enhancement of seasonal prediction of East Asian summer rainfall related to the western tropical Pacific convection

Science.gov (United States)

Lee, D. Y.; Ahn, J. B.; Yoo, J. H.

2014-12-01

The prediction skills of climate model simulations in the western tropical Pacific (WTP) and East Asian region are assessed using the retrospective forecasts of seven state-of-the-art coupled models and their multi-model ensemble (MME) for boreal summers (June-August) during the period 1983-2005, along with corresponding observed and reanalyzed data. The prediction of summer rainfall anomalies in East Asia is difficult, while the WTP has a strong correlation between model prediction and observation. We focus on developing a new approach to further enhance the seasonal prediction skill for summer rainfall in East Asia and investigate the influence of convective activity in the WTP on East Asian summer rainfall. By analyzing the characteristics of the WTP convection, two distinct patterns associated with El Niño-Southern Oscillation (ENSO) developing and decaying modes are identified. Based on the multiple linear regression method, the East Asia Rainfall Index (EARI) is developed by using the interannual variability of the normalized Maritime continent-WTP indices (MPIs), as potentially useful predictors for rainfall prediction over East Asia, obtained from the above two main patterns. For East Asian summer rainfall, the EARI has superior performance to the East Asia summer monsoon index (EASMI) or each MP index (MPI). Therefore, the regressed rainfall from EARI also shows a strong relationship with the observed East Asian summer rainfall pattern. In addition, we evaluate the prediction skill of the East Asia reconstructed rainfall obtained by statistical-empirical approach using the cross-validated EARI from the individual models and their MME. The results show that the rainfalls reconstructed from simulations capture the general features of observed precipitation in East Asia quite well. This study convincingly demonstrates that rainfall prediction skill is considerably improved by using the statistical-empirical method compared to the dynamical models

New aerogeophysical views of crustal architecture in the Recovery frontier of East Antarctica

Science.gov (United States)

Ferraccioli, Fausto; Forsberg, Rene; Jordan, Tom; Matsuoka, Kenichi; Olsen, Arne; King, Owen; Ghidella, Marta

2014-05-01

East Antarctica is the least known continent on Earth, despite being regarded as a keystone in Gondwana, Rodinia and possibly Columbia supercontinents. Significant progress has however been made in recent years in the exploration of East Antarctica using airborne geophysical techniques. Spurred by the International Polar Year major collaborative aerogeophysical campaigns have been performed over the Wilkes Subglacial Basin, the Aurora Subglacial Basin and the Gamburtsev Subglacial Mountains. Analyses of these recent datasets is providing fundamental new glimpses into the crustal architecture in interior East Antarctica, as well as several new interpretations regarding its linkages with tectonic and geodynamic evolution from the Precambrian to the Mesozoic. Here we present the first results of a major reconnaissance aerogeophysical survey over the largely unexplored Recovery ice stream catchment in East Antarctica, flown during the IceGRAV 2012-13 field season, as part of a new international Danish, Norwegian, UK and Argentine collaboration. Over 29,000 line km of new radio-echo sounding, laser altimetry, gravity and magnetic data were acquired using a British Antarctic Survey Twin Otter. We will focus primarily on presenting the new potential field datasets and discuss the anomaly patterns seen in aeromagnetic anomaly maps, free air, Bouguer and isostatic residual maps. The aerogeophysical datasets we will present provide a new foundation to address a cascade of open questions regarding this part of East Antarctica, including: i) Where are and what is the nature of the major tectonic boundaries separating the Coast block, the Shackleton Range and the Dronning Maud Land crustal provinces? Specifically is there new geophysical evidence in support of a Pan-African age suture zone in the Shackleton Range linked to Gondwana assembly?; ii) is there evidence in support of an older Grenvillian-age orogenic belt, extending across the interior of East Antarctica?; Or, is

Regimes of Diurnal Variation of Summer Rainfall over Subtropical East Asia

Energy Technology Data Exchange (ETDEWEB)

Yuan W.; Lin W.; Yu, R.; Zhang, M.; Chen, H.; Li, J.

2012-05-01

Using hourly rain gauge records and Tropical Rainfall Measuring Mission 3B42 from 1998 to 2006, the authors present an analysis of the diurnal characteristics of summer rainfall over subtropical East Asia. The study shows that there are four different regimes of distinct diurnal variation of rainfall in both the rain gauge and the satellite data. They are located over the Tibetan Plateau with late-afternoon and midnight peaks, in the western China plain with midnight to early-morning peaks, in the eastern China plain with double peaks in late afternoon and early morning, and over the East China Sea with an early-morning peak. No propagation of diurnal phases is found from the land to the ocean across the coastlines. The different diurnal regimes are highly correlated with the inhomogeneous underlying surface, such as the plateau, plain, and ocean, with physical mechanisms consistent with the large-scale 'mountain-valley' and 'land-sea' breezes and convective instability. These diurnal characteristics over subtropical East Asia can be used as diagnostic metrics to evaluate the physical parameterization and hydrological cycle of climate models over East Asia.

Controllability study of EAST plasma vertical instability and improvement in future

International Nuclear Information System (INIS)

Liu, L.; Xiao, B.J.; Humphreys, D.A.; Luo, Z.P.; Chen, S.L.

2014-01-01

Highlights: • The discontinuous passive plate model is developed and verified by experiment. • The power supply upgrade requirements for VDE control are evaluated. • We investigate efficacy of internal control coil location for VDE control. • Maximum controllable vertical displacement experiments are done. • EAST VDE controllability is roughly given by VDE experiments. - Abstract: In order to enhance control speed, each up/down Cu passive plate in EAST is cut into 8 pieces. These discontinuous plate segments are still connected to the inner vacuum vessel by steel supporting legs. A model of this plate segments-vessel-supporting leg loop is developed and verified by EAST vertical displacement event (VDE) experiments. The internal coil (IC) power supply requirements for VDE control are also evaluated. In particularly, we investigate the efficacy of internal control coil location to minimize the power supply capability. The IC power supply upgrade requirements for the optimized location and actual location are discussed. VDE experiments to evaluate maximum controllable vertical displacement (dZmax) were done with varying elongation and resulting EAST vertical controllability estimates are summarized here. These experimental results verified previous simulation results that present IC power supply capacity cannot provide robust vertical control

Controllability study of EAST plasma vertical instability and improvement in future

Energy Technology Data Exchange (ETDEWEB)

Liu, L., E-mail: liulei@ipp.ac.cn [University of Science and Technology of China, Hefei (China); Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Xiao, B.J., E-mail: bjxiao@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); University of Science and Technology of China, Hefei (China); Humphreys, D.A., E-mail: dave.humphreys@gat.com [General Atomics, PO Box 85608, San Diego, CA 92186-5608 (United States); Luo, Z.P., E-mail: zhpluo@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Chen, S.L., E-mail: slchen@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China)

2014-05-15

Highlights: • The discontinuous passive plate model is developed and verified by experiment. • The power supply upgrade requirements for VDE control are evaluated. • We investigate efficacy of internal control coil location for VDE control. • Maximum controllable vertical displacement experiments are done. • EAST VDE controllability is roughly given by VDE experiments. - Abstract: In order to enhance control speed, each up/down Cu passive plate in EAST is cut into 8 pieces. These discontinuous plate segments are still connected to the inner vacuum vessel by steel supporting legs. A model of this plate segments-vessel-supporting leg loop is developed and verified by EAST vertical displacement event (VDE) experiments. The internal coil (IC) power supply requirements for VDE control are also evaluated. In particularly, we investigate the efficacy of internal control coil location to minimize the power supply capability. The IC power supply upgrade requirements for the optimized location and actual location are discussed. VDE experiments to evaluate maximum controllable vertical displacement (dZmax) were done with varying elongation and resulting EAST vertical controllability estimates are summarized here. These experimental results verified previous simulation results that present IC power supply capacity cannot provide robust vertical control.

Prediction of East African Seasonal Rainfall Using Simplex Canonical Correlation Analysis.

Science.gov (United States)

Ntale, Henry K.; Yew Gan, Thian; Mwale, Davison

2003-06-01

A linear statistical model, canonical correlation analysis (CCA), was driven by the Nelder-Mead simplex optimization algorithm (called CCA-NMS) to predict the standardized seasonal rainfall totals of East Africa at 3-month lead time using SLP and SST anomaly fields of the Indian and Atlantic Oceans combined together by 24 simplex optimized weights, and then `reduced' by the principal component analysis. Applying the optimized weights to the predictor fields produced better March-April-May (MAM) and September-October-November (SON) seasonal rain forecasts than a direct application of the same, unweighted predictor fields to CCA at both calibration and validation stages. Northeastern Tanzania and south-central Kenya had the best SON prediction results with both validation correlation and Hanssen-Kuipers skill scores exceeding +0.3. The MAM season was better predicted in the western parts of East Africa. The CCA correlation maps showed that low SON rainfall in East Africa is associated with cold SSTs off the Somali coast and the Benguela (Angola) coast, and low MAM rainfall is associated with a buildup of low SSTs in the Indian Ocean adjacent to East Africa and the Gulf of Guinea.

Detrital Zircons Split Sibumasu in East Gondwana

Science.gov (United States)

Zhang, X.; Chung, S. L.

2017-12-01

It is widely accepted that Sibumasu developed as a united terrane and originated from NW Australian margin in East Gondwana. Here we report new detrital zircon U-Pb-Hf isotopic data from Sumatra that, in combination with literature data, challenge and refute the above long-held view. In particular, the East and West Sumatra terranes share nearly identical Precambrian to Paleozoic detrital zircon age distributions and Hf isotopes, indicating a common provenance/origin for them. The Sumatra detrital zircons exhibit a prominent population of ca. 1170-1070 Ma, indistinguishable from those of the Lhasa and West Burma terranes, with detritus most probably sourcing from western Australia. By contrast, Sibuma (Sibumasu excluding Sumatra) detrital zircons display a prevailing population of ca. 980-935 Ma, strongly resembling those of the western Qiangtang terrane, with detrital materials most likely derived from Greater India and Himalayas. Such markedly distinct detrital zircon age profiles between Sumatra and Sibuma require disparate sources/origin for them, provoking disintegration of the widely-adopted, but outdated, term Sibumasu and thus inviting a new configuration of East Gondwana in the early Paleozoic, with Sumatra and West Burma lying outboard the Lhasa terrane in the NW Australian margin and Sibuma situated in the northern Greater Indian margin. More future investigations are needed to establish the precise rifting and drifting histories of Sumatra and Sibuma, as two separated terranes, during the breakup of Gondwana.

Joint stockpiling and emergency sharing of oil: Arrangements for regional cooperation in East Asia

Energy Technology Data Exchange (ETDEWEB)

Shin, Eui-soon, E-mail: shine@yonsei.ac.k [School of Economics, Yonsei University, 50 Yonsei-ro, Seodaemun-gu, Seoul 120-749 (Korea, Republic of); Savage, Tim, E-mail: seoul@nautilus.or [Nautilus Institute, 58-14 Shinmun-ro 1-ga, Hangeul Hall Room 503, Jongro-gu, Seoul 110-061 (Korea, Republic of)

2011-05-15

The East Asia region includes three of the world's top five oil-importing nations-China, Japan, and the Republic of Korea. As a consequence, international oil supply disruptions and oil price spikes, and their effects on the economies of the region, have historically been of significant concern. Each of these three nations, as well as other nations in East Asia, has developed or is developing their own strategic oil stockpiles, but regional coordination in stockpiling arrangements and sharing of oil stocks in an emergency could provide significant benefits. This article describes the overall oil supply security situation in East Asia, reviews the attributes of different stockpiling arrangements to address energy supply security concerns, summarizes ongoing national approaches to stockpiling in East Asia, describes the development of joint oil stockpile initiatives in the region, and suggests the most attractive options for regional cooperation on oil stockpiling issues. - Highlights: {yields} Rising oil consumption will make East Asia more vulnerable to energy insecurity. {yields} There have been various dialogs on the need for a joint regional oil stockpile. {yields} No serious joint oil stockpiling efforts have been made in East Asia to date. {yields} Despite various impediments, diverse benefits justify oil stockpile cooperation.

Joint stockpiling and emergency sharing of oil: Arrangements for regional cooperation in East Asia

International Nuclear Information System (INIS)

Shin, Eui-soon; Savage, Tim

2011-01-01

The East Asia region includes three of the world's top five oil-importing nations-China, Japan, and the Republic of Korea. As a consequence, international oil supply disruptions and oil price spikes, and their effects on the economies of the region, have historically been of significant concern. Each of these three nations, as well as other nations in East Asia, has developed or is developing their own strategic oil stockpiles, but regional coordination in stockpiling arrangements and sharing of oil stocks in an emergency could provide significant benefits. This article describes the overall oil supply security situation in East Asia, reviews the attributes of different stockpiling arrangements to address energy supply security concerns, summarizes ongoing national approaches to stockpiling in East Asia, describes the development of joint oil stockpile initiatives in the region, and suggests the most attractive options for regional cooperation on oil stockpiling issues. - Highlights: → Rising oil consumption will make East Asia more vulnerable to energy insecurity. → There have been various dialogs on the need for a joint regional oil stockpile. → No serious joint oil stockpiling efforts have been made in East Asia to date. → Despite various impediments, diverse benefits justify oil stockpile cooperation.

The Middle East and the Development of a Natural Gas World Market

International Nuclear Information System (INIS)

Honore, Anouk

2006-01-01

Gas resources can easily meet the projected increase in global demand. However, international trade in energy will need to expand to accommodate the growing mismatch between the location of demand or production. The Middle East nations emerge among the leading countries, with a reserve to production ratios exceeding 100 years. Although some have significant domestic consumption, this mostly leaves ample potential for exports. Most of the incremental output in the Middle East will be exported to North America, Europe and Asia, where indigenous production will fall behind demand on the short to medium term. The key question is whether the Middle East can live up to the consuming countries' supply expectations

Cultural Adaptations to Environmental Variability: An Evolutionary Account of East-West Differences

Science.gov (United States)

Chang, Lei; Mak, Miranda C. K.; Li, Tong; Wu, Bao Pei; Chen, Bin Bin; Lu, Hui Jing

2011-01-01

Much research has been conducted to document and sometimes to provide proximate explanations (e.g., Confucianism vs. Western philosophy) for East-West cultural differences. The ultimate evolutionary mechanisms underlying these cross-cultural differences have not been addressed. We propose in this review that East-West cultural differences (e.g.,…

When West Meets East: Generalizing Theory and Expanding the Conceptual Toolkit of Criminology.

Science.gov (United States)

Messner, Steven F

2015-06-01

This paper considers the ways in which established criminological theories born and nurtured in the West might need to be transformed to be applicable to the context of East Asian societies. The analyses focus on two theoretical perspectives-Situational Action Theory and Institutional Anomie Theory-that are located at opposite ends of the continuum with respect to levels of analysis. I argue that the accumulated evidence from cross-cultural psychology and criminological research in East Asian societies raises serious questions about the feasibility of simply transporting these perspectives from the West to the East. Instead, my analyses suggest that the formulation of theoretical explanations of crime that are truly universal will require criminologists to create and incorporate new concepts that are more faithful to the social realities of non-Western societies, societies such as those in East Asia and Asia more generally.

Critically Ill Patients With the Middle East Respiratory Syndrome: A Multicenter Retrospective Cohort Study.

Science.gov (United States)

Arabi, Yaseen M; Al-Omari, Awad; Mandourah, Yasser; Al-Hameed, Fahad; Sindi, Anees A; Alraddadi, Basem; Shalhoub, Sarah; Almotairi, Abdullah; Al Khatib, Kasim; Abdulmomen, Ahmed; Qushmaq, Ismael; Mady, Ahmed; Solaiman, Othman; Al-Aithan, Abdulsalam M; Al-Raddadi, Rajaa; Ragab, Ahmed; Al Mekhlafi, Ghaleb A; Al Harthy, Abdulrahman; Kharaba, Ayman; Ahmadi, Mashael Al; Sadat, Musharaf; Mutairi, Hanan Al; Qasim, Eman Al; Jose, Jesna; Nasim, Maliha; Al-Dawood, Abdulaziz; Merson, Laura; Fowler, Robert; Hayden, Frederick G; Balkhy, Hanan H

2017-10-01

To describe patient characteristics, clinical manifestations, disease course including viral replication patterns, and outcomes of critically ill patients with severe acute respiratory infection from the Middle East respiratory syndrome and to compare these features with patients with severe acute respiratory infection due to other etiologies. Retrospective cohort study. Patients admitted to ICUs in 14 Saudi Arabian hospitals. Critically ill patients with laboratory-confirmed Middle East respiratory syndrome severe acute respiratory infection (n = 330) admitted between September 2012 and October 2015 were compared to consecutive critically ill patients with community-acquired severe acute respiratory infection of non-Middle East respiratory syndrome etiology (non-Middle East respiratory syndrome severe acute respiratory infection) (n = 222). None. Although Middle East respiratory syndrome severe acute respiratory infection patients were younger than those with non-Middle East respiratory syndrome severe acute respiratory infection (median [quartile 1, quartile 3] 58 yr [44, 69] vs 70 [52, 78]; p < 0.001), clinical presentations and comorbidities overlapped substantially. Patients with Middle East respiratory syndrome severe acute respiratory infection had more severe hypoxemic respiratory failure (PaO2/FIO2: 106 [66, 160] vs 176 [104, 252]; p < 0.001) and more frequent nonrespiratory organ failure (nonrespiratory Sequential Organ Failure Assessment score: 6 [4, 9] vs 5 [3, 7]; p = 0.002), thus required more frequently invasive mechanical ventilation (85.2% vs 73.0%; p < 0.001), oxygen rescue therapies (extracorporeal membrane oxygenation 5.8% vs 0.9%; p = 0.003), vasopressor support (79.4% vs 55.0%; p < 0.001), and renal replacement therapy (48.8% vs 22.1%; p < 0.001). After adjustment for potential confounding factors, Middle East respiratory syndrome was independently associated with death compared to non-Middle East respiratory syndrome severe acute respiratory

ISLAM AND THE FAILURE OF MODERNIZATION IN THE MIDDLE EAST

Directory of Open Access Journals (Sweden)

Ahmad Sahide

2012-12-01

Full Text Available This paper tries to see the encounter between Islam and modernity in the countries where the majority of the inhabitants are Muslims, particularly in the Middle East that is currently in the state of turmoil. In General, modernity failed to adapt to the Islamic states, for example the failure of democracy, which became the current joint attention in some Arab countries where the iron fist regimes are still a part of the political system. Furthermore, this paper attempts to see why modernity is difficult to adapt itself in the Middle East which began to build relations with Europe in the 18th century. Bernard Lewis, an expert who focuses on the Islamic world, argued that the failure of modernity in the Middle East and Islamic countries because of cultural factors and understanding of religion that hampered the pace of modernity. The understanding of religion is still centered on debating the democratic system and gender equality which come from the West; all of which is part of modernity. In addition, the young generations that learn a lot from the West, are not given broader space to apply their knowledge in developing and setting up a system of nationhood and statehood. These are the core issues that will be discussed further in this paper. Keywords: Modernity, Middle East tensions, and Islam

Negotiated Peripherality in Iron Age Greece: Accepting and Resisting the East

Directory of Open Access Journals (Sweden)

Ian Morris

2015-08-01

Full Text Available Most archaeologists argue that the Aegean was cut off from the Near East in the tenth century B.C., but a new position is winning favor, seeing Iron Age Greece as a periphery to a Lcvantinc core. In this paper, I argue for a more complex model of negotiated peripherality. I try to understand how Greeks made sense of the East. For this, variations in local leadership were crucial Political changes in the Near East c. 1050 B.C. reduced contacts, and in the central Aegean, a new mythology emerged, stressing isolation in time and space and making sense of these shrinking horizons. People deliberately emphasized isolation in ritual, with one exception, a remarkable burial at Lefkandi c. 975 B.C. This inverted normal symbolic practices, using Orientalizing antiques and burial customs which throughout the first millennium were linked to the idea of a vanished race of semidivine heroes. This opposition between an inward-turned present and an expansionist past remained central to ancient Greek social structure..The tenth-century world-view explained isolation and decline; but I concentrate on the ninth century, in which contacts revived. I argue that some leaders struggled to preserve the model of isolation, while others embraced the East, or sought compromise. I trace these style wars at five sites, showing how the use of orientalia generally declined after 850 B.C., although Greek contact with Syria intensified. By 800 B.C. Greeks had negotiated among themselves a new relationship to the Near East, making it less threatening to the traditional order.

Review and meta analysis of nontuberculous mycobacteria in the Middle East

Directory of Open Access Journals (Sweden)

Sanaz Rahideh

2015-01-01

Conclusion: This is the first study reporting NTM species in the Middle East. In summary, this review demonstrates that the frequency of NTM has increased in this region. In addition to the limitations of the NTM study in some countries of the Middle East, there is an urgent need to develop laboratory methods for NTM identification to prepare a comprehensive report for this region.

The Water Conflict in the Middle East

National Research Council Canada - National Science Library

1997-01-01

The water conflict in the Middle East is reaching a crisis peak. The region suffers from a shortage of water, a high rate of population growth and the absence of a clear criteria for sharing waters within the region...

Turkey’s Arabian Middle East Policy and Syrian Civil War

OpenAIRE

AKILLI, Erman

2017-01-01

TheMiddle East was remolded when the Ottoman Empire was divided through the SykesPicot Agreement, prepared by Great Britain and France on 19 May, 1916. Whilethe Arabs had expected to gain absolute freedom and from the empire, historyunfortunately has shown that this was merely a tale well suited to the ArabianNights. That agreement erased one region, replacing it with another; and theMiddle East has primarily been ruled since then under totalitarian regimes, atleast until the so-called Arab S...

The Strategic Positioning of Australian Research Universities in the East Asian Region

Science.gov (United States)

Marginson, Simon

2015-01-01

Regional tendencies in higher education are increasingly important, for example the common rise of North-East Asian universities in China, Hong Kong SAR, Taiwan and South Korea, and Singapore in South-East Asia, to a major global role, following the prior trajectory of Japan. Though the rapidly modernizing Post-Confucian countries do not…

An isotope trace element study of the East Greenland Tertiary dyke swarm

DEFF Research Database (Denmark)

Hanghøj, Karen; Storey, Michael; Stecher, Ole

2003-01-01

Dykes of the East Greenland Tertiary dyke swarm can be divided into pre- and syn-break-up tholeiitic dykes, and post-break-up transitional dykes. Of the pre- and syn-break-up dykes, the most abundant group (Tholeiitic Series; TS) has major element compositions similar to the main part of the East...

Social Welfare in East and West – A Tranquilizer for Dialogue

DEFF Research Database (Denmark)

Juego, Bonn; Schmidt, Johannes Dragsbæk

Policies in Southeast Asia (Thailand and Indonesia in particular, but also Malaysia and the Philippines) in a comparative perspective with the East Asian experience (Japan, Korea and Taiwan - excl. labor), and the Scandinavian experience with corporatism (incl. labor). Are there lessons to be lea......Policies in Southeast Asia (Thailand and Indonesia in particular, but also Malaysia and the Philippines) in a comparative perspective with the East Asian experience (Japan, Korea and Taiwan - excl. labor), and the Scandinavian experience with corporatism (incl. labor). Are there lessons...... definite conclusions or policy prescriptions. As a matter of fact, in terms of social welfare, equity and labor market policies the pre-crisis model of East Asia might offer lessons for the West and vice versa. Mutual learning and dialogue must be the key for future understanding and cooperation....

Ethnic entrepreneurship and internationalisation in East Africa

NARCIS (Netherlands)

Leendert de Bell; Hein Roelfsema; Khalidi Swabiri

Using the World Bank Enterprise Surveys panel data for the East African Community, this paper analyses the influence of ethnic origin of entrepreneurs on internationalisation and firm performance. Using traditional probit and OLS estimation techniques in combination with matching strategies to

Transmission of Middle East respiratory syndrome coronavirus ...

African Journals Online (AJOL)

... hand hygiene, and cough etiquette, would minimize the infection rate among HCPs. The required consumables for maintaining hand hygiene should be readily available to all HCPs. Keywords: Middle East respiratory syndrome coronavirus (MERS-CoV), Systematic review, healthcareassociated infections, Coronaviruses ...

The Middle East WMDFZ: hopes and fears

International Nuclear Information System (INIS)

Hautecouverture, Benjamin

2014-05-01

The 3. Preparatory Committee (PrepCom) for the 2015 Nuclear Non-Proliferation Treaty (NPT) Review Conference took place in New York between 28 April and 9 May 2014. Despite the failure to hold a conference in Helsinki in 2013 on a zone free of weapons of mass destruction and their delivery systems (WMDFZ) in the Middle East, due to a lack of consensus among States, the issue of the Middle East did not unduly disrupt this year's round of debates. This is in contrast to the Geneva PrepCom in the spring of 2013, where the Egyptian delegation's decision to leave the second session before the close first checked the momentum generated by the adoption of the 2010 Action Plan. The argument put forward by the Egyptian delegation was the lack of progress on the implementation of a commitment in the document to bring together all of the States in the region at a conference in 2012 on the Middle East WMDFZ project with the support of a facilitator. Although bilateral and multilateral (the Glion process) negotiations are in progress out of the spotlight under the auspices of Ambassador Laajava on both the agenda and outcome of a future conference, as well as on its procedural aspects, it is impossible to say with any certainty that a conference in Helsinki bringing together all of the States in the region will take place before the 2015 NPT Review Conference. One of the principal weaknesses of the Middle East WMDFZ project is its inscription almost twenty years ago in the framework of the NPT (with the resolution 'on the Middle East' of the 1995 Review and Extension Conference). The fact that Israel, a key State in the region, was absent at that time and is still absent today has naturally hindered the progress of this issue from review conference to review conference. The NPT forum is clearly inappropriate for dealing with the multiple regional security issues involved in the project. Yet, no alternative to the NPT currently exists, despite the fact that the real substance of

Environmental Impact Research Program. Ruffed Grouse (Bonasa umbellus) Section 4.1.1, US Army Corps of Engineers Wildlife Resources Management Manual.

Science.gov (United States)

1986-07-01

tors in most populations (Edminster 1954, Gullion and Marshall 1968). However, hunting may depress grouse numbers on areas that receive intensive...in the diversity of ruffed grouse diets. Clover and other green leafy material and the fruits of Arctostaphylos, cranberry , and meadow rue contribute...Christmas fern Polystichum acrostichoides Clover Trifoliwn spp. Cranberry Viburnum edule Dandelion Taraxaum spp. Dogwood Corfus spp. Douglas fir Pseudotsuga

The East Greenland rifted volcanic margin

Directory of Open Access Journals (Sweden)

C. Kent Brooks

2011-12-01

Full Text Available The Palaeogene North Atlantic Igneous Province is among the largest igneous provinces in the world and this review of the East Greenland sector includes large amounts of information amassed since previous reviews around 1990.The main area of igneous rocks extends from Kangerlussuaq (c. 67°N to Scoresby Sund (c. 70°N, where basalts extend over c. 65 000 km2, with a second area from Hold with Hope (c. 73°N to Shannon (c. 75°N. In addition, the Ocean Drilling Project penetrated basalt at five sites off South-East Greenland. Up to 7 km thickness of basaltic lavas have been stratigraphically and chemically described and their ages determined. A wide spectrum of intrusions are clustered around Kangerlussuaq, Kialeeq (c. 66°N and Mesters Vig (c. 72°N. Layered gabbros are numerous (e.g. the Skaergaard and Kap Edvard Holm intrusions, as are under- and oversaturated syenites, besides small amounts of nephelinite-derived products, such as the Gardiner complex (c. 69°N with carbonatites and silicate rocks rich in melilite, perovskite etc. Felsic extrusive rocks are sparse. A single, sanidine-bearing tuff found over an extensive area of the North Atlantic is thought to be sourced from the Gardiner complex.The province is famous for its coast-parallel dyke swarm, analogous to the sheeted dyke swarm of ophiolites, its associated coastal flexure, and many other dyke swarms, commonly related to central intrusive complexes as in Iceland. The dyke swarms provide time markers, tracers of magmatic evolution and evidence of extensional events. A set of dykes with harzburgite nodules gives unique insight into the Archaean subcontinental lithosphere.Radiometric dating indicates extrusion of huge volumes of basalt over a short time interval, but the overall life of the province was prolonged, beginning with basaltic magmas at c. 60 Ma and continuing to the quartz porphyry stock at Malmbjerg (c. 72°N at c. 26 Ma. Indeed, activity was renewed in the Miocene with

North-East Asian Super Grid: Renewable energy mix and economics

Science.gov (United States)

Breyer, Christian; Bogdanov, Dmitrii; Komoto, Keiichi; Ehara, Tomoki; Song, Jinsoo; Enebish, Namjil

2015-08-01

Further development of the North-East Asian energy system is at a crossroads due to severe limitations of the current conventional energy based system. For North-East Asia it is proposed that the excellent solar and wind resources of the Gobi desert could enable the transformation towards a 100% renewable energy system. An hourly resolved model describes an energy system for North-East Asia, subdivided into 14 regions interconnected by high voltage direct current (HVDC) transmission grids. Simulations are made for highly centralized, decentralized and country-wide grids scenarios. The results for total system levelized cost of electricity (LCOE) are 0.065 and 0.081 €/(kW·h) for the centralized and decentralized approaches for 2030 assumptions. The presented results for 100% renewable resources-based energy systems are lower in LCOE by about 30-40% than recent findings in Europe for conventional alternatives. This research clearly indicates that a 100% renewable resources-based energy system is THE real policy option.

Drugs in East Germany.

Science.gov (United States)

Dressler, J; Müller, E

1997-09-01

Germany was divided into two parts after World War II. The closed border and a nonconvertible currency in the Eastern part were the factors that did not allow a drug market to develop. Alcohol and medicaments were used as substitute drugs. Since Germany was reunified 5 years ago, there are now the same conditions prevailing for the procurement and sale of drugs in East Germany as there are in the Western German states. This report describes the current state of drug traffic, especially in Saxony, under the new social conditions.

The springboks in East Africa: the role of 1 SA Survey Company ...

African Journals Online (AJOL)

The springboks in East Africa: the role of 1 SA Survey Company (SAEC) in the East African campaign of World War II, 1940–1941. ... Scientia Militaria: South African Journal of Military Studies ... As a member of the British Commonwealth, South Africa was part of Britain's war effort from September 1939 onward. When Italy ...

City Limits, 2004, East Baton Rouge Parish, Louisiana

Data.gov (United States)

Louisiana Geographic Information Center — This is a graphical polygon dataset depicting the polygon boundaries of the incorporated city limits of Baton Rouge, Baker, and Zachary within East Baton Rouge...

Seamount physiography and biology in North-East Atlantic and Mediterranean Sea

OpenAIRE

T. Morato; K. Ø. Kvile; G. H. Taranto; F. Tempera; B. E. Narayanaswamy; D. Hebbeln; G. Menezes; C. Wienberg; R. S. Santos; T. J. Pitcher

2012-01-01

This work aims at characterising the seamount physiography and biology in the OSPAR Convention limits (North-East Atlantic Ocean) and Mediterranean Sea. We first inferred potential abundance, location and morphological characteristics of seamounts, and secondly, summarized the existing biological, geological and oceanographic in-situ research, identifying examples of well-studied seamounts. Our study showed that the seamount population in the OSPAR area (North-East Atlantic) and in Mediterran...

First report of Anisakis sp. in Epinephelus sp. in East Indonesia

OpenAIRE

Annytha Ina Rohi Detha; Diana Agustiani Wuri; Julianty Almet; Yuni Riwu; Christin Melky

2018-01-01

Objective: The present research was conducted to identify the prevalence of Anisakis sp. as fish-borne zoonoses in Epinephelus sp. in territorial waters of East Nusa Tenggara, Indonesia. Materials and methods: A total of 50 fish (Epinephelus sp.) were collected from Kupang Fish Market in East Nusa Tenggara. Identification of Anisakis sp. was performed based on morphological observations considering shape of ventriculus, boring tooth, and mucron using binocular microscope. Results: Prev...

Genetic population structure of the malaria vector Anopheles baimaii in north-east India using mitochondrial DNA.

Science.gov (United States)

Sarma, Devojit K; Prakash, Anil; O'Loughlin, Samantha M; Bhattacharyya, Dibya R; Mohapatra, Pradumnya K; Bhattacharjee, Kanta; Das, Kanika; Singh, Sweta; Sarma, Nilanju P; Ahmed, Gias U; Walton, Catherine; Mahanta, Jagadish

2012-03-20

Anopheles baimaii is a primary vector of human malaria in the forest settings of Southeast Asia including the north-eastern region of India. Here, the genetic population structure and the basic population genetic parameters of An. baimaii in north-east India were estimated using DNA sequences of the mitochondrial cytochrome oxidase sub unit II (COII) gene. Anopheles baimaii were collected from 26 geo-referenced locations across the seven north-east Indian states and the COII gene was sequenced from 176 individuals across these sites. Fifty-seven COII sequences of An. baimaii from six locations in Bangladesh, Myanmar and Thailand from a previous study were added to this dataset. Altogether, 233 sequences were grouped into eight population groups, to facilitate analyses of genetic diversity, population structure and population history. A star-shaped median joining haplotype network, unimodal mismatch distribution and significantly negative neutrality tests indicated population expansion in An. baimaii with the start of expansion estimated to be ~0.243 million years before present (MYBP) in north-east India. The populations of An. baimaii from north-east India had the highest haplotype and nucleotide diversity with all other populations having a subset of this diversity, likely as the result of range expansion from north-east India. The north-east Indian populations were genetically distinct from those in Bangladesh, Myanmar and Thailand, indicating that mountains, such as the Arakan mountain range between north-east India and Myanmar, are a significant barrier to gene flow. Within north-east India, there was no genetic differentiation among populations with the exception of the Central 2 population in the Barail hills area that was significantly differentiated from other populations. The high genetic distinctiveness of the Central 2 population in the Barail hills area of the north-east India should be confirmed and its epidemiological significance further

Genetic population structure of the malaria vector Anopheles baimaii in north-east India using mitochondrial DNA

Directory of Open Access Journals (Sweden)

Sarma Devojit K

2012-03-01

Full Text Available Abstract Background Anopheles baimaii is a primary vector of human malaria in the forest settings of Southeast Asia including the north-eastern region of India. Here, the genetic population structure and the basic population genetic parameters of An. baimaii in north-east India were estimated using DNA sequences of the mitochondrial cytochrome oxidase sub unit II (COII gene. Methods Anopheles baimaii were collected from 26 geo-referenced locations across the seven north-east Indian states and the COII gene was sequenced from 176 individuals across these sites. Fifty-seven COII sequences of An. baimaii from six locations in Bangladesh, Myanmar and Thailand from a previous study were added to this dataset. Altogether, 233 sequences were grouped into eight population groups, to facilitate analyses of genetic diversity, population structure and population history. Results A star-shaped median joining haplotype network, unimodal mismatch distribution and significantly negative neutrality tests indicated population expansion in An. baimaii with the start of expansion estimated to be ~0.243 million years before present (MYBP in north-east India. The populations of An. baimaii from north-east India had the highest haplotype and nucleotide diversity with all other populations having a subset of this diversity, likely as the result of range expansion from north-east India. The north-east Indian populations were genetically distinct from those in Bangladesh, Myanmar and Thailand, indicating that mountains, such as the Arakan mountain range between north-east India and Myanmar, are a significant barrier to gene flow. Within north-east India, there was no genetic differentiation among populations with the exception of the Central 2 population in the Barail hills area that was significantly differentiated from other populations. Conclusions The high genetic distinctiveness of the Central 2 population in the Barail hills area of the north-east India should be

Teaching East and Southeast Asia through Asian Eyes

Directory of Open Access Journals (Sweden)

Tracy C. Barrett

2014-06-01

Full Text Available Colonialism and indigenous responses to its varied forms dominate modern Asian historiography and imbue the history of the region with rich and multifaceted connections to world history. As a result, the histories of East and Southeast Asian nation-states since 1500 cannot be viewed outside of the context of global affairs. Imagining Asian peoples and cultures during this time is problematic for students, who typically approach colonialism from a western perspective. This presentation explores various means of incorporating into the classroom pedagogical materials and diverse media sources that facilitate a more grounded examination of East and Southeast Asian colonies, peoples, and nation-states.It pays special attention to teaching colonialism, anti-colonialism, nationalism, and transnationalism from the perspective of Southeast Asia’s indigenous peoples.

The current situation of the NDL Great East Japan Earthquake Archive 'HINAGIKU'

International Nuclear Information System (INIS)

Suwa, Yasuko

2014-01-01

On March 7, 2013, the National Diet Library (NDL) started full-scale operation of the NDL Great East Japan Earthquake Archive 'HINAGIKU'. Hinagiku is the Searching Portal that enables integrated search and utilization of sound and videos, pictures, websites, etc., about the Great East Japan Earthquake. Its aim is to hand down all records and lessons to future generations and to utilize them for the restoration and reconstruction of the affected areas and for disaster prevention measures. Since its release last year, Hinagiku has been enlarging search targets in cooperation with related institutions. In this article, I will give an overview of the NDL Great East Japan Earthquake Archive and discuss about its challenges for the future. (author)

Assessing sanitary mixtures in East African cities

NARCIS (Netherlands)

Letema, S.C.

2012-01-01

The urbanisation of poverty and informality in East African cities poses a threat to environmental
health, perpetuates social exclusion and inequalities, and creates service gaps (UN-Habitat, 2008).
This makes conventional sanitation provision untenable citywide, giving rise to the

Correlation Dynamics in East Asian Financial Markets

NARCIS (Netherlands)

Kuper, Gerard; Lestano, L

2014-01-01

This paper examines the dynamic relationship between stock returns and exchange rate changes using daily data from January 3, 1994 - September 27, 2013 for six East Asian countries: Indonesia, Malaysia, the Philippines, Singapore, South Korea and Thailand. We estimate conditional correlations using

National oil companies of South East Asia

International Nuclear Information System (INIS)

Singh, Gurdip

1998-12-01

Contains Executive Summary and Chapters on: Pertamina; Petronas; Petroleum Authority of Thailand; Philippines National Oil Company; Petro Vietnam; Myanmar Oil and Gas Enterprise; Singapore; Asean Free Trade Agreement, and Appendix on Petroleum tax legislation in the main south east Asian countries. (Author)

The Eichmann Trial on East German Television

NARCIS (Netherlands)

Keilbach, Judith

2014-01-01

abstractThe trial against Adolf Eichmann was one of the first transnational media events on television. Its world-wide coverage required transnational cooperation. Using East German television reports about the trial this article argues that although the event transcended national borders it

Agribusiness entrepreneurship development strategy in East Java for welcoming ASEAN Economic Community (AEC era

Directory of Open Access Journals (Sweden)

Dewie Tri Wijayati

2016-07-01

Full Text Available Facing the implementation of ASEAN Economic Community (AEC at the end of 2015 requires strategic measures to make Indonesia ready to compete with other nations in ASEAN. East Java Province has great potentials and contributions in the national agribusiness. Establishing agribusiness in East Java towards increased competitiveness is the right step to welcome AEC 2015. This research attempts to study the appropriate model of agribusiness development strategy for East Java. The selection of strategy model is expected to prepare a strong and competitive economy in East Java. Through three principles of data analysis model of Miles and Huberman with the emphasis on data collection, data display, and verification, this study also used a variety of data collection techniques and verifications such as Focus Group Discussion (FGD, observation, and others. This research was conducted in four regions as the focus of the study area: Probolinggo District, Sidoarjo District, Pasuruan District and the City of Batu. The results provide the following conclusions: (a the agribusiness development strategy in East Java should be done with the target approach. This means that the introduction to the target is the most important factors to determine the strategy to be implemented; (b the role of the government is highly important and strategic in developing agribusiness in East Java. These can be implemented through a variety of program models that are tailored to the target.

Imaging of upper crustal structure beneath East Java-Bali, Indonesia with ambient noise tomography

Science.gov (United States)

Martha, Agustya Adi; Cummins, Phil; Saygin, Erdinc; Sri Widiyantoro; Masturyono

2017-12-01

The complex geological structures in East Java and Bali provide important opportunities for natural resource exploitation, but also harbor perils associated with natural disasters. Such a condition makes the East Java region an important area for exploration of the subsurface seismic wave velocity structure, especially in its upper crust. We employed the ambient noise tomography method to image the upper crustal structure under this study area. We used seismic data recorded at 24 seismographs of BMKG spread over East Java and Bali. In addition, we installed 28 portable seismographs in East Java from April 2013 to January 2014 for 2-8 weeks, and we installed an additional 28 seismographs simultaneously throughout East Java from August 2015 to April 2016. We constructed inter-station Rayleigh wave Green's functions through cross-correlations of the vertical component of seismic noise recordings at 1500 pairs of stations. We used the Neighborhood Algorithm to construct depth profiles of shear wave velocity (Vs). The main result obtained from this study is the thickness of sediment cover. East Java's southern mountain zone is dominated by higher Vs, the Kendeng basin in the center is dominated by very low Vs, and the Rembang zone (to the North of Kendeng zone) is associated with medium Vs. The existence of structures with oil and gas potential in the Kendeng and Rembang zones can be identified by low Vs.

The Roots and Implications of East Asian Regionalism

National Research Council Canada - National Science Library

Miller, John

2004-01-01

Regionalism in East Asia is driven by historical patterns of cooperation, the common challenge of the West, the century-long quest for an Asian identity, and growing economic interdependence and integration...

Using Classroom Recordings in Educational History Research. An East German Civics Lesson

Science.gov (United States)

Jehle, May; Blessing, Benita

2014-01-01

Students learned in civics lessons in the German Democratic Republic (GDR, or East Germany) that their socialist society uniquely guaranteed all individuals the right to work, and that, as good socialists, they had the duty to take on socially meaningful work. Using the example of a video recording of an East German civics lesson and its…

Disruption simulation for the EAST plasma

International Nuclear Information System (INIS)

Niu Xingping; Wu Bin

2007-01-01

The disruptions due to vertical displacement event for the EAST plasma are simulated in this article by using the TSC program. Meanwhile, the evolutions of the halo current and stress on vacuum vessel are calculated; the disruptions at different initial conditions are compared with each other, and killer pellet injection is simulated for the device fast shutting-down. (authors)

People and forests in East Kalimantan

Science.gov (United States)

Kuswata Kartawinata; Timothy C. Jessup; A. P. Vayda; S. Riswan; Cynthia Mackie; Nancy E. Peluso

1992-01-01

Two major Indonesian-MAB (Man and the Biosphere) projects were carried out in the province of East Kalimantan, Indonesia, in the 1980s. Investigators found that farmers vary in their reason for practicing shifting cultivation of logging and agriculture, in their intensity of farming, and in the amount of damage they caused forests in their practices. Shifting...

Uncertainty in biogenic isoprene emissions and its impacts on tropospheric chemistry in East Asia

International Nuclear Information System (INIS)

Han, K.M.; Park, R.S.; Kim, H.K.; Woo, J.H.; Kim, J.; Song, C.H.

2013-01-01

In this study, the accuracy of biogenic isoprene emission fluxes over East Asia during two summer months (July and August) was examined by comparing two tropospheric HCHO columns (Ω HCHO ) obtained from the SCIAMACHY sensor and the Community Multi-scale Air Quality (CMAQ v4.7.1) model simulations, using three available biogenic isoprene emission inventories over East Asia: i) GEIA, ii) MEGAN and iii) MOHYCAN. From this comparative analysis, the tropospheric HCHO columns from the CMAQ model simulations, using the MEGAN and MOHYCAN emission inventories (Ω CMAQ, MEGAN and Ω CMAQ, MOHYCAN ), were found to agree well with the tropospheric HCHO columns from the SCIAMACHY observations (Ω SCIA ). Secondly, the propagation of such uncertainties in the biogenic isoprene emission fluxes to the levels of atmospheric oxidants (e.g., OH and HO 2 ) and other atmospheric gaseous/particulate species over East Asia during the two summer months was also investigated. As the biogenic isoprene emission fluxes decreased from the GEIA to the MEGAN emission inventories, the levels of OH radicals increased by factors of 1.39 and 1.75 over Central East China (CEC) and South China, respectively. Such increases in the OH radical mixing ratios subsequently influence the partitioning of HO y species. For example, the HO 2 /OH ratios from the CMAQ model simulations with GEIA isoprene emissions were 2.7 times larger than those from the CMAQ model simulations based on MEGAN isoprene emissions. The large HO 2 /OH ratios from the CMAQ model simulations with the GEIA biogenic emission were possibly due to the overestimation of GEIA biogenic isoprene emissions over East Asia. It was also shown that such large changes in HO x radicals created large differences on other tropospheric compounds (e.g., NO y chemistry) over East Asia during the summer months. - Highlights: • GEIA isoprene emissions were possibly overestimated over East Asia. • Using MEGAN or MOHYCAN emissions in CMAQ well captured

The Early Ordovician trilobite distribution and zonation of the East Baltic

Directory of Open Access Journals (Sweden)

Pärnaste, Helje

2006-06-01

Full Text Available Biozones of the East Baltic Early Ordovician trilobites were studied based on the trilobite distribution in northwestern Russia, Estonia, and Sweden. New data on trilobite distribution reveal the diachroneity of the lowest calcareous sediments of the Mäeküla Member, which forms the upper part of the Leetse Formation in the East Baltic. Trilobites of the Tremadoc Apatokephalus serratus and Megistaspis (Ekeraspis armata biozones are missing in the East Baltic, in contradiction to the suggestion of Balashova (Vopr. Paleontol., 1966, 5, 3–22. Some poorly preserved specimens probably belonging to Megistaspis (Paramegistaspis planilimbata (Angelin and also records of Pliomerops? linnarssoni (Wiman indicate that the Arenig Megistaspis (P. planilimbata Biozone of the Hunneberg Stage may be represented in some localities. The final delimitation of biozones in the Mäeküla and Päite members should improve when the ontogenetic and phylogenetic variation of the M. (Paramegistaspis lineage has been fully documented. Until then the Evropeites lamanskii Biozone is used in the East Baltic following Balashova, as indicated by the appearance of that taxon in most studied localities, marking the beginning of the Billingen Age. The succeeding Megalaspides (Megalaspides dalecarlicus Biozone is represented by the occurrence of at least its upper part in the Vassilkovo Beds in the St. Petersburg region, where Megalaspides paliformis Tjernvik occurs together with the index taxon (these taxa co-occur in the upper part of this zone in Sweden. The Päite Member in the East Baltic is correlated with the Megistaspis (P. estonica Biozone of the upper part of the Billingen Stage in Sweden.

Multi-scenario electromagnetic load analysis for CFETR and EAST magnet systems

Energy Technology Data Exchange (ETDEWEB)

Xu, Weiwei; Liu, Xufeng, E-mail: lxf@ipp.ac.cn; Du, Shuangsong; Song, Yuntao

2017-01-15

Highlights: • A multi-scenario force-calculating simulator for Tokamak magnet system is developed using interaction matrix method. • The simulator is applied to EM analysis of CFETR and EAST magnet system. • The EM loads on CFETR magnet coils at different typical scenarios and the EM loads acting on magnet system of EAST as function of time for different shots are analyzed with the simulator. • Results indicate that the approach can be conveniently used for multi-scenario and real-time EM analysis of Tokamak magnet system. - Abstract: A technology for electromagnetic (EM) analysis of the current-carrying components in tokamaks has been proposed recently (Rozov, 2013; Rozov and Alekseev, 2015). According to this method, the EM loads can be obtained by a linear transform of given currents using the pre-computed interaction matrix. Based on this technology, a multi-scenario force-calculating simulator for Tokamak magnet system is developed using Fortran programming in this paper. And the simulator is applied to EM analysis of China Fusion Engineering Test Reactor (CFETR) and Experimental Advanced Superconducting Tokamak (EAST) magnet system. The pre-computed EM interaction matrices of CFETR and EAST magnet system are implanted into the simulator, then the EM loads on CFETR magnet coils at different typical scenarios are evaluated with the simulator, and the comparison of the results with ANSYS method results validates the efficiency and accuracy of the method. Using the simulator, the EM loads acting on magnet system of EAST as function of time for different shots are further analyzed, and results indicate that the approach can be conveniently used for the real-time EM analysis of Tokamak magnet system.

Near East/South Asia Report

Science.gov (United States)

1987-03-26

all forces having an interest m the solution and an interest in society there is an alliance and partnership to confront the danger overtaking the...must be partnership and consensus in order to reach a solution. I doubt that President al-Jumayyil can at this stage settle affairs in East Beirut by...mountains, followed by another, in 1977 in Dhofar. ! Three conservation projects were undertaken, with the sup- port of the WWF and IUCN, which

Conceptual design of Remote Control System for EAST tokamak

International Nuclear Information System (INIS)

Sun, X.Y.; Wang, F.; Wang, Y.; Li, S.

2014-01-01

Highlights: • A new design conception for remote control for EAST tokamak is proposed. • Rich Internet application (RIA) was selected to implement the user interface. • Some security mechanism was used to fulfill security requirement. - Abstract: The international collaboration becomes popular in tokamak research like in many other fields of science, because the experiment facilities become larger and more expensive. The traditional On-site collaboration Model that has to spend much money and time on international travel is not fit for the more frequent international collaboration. The Remote Control System (RCS), as an extension of the Central Control System for the EAST tokamak, is designed to provide an efficient and economical way to international collaboration. As a remote user interface, the RCS must integrate with the Central Control System for EAST tokamak to perform discharge control function. This paper presents a design concept delineating a few key technical issues and addressing all significant details in the system architecture design. With the aim of satisfying system requirements, the RCS will select rich Internet application (RIA) as a user interface, Java as a back-end service and Secure Socket Layer Virtual Private Network (SSL VPN) for securable Internet communication

Overview of long pulse H-mode operation on EAST

Science.gov (United States)

Gong, X.; Garofalo, A. M.; Wan, B.; Li, J.; Qian, J.; Li, E.; Liu, F.; Zhao, Y.; Wang, M.; Xu, H.; EAST Team

2017-10-01

The EAST research program aims to demonstrate steady-state long-pulse high-performance H-mode operations with ITER-like poloidal configuration and RF-dominated heating schemes. In the recent experimental campaign, a long pulse fully non-inductive H-mode discharge lasting over 100 seconds using the upper ITER-like tungsten divertor has been achieved in EAST. This scenario used only RF heating and current drive, but also benefitted from an integrated control of the wall conditioning, plasma configuration, divertor heat flux, particle exhaust, impurity management and superconducting coils safety. Maintaining effective coupling of multiple RF heating and current drive sources on EAST is a critical ingredient. This long pulse discharge had good energy confinement, H98,y2 1.1-1.2, and all of the plasma parameters reach a true steady-state. Power balance indicates that the confinement improvement is due partly to a significantly reduced core electron transport inside minor radius rho<0.4. This work was supported by the National Magnetic Confinement Fusion Program of China Contract No. 2015GB10200 and the US Department of Energy Contract No. DE-SC0010685.

Conceptual design of Remote Control System for EAST tokamak

Energy Technology Data Exchange (ETDEWEB)

Sun, X.Y., E-mail: xysun@ipp.ac.cn; Wang, F.; Wang, Y.; Li, S.

2014-05-15

Highlights: • A new design conception for remote control for EAST tokamak is proposed. • Rich Internet application (RIA) was selected to implement the user interface. • Some security mechanism was used to fulfill security requirement. - Abstract: The international collaboration becomes popular in tokamak research like in many other fields of science, because the experiment facilities become larger and more expensive. The traditional On-site collaboration Model that has to spend much money and time on international travel is not fit for the more frequent international collaboration. The Remote Control System (RCS), as an extension of the Central Control System for the EAST tokamak, is designed to provide an efficient and economical way to international collaboration. As a remote user interface, the RCS must integrate with the Central Control System for EAST tokamak to perform discharge control function. This paper presents a design concept delineating a few key technical issues and addressing all significant details in the system architecture design. With the aim of satisfying system requirements, the RCS will select rich Internet application (RIA) as a user interface, Java as a back-end service and Secure Socket Layer Virtual Private Network (SSL VPN) for securable Internet communication.

OTEC Potential of East Nusa Tenggara Province in Indonesia

Science.gov (United States)

Widyartono, M.; Rahmadian, R.

2018-04-01

Indonesia is the largest archipelago country in the world, located between Indian Ocean and Pacific Ocean. Indonesia has more than 17000 islands with 70 per cent of the region is ocean. The Growth of the economic and population in Indonesia increasing the demand of the electricity annually, in 2015 alone electricity consumption in Indonesia reaching 200 TWh and will continue increasing every year. However, East Nusa Tenggara Province electrification ratio only around 58.64%, this is the second lowest ratio in Indonesia. This electrification ratio describes the level of availability of electrical energy for the community. Power Plant with renewable source placement in East Nusa Tenggara Province or smaller district need to be prioritise to cope with the low electrification ratio. Renewable sources for power plant have a good potential to work with, in example wind power, solar power, geothermal, or biomass. In addition, another renewable source that not yet known is from the ocean itself. Ocean Thermal Energy Conversion (OTEC) is one of the renewable source method from ocean. This paper will uncover the potential of OTEC in East Nusa Tenggara province so it will bring possibility to build an OTEC power plant in the future.

Modeling biomass burning over the South, South East and East Asian Monsoon regions using a new, satellite constrained approach

Science.gov (United States)

Lan, R.; Cohen, J. B.

2017-12-01

Biomass burning over the South, South East and East Asian Monsoon regions, is a crucial contributor to the total local aerosol loading. Furthermore, the impact of the ITCZ, and Monsoonal circulation patterns coupled with complex topography also have a prominent impact on the aerosol loading throughout much of the Northern Hemisphere. However, at the present time, biomass burning emissions are highly underestimated over this region, in part due to under-reported emissions in space and time, and in part due to an incomplete understanding of the physics and chemistry of the aerosols emitted in fires and formed downwind from them. Hence, a better understanding of the four-dimensional source distribution, plume rise, and in-situ processing, in particular in regions with significant quantities of urban air pollutants, is essential to advance our knowledge of this problem. This work uses a new modeling methodology based on the simultaneous constraints of measured AOD and some trace gasses over the region. The results of the 4-D constrained emissions are further expanded upon using different fire plume height rise and in-situ processing assumptions. Comparisons between the results and additional ground-based and remotely sensed measurements, including AERONET, CALIOP, and NOAA and other ground networks are included. The end results reveal a trio of insights into the nonlinear processes most-important to understand the impacts of biomass burning in this part of the world. Model-measurement comparisons are found to be consistent during the typical burning years of 2016. First, the model performs better under the new emissions representations, than it does using any of the standard hotspot based approaches currently employed by the community. Second, long range transport and mixing between the boundary layer and free troposphere contribute to the spatial-temporal variations. Third, we indicate some source regions that are new, either because of increased urbanization, or of

East-African Social Sciences and Humanities Publishing: A Handmade Bibliometrics Approach

Energy Technology Data Exchange (ETDEWEB)

Schmidt, N

2016-07-01

For Eastern Africa, very little information about the SSH knowledge production can be found from a European perspective. Adequate indicators like information-rich bibliographic databases that cover East-Africa-based journals and book publishers are lacking. This research in progress explores their indexing situation in detail, their development, which is closely connected to political history, their (non-)usage, and affiliations as well as careerstages of their authors. Furthermore, it also pays attention to East-Africa-based SSH researchers who use other publication venues. Any bibliometric analysis in this field needs to rely on manual data collection, otherwise it would be heavily biased. This study lays out the foundation for citation analyses, qualitative research on the publications' content and the self-description of East-African scholars against the background of an academic environment that is often described as “international”. (Author)

Health and Climate Impacts of Ocean-Going Vessels in East Asia

Science.gov (United States)

Liu, Huan; Fu, Mingliang; Jin, Xinxin; Shang, Yi; Shindell, Drew; Faluvegi, Greg; Shindell, Cary; He, Kebin

2016-01-01

East Asia has the most rapidly growing shipping emissions of both CO2 and traditional air pollutants, but the least in-depth analysis. Full evaluation of all pollutants is needed to assess the impacts of shipping emissions. Here, using an advanced method based on detailed dynamic ship activity data, we show that shipping emissions in East Asia accounted for 16% of global shipping CO2 in 2013, compared to only 4-7% in 2002-2005. Increased emissions lead to large adverse health impacts, with 14,500-37,500 premature deaths per year. Global mean radiative forcing from East Asian shipping is initially negative, but would become positive after approximately eight years for constant current emissions. As a large fraction of vessels are registered elsewhere, joint efforts are necessary to reduce emissions and mitigate the climate and health impacts of shipping in the region.

Nontuberculous mycobacteria in Middle East: Current situation and future challenges.

Science.gov (United States)

Velayati, Ali Akbar; Rahideh, Sanaz; Nezhad, Zahra Derakhshani; Farnia, Parissa; Mirsaeidi, Mehdi

2015-03-01

Nontuberculous mycobacteria (NTM) are a diverse group of bacterial species that are distributed in the environment. Many of these environmental bacteria can cause disease in humans. The identification of NTM in environmental sources is important for both clinical and epidemiological purposes. In this study, the distribution of NTM species from environmental and clinical samples in the Middle East was reviewed. In order to provide an overview of NTM, as well as recent epidemiological trends, all studies addressing NTM in the Middle East from 1984 to 2014 were reviewed. A total of 96 articles were found, in which 1751 NTM strains were isolated and 1084 of which were obtained from clinical samples, 619 from environmental samples and 48 were cited by case reports. Mycobacterium fortuitum was the most common rapid growing mycobacteria (RGM) isolated from both clinical (269 out of 447 RGM; 60.1%) and environmental (135 out of 289 RGM; 46.7%) samples. Mycobacterium avium complex (MAC) was the most common slow growing mycobacteria (SGM) isolated from clinical samples (140 out of 637 SGM; 21.9%). An increasing trend in NTM isolation from the Middle East was noted over the last 5years. This review demonstrates the increasing concern regarding NTM disease in the Middle East, emphasizing the need for regional collaboration and coordination in order to respond appropriately. Copyright © 2015 Asian African Society for Mycobacteriology. Published by Elsevier Ltd. All rights reserved.

78 FR 12049 - The East Ohio Gas Company d/b/a Dominion East Ohio; Dominion Transmission, Inc.; Notice of...

Science.gov (United States)

2013-02-21

... Gas Company d/b/a Dominion East Ohio; Dominion Transmission, Inc.; Notice of Abbreviated Application for Limited Amendment to Certificate of Public Convenience and Necessity On February 11, 2013, The...''), filed an abbreviated application for limited amendment to certificate of public convenience and...

Progress on high performance long-pulse operations in EAST

International Nuclear Information System (INIS)

Guo, H.Y.; Li, J.; Wan, B.N.; Gong, X.Z.; Xu, G.S.; Liang, Y.F.

2013-01-01

Significant progress has been made in the Experimental Advanced Superconducting Tokamak (EAST) on both technology and physics fronts, achieving long pulse L-mode discharges over 400 s, entirely driven by Lower Hybrid Current Drive (LHCD), with improved plasma facing components, active Li gettering, cryopumping and flexible divertor configurations. High confinement plasmas, i.e., H-modes, have been extended over 30 s with combined operation of LHCD and Ion Cyclotron Resonant Heating (ICRH). Various means for mitigating ELMs have also been explored to facilitate high power, long pulse operation in EAST, such as supersonic molecular beam injection, D 2 pellet injection, as well as innovative solid Li granule injection. (author)

East Midlands healthcare and bioscience sector strategy

OpenAIRE

East Midlands Development Agency

2007-01-01

The healthcare and bioscience sector is one of four priority sectors identified in the regional economic strategy, A Flourishing Region. This document sets out a strategy for maximising the contribution of the healthcare and biosciences sector to the economic development of the East Midlands.

Early East Asian art history in Vienna and its trajectories: Josef Strzygowski, Karl With, Alfred Salmony

Directory of Open Access Journals (Sweden)

Julia Orell

2015-12-01

Full Text Available In 1912 Josef Strzygowski founded the ‘Section for East Asian Art History’ at the University of Vienna, which attracted many students who would continue their careers in museums and at universities and thus established East Asian art history as an academic field. This paper examines these early art historical engagements with East Asian art: First, I discuss the role of East Asian art in Strzygowski’s agenda of broadening art history’s geographical scope beyond Europe and in his argument about the dominance of ‘Nordic’ artistic traditions in Europe and in Asia. Secondly, I introduce the work of two early students at the ‘Section for East Asian Art History’ in Vienna, Karl With and Alfred Salmony. Their respective approaches to East Asian art exemplify a range of methodological concerns of their time, from stylistic narratives, the concept of ars una, comparative frameworks, to ideas about cultural or national ‘purity’ in the arts, and an interest in cross-cultural adaption and transformation of motifs and symbolism.

The genus Rhaponticum in East Asia

Directory of Open Access Journals (Sweden)

Gorovoy, P.

2010-12-01

Full Text Available The genus Rhaponticum in East Asia has always been a taxon for discussion. Rhaponticum carthamoides from East Siberia comprises three subspecies: carthamoides, chamarensis and orientale. Even though they differ in morphology, they do not have isolated areas. Rhaponticum satzyperovii was recently described and its author pointed out its affinity with Rh. uniflorum. Plant height, stem indumentum, and radical and stem leaf dissection were signaled as the diagnostic characters. Our present study on living and herbarium specimens of Rh. satzyperovii shows that the diagnostic characters are not consistent. The species area was also claimed to be an argument for considering Rh. satzyperovii a distinct species. This area covers the south of the Primorye Province in the Far East of Russia with some locations in the adjacent Jewish Autonomous Region and in China. In our study, the area of Rh. satzyperovii is found to be within the area of Rh. uniflorum and thereafter they turned out to have no disjunction. In East Asia, Rh. uniflorum is characterized by a wide range of morphological variability. We suggest that Rh. satzyperovii should be included within Rh. uniflorum without any taxonomic rank.El género Rhaponticum en el Este de Asia ha sido siempre un taxón discutido. Rhaponticum carthamoides del Este de Siberia incluye tres subespecies: carthamoides, chamarensis y orientale. Aunque difieren en su morfología, sus áreas no están aisladas. Rhaponticum satzyperovii fue descrito recientemente y su autor señaló su afinidad con Rh. uniflorum. Los caracteres diagnósticos fueron la altura de la planta, el indumento del tallo y las divisiones de las hojas basales y caulinares. Nuestro estudio de plantas vivas y muestras de herbario de Rh. satzyperovii muestra que los caracteres diagnósticos no son consistentes. El área de distribución también se argumentó para considerar Rh. satzyperovii una especie diferente. El área cubre el sur de la provincia de

The Hidden Integration of Eurasia: East-West Relations in the History of Technology

Directory of Open Access Journals (Sweden)

Per Högselius

2017-12-01

Full Text Available “East” and “West” have long been prominent categories in the history of technology. The historical literature that claims to deal with comparisons or connections between East and West from a technological point of view is rich and fascinating. Yet, so far there has been no attempt to succinctly summarize or synthesize the main findings. This article takes a first step towards such a synthesis. It does so by addressing technological interaction between three broadly defined geographical regions: (1 Western Europe and North America; (2 Eastern Europe, Russia and Central Asia; and (3 the non-Russian Far East. The article suggests that East–West studies in the history of technology can be divided into three sets, which would benefit from greater interaction with each other: studies of East–West and West– East technology transfer; studies comparing the evolution of Eastern and Western technological levels and technological “styles”; and studies of large technical systems that materially interconnect East and West.

The Rapid Arctic Warming and Its Impact on East Asian Winter Weather in Recent Decade

Science.gov (United States)

Kim, S. J.; Kim, B. M.; Kim, J. H.

2015-12-01

The Arctic is warming much more rapidly than the lower latitudes. In contrast to the rapid Arctic warming, in winters of the recent decade, the cold-air outbreaks over East Asia occur more frequently and stronger than in 1990s. By accompanying the snow over East Asia, the strong cold surges have led to a severe socio-economic impact. Such severe cold surges in recent decade over east Asia is consistent with the more dominant negative phase of the Arctic Oscillation (AO), that may be attributed by the Arctic amplification. In both observation-based reanalysis and numerical model experiments, the Arctic sea ice melting leads to the weakening of the AO polarity by reducing the meridional temperature gradient through a heat flux feedback. The Arctic warming and associated sea ice melting over the Kara-Barents area in late fall and early winter first release a lot of heat to the atmosphere from the ocean by a strong contrast in temperature and moisture and higher height anomaly is developed over the Kara/Barents and the Ural mountains The anomalous anticyclonic anomaly over the Arctic strengthen the Siberian High and at the same time the east Asian trough is developed over the western coast of the North Pacific. Through the passage between the margin of the Siberian High and east Asian tough, an extremely cold air is transported from east Siberia to east Asia for sometimes more than a week. Such a severe sold air brings about the moisture from nearby ocean, largely influencing the daily lives and economy in north East China, Korea, and Japan. The recent Arctic and associated sea ice melting is not only contributed to the local climate and weather, but also a severe weather in mid-latitudes through a modulation in polar vortex.

A new radiation stripline ICRF antenna design for EAST Tokamak

International Nuclear Information System (INIS)

Qin, C. M.; Zhao, Y. P.; Wan, B. N.; Li, J.; Zhang, X. J.; Yang, Q. X.; Yuan, S.; Braun, F.; Notedame, J.-M.; Kasahara, H.

2014-01-01

A new type of toroidal long Radiation Stripline Antenna (RSA) is presented, which can effectively improve antenna radiation, leading in reduction of max voltage on transmission line and decrease of the sensitivity to ELM's of the ICRF system at some frequencies. Based on the new concept, a 4-straps RSA is proposed for EAST device. Using 3-D computing simulator code (HFSS), RF current distribution, S-parameters and electromagnetic field distribution on and near the RSA ICRF antenna are analyzed and compared with present ICRF antenna on EAST

Internal Magnetic Configuration Measured by ECE Imaging on EAST Tokamak

International Nuclear Information System (INIS)

Xu Ming; Wen Yizhi; Xie Jinlin; Yu Changxuan; Gao Bingxi; Xu Xiaoyuan; Liu Wandong; Hu Liqun; Sun Youwen; Qian Jinping; Wan Baonian

2013-01-01

ECE imaging (electron cyclotron emission imaging) is an important diagnostic which can give 2D imaging of temperature fluctuation in the core of tokamak. A method based on ECE imaging is introduced which can give the information of the position of magnetic axis and the structure of internal magnetic surface for EAST tokamak. The EFIT equilibrium reconstruction is not reliable due to the absence of important core diagnostic at the initial phase for EAST, so the information given by ECE imaging could help to improve the accuracy of EFIT equilibrium reconstruction. (magnetically confined plasma)

75 FR 34362 - Safety Zone; Festivals & Fireworks Celebration, East Moran Bay, Lake Huron, St. Ignace, MI

Science.gov (United States)

2010-06-17

...-AA00 Safety Zone; Festivals & Fireworks Celebration, East Moran Bay, Lake Huron, St. Ignace, MI AGENCY... safety zone on East Moran Bay, Lake Huron, St. Ignace, MI. This zone is intended to restrict vessels from... portion of East Moran Bay, Lake Huron, St. Ignace, MI between 9 p.m. and 11 p.m. on June 26, July 10, July...

M. S. Hrushevsky as an Old East Slavic chronicles researcher

Directory of Open Access Journals (Sweden)

Voronov, V. I.

2017-07-01

Full Text Available The author analyzes scientific studies of M. S. Hrushevsky, which directly or indirectly are connected with Old East Slavic chronicles characteristics as specific historical sources. The article determines famous scientistʼs conceptual approaches to such topics as chronicles texts' attribution, determination of the content authenticity, information capabilities to investigate the history of the Kievan Rus'. It is ascertained, what are the main problematic issues, discrepancies, thematic and conceptual lacunae according to the M. Hrushevsky were the obstacle while researching Old East Slavic chronicles as a sources complex in the Ukrainian historiography of 20th century. The most weighty contribution was made by M. S. Hrushevsky to the Galician-Volhynian Chronicle studies. He reconstructed in depth the chronology of Galician-Volhynian Chronicle, and proved that this chronicle was firstly composed as a narrative ignoring dates. Only later some-one filled out the dates while editing the text, but "in a very random and false way". The author of the article makes a conclusion that in general M. Hrushevsky has described Old East Slavic chronicles as a "golden age of Kievan Rus' culture". However, only poor fragments of the chronicleʼs tradition remained by the turn of 20th century, being interrupted by the Mongol invasion. That's why the scientist warned historians against attributing the Old East Slavic chronicles with irrelevant "significant forms", since as reported in his researches there werenʼt enough sources to make such conclusions. The article demonstrates that the most typical features of the chronicles according to M. Hrushevsky were: significant impact of the Christian ideology, symptomatic loyalty to "knyaz-druzhina" system (governing classes in Kievan Rus', content originality and stylistic ingenuousness, predominating collectivity and anonymity of the authorship. It is stated that Ukrainian historian has also defined main challenges

Archaeology, archaeozoology and the study of pastoralism in the Near East (Review Article)

NARCIS (Netherlands)

Çakirlar, Canan

2017-01-01

Sheep and goat herding, the basis of pastoralism in the Near East, has been integral to the social organisation, diet, economy, religion and environment of the region since the beginnings of animal domestication. Interestingly, this omnipresent factor of life in the Near East has not been a popular

Conversing across cultures: East-West communication styles in work and nonwork contexts.

Science.gov (United States)

Sanchez-Burks, Jeffrey; Lee, Fiona; Choi, Incheol; Nisbett, Richard; Zhao, Shuming; Koo, Jasook

2003-08-01

Four experiments provided evidence that East-West differences in attention to indirect meaning are more pronounced in work settings compared with nonwork settings as suggested by prior research on Protestant relational ideology. Study 1 compared errors in interpreting indirect messages in work and nonwork contexts across three cultures. Studies 2 and 3 examined differences in self-reported indirectness with coworkers versus nonwork acquaintances across three cultures controlling for variation in individualism--collectivism. Study 4 examined self-reported indirectness in bicultural managers and experimentally manipulated the salience of Western versus Eastern culture. The results showed that Americans, but not East Asians, were less attentive to indirect cues in work than nonwork settings and that East-West differences in indirectness were greater in work than nonwork settings.

Lithostratigraphic, borehole-geophysical, hydrogeologic, and hydrochemical data from the East Bay Plain, Alameda County, California

Science.gov (United States)

Sneed, Michelle; Orlando, Patricia v.P.; Borchers, James W.; Everett, Rhett; Solt, Michael; McGann, Mary; Lowers, Heather; Mahan, Shannon

2015-01-01

The U.S. Geological Survey, in cooperation with the East Bay Municipal Utility District, carried out an investigation of aquifer-system deformation associated with groundwater-level changes at the Bayside Groundwater Project near the modern San Francisco Bay shore in San Lorenzo, California. As a part of the Bayside Groundwater Project, East Bay Municipal Utility District proposed an aquifer storage and recovery program for 1 million gallons of water per day. The potential for aquifer-system compaction and expansion, and related subsidence, uplift, or both, resulting from aquifer storage and recovery activities were investigated and monitored in the Bayside Groundwater Project. In addition, baseline analysis of groundwater and substrata properties were performed to assess the potential effect of such activities. Chemical and physical data, obtained from the subsurface at four sites on the east side of San Francisco Bay in the San Lorenzo and San Leandro areas of the East Bay Plain, Alameda County, California, were collected during the study. The results of the study were provided to the East Bay Municipal Utility District and other agencies to evaluate the chemical and mechanical responses of aquifers underlying the East Bay Plain to the future injection and recovery of imported water from the Sierra Nevada of California.

ESONET LIDO Demonstration Mission: the East Sicily node

Science.gov (United States)

Riccobene, Giorgio; Favali, Paolo; Andrè, Michel; Chierici, Francesco; Pavan, Gianni; Esonet Lido Demonstration Mission Team

2010-05-01

Off East Sicily (at 2100 m depth, 25 km off the harbour of Catania) a prototype of a cabled deep-sea observatory (NEMO-SN1) was set up and has been operational in real-time since 2005 (the cabled deep-sea multi-parameter station SN1, equipped with geophysical and environmental sensors and the cabled NEMO-OνDE, equipped with 4 broadband hydrophones). The Western Ionian Sea is one of the node sites for the upcoming European permanent underwater network (EMSO). Within the activities of the EC project ESONET-NoE some demonstration missions have been funded. The LIDO-DM (Listening to the Deep Ocean-Demonstration Mission) is one of these and is related to two sites, East Sicily and Iberian Margin (Gulf of Cadiz), the main aims being geo-hazards monitoring and warning (seismic, tsunami, and volcanic) and bio-acoustics. The LIDO-DM East Sicily installation represents a further major step within ESONET-NoE, resulting in a fully integrated system for multidisciplinary deep-sea science, capable to transmit and distribute data in real time to the scientific community and to the general public. LIDO-DM East Sicily hosts a large number of sensors aimed at monitoring and studying oceanographic and environmental parameters (by means of CTD, ADCP, 3-C single point current meter, turbidity meter), geophysical phenomena (low frequency hydrophones, accelerometer, gravity meter, vector and scalar magnetometers, seismometer, absolute and differential pressure gauges), ocean noise monitoring and identification and tracking of biological acoustic sources in deep sea. The latter will be performed using two tetrahedral arrays of 4 hydrophones, located at a relative distance of about 5 km, and at about 25 km from the shore. The whole system will be connected and powered from shore, by means of the electro-optical cable net installed at the East Sicily Site Infrastructure, and synchronised with GPS. Sensors data sampling is performed underwater and transmitted via optical fibre link, with

Housing East Asia: socioeconomic and demographic challenges

NARCIS (Netherlands)

Doling, J.; Ronald, R.

2014-01-01

Housing and home ownership has been strongly embedded in East Asian socioeconomic and policy models. Based on the primacy of national economic growth objectives, it was promoted as a means of, on the one hand, contributing directly to economic growth through the motor of the construction industry,

Financing environmental policy in East Central Europe

NARCIS (Netherlands)

Kolk, A.; van der Weij, E.

1998-01-01

The transition in East Central Europe created a general optimism which was reflected in a belief that a solution to the environmental problems faced by these countries would be found. There were great expectations regarding the blessings of the market economy, which would diminish state-guided waste

Correlation dynamics in East Asian financial markets

NARCIS (Netherlands)

Lestano, L; Kuper, Gerard H.

2016-01-01

We examine the dynamic relationship between stock returns and exchange rate changes using daily data from January 1994 to September 2013 for six East Asian countries. We use the multivariate GARCH-DCC model in order to disclose the relationship between stock markets and foreign exchange markets

Soldiers and Civilians in Contemporary Middle East

DEFF Research Database (Denmark)

2017-01-01

Despite the fact that the co-called Arab Spring has spread promising winds across the Middle East and the Northern Afria (MENA) region over the past decade, several countries in the region have nevertheless been caught up in devastating and destructive intra-state conflicts. A prevailing trend...

The influence of European pollution on ozone in the Near East and northern Africa

Directory of Open Access Journals (Sweden)

B. N. Duncan

2008-04-01

Full Text Available We present a modeling study of the long-range transport of pollution from Europe, showing that European emissions regularly elevate surface ozone by as much as 20 ppbv in summer in northern Africa and the Near East. European emissions cause 50–150 additional violations per year (i.e. above those that would occur without European pollution of the European health standard for ozone (8-h average >120 μg/m³ or ~60 ppbv in northern Africa and the Near East. We estimate that European ozone pollution is responsible for 50 000 premature mortalities globally each year, of which the majority occurs outside of Europe itself, including 37% (19 000 in northern Africa and the Near East. Much of the pollution from Europe is exported southward at low altitudes in summer to the Mediterranean Sea, northern Africa and the Near East, regions with favorable photochemical environments for ozone production. Our results suggest that assessments of the human health benefits of reducing ozone precursor emissions in Europe should include effects outside of Europe, and that comprehensive planning to improve air quality in northern Africa and the Near East likely needs to address European emissions.

The Influence of European Pollution on Ozone in the Near East and Northern Africa

Science.gov (United States)

Duncan, B. N.; West, J. J.; Yoshida, Y.; Fiore, A. M.; Ziemke, J. R.

2008-01-01

We present a modeling study of the long-range transport of pollution from Europe, showing that European emissions regularly elevate surface ozone by as much as 20 ppbv in summer in northern Africa and the Near East. European emissions cause 50-150 additional violations per year (i.e. above those that would occur without European pollution) of the European health standard for ozone (8-h average greater than 120 micrograms per cubic meters or approximately 60 ppbv) in northern Africa and the Near East. We estimate that European ozone pollution is responsible for 50 000 premature mortalities globally each year, of which the majority occurs outside of Europe itself, including 37% (19 000) in northern Africa and the Near East. Much of the pollution from Europe is exported southward at low altitudes in summer to the Mediterranean Sea, northern Africa and the Near East, regions with favorable photochemical environments for ozone production. Our results suggest that assessments of the human health benefits of reducing ozone precursor emissions in Europe should include effects outside of Europe, and that comprehensive planning to improve air quality in northern Africa and the Near East likely needs to address European emissions.

Brief communication: Drought likelihood for East Africa

Directory of Open Access Journals (Sweden)

H. Yang

2018-02-01

Full Text Available The East Africa drought in autumn of year 2016 caused malnutrition, illness and death. Close to 16 million people across Somalia, Ethiopia and Kenya needed food, water and medical assistance. Many factors influence drought stress and response. However, inevitably the following question is asked: are elevated greenhouse gas concentrations altering extreme rainfall deficit frequency? We investigate this with general circulation models (GCMs. After GCM bias correction to match the climatological mean of the CHIRPS data-based rainfall product, climate models project small decreases in probability of drought with the same (or worse severity as 2016 ASO (August to October East African event. This is by the end of the 21st century compared to the probabilities for present day. However, when further adjusting the climatological variability of GCMs to also match CHIRPS data, by additionally bias-correcting for variance, then the probability of drought occurrence will increase slightly over the same period.

Brief communication: Drought likelihood for East Africa

Science.gov (United States)

Yang, Hui; Huntingford, Chris

2018-02-01

The East Africa drought in autumn of year 2016 caused malnutrition, illness and death. Close to 16 million people across Somalia, Ethiopia and Kenya needed food, water and medical assistance. Many factors influence drought stress and response. However, inevitably the following question is asked: are elevated greenhouse gas concentrations altering extreme rainfall deficit frequency? We investigate this with general circulation models (GCMs). After GCM bias correction to match the climatological mean of the CHIRPS data-based rainfall product, climate models project small decreases in probability of drought with the same (or worse) severity as 2016 ASO (August to October) East African event. This is by the end of the 21st century compared to the probabilities for present day. However, when further adjusting the climatological variability of GCMs to also match CHIRPS data, by additionally bias-correcting for variance, then the probability of drought occurrence will increase slightly over the same period.

The Middle East in the year 2000

International Nuclear Information System (INIS)

Henderson, S.

1996-02-01

The Middle East in the year 2000 provides all insight into the political and economic changes taking place in the region and explains what they mean for the oil and gas industry. This comprehensive report combines published forecasts with expert comment and analysis, making it a highly practical business guide. With oil and gas at the heart of its discussion it looks in detail at: the likely shape of the Middle East into the next century, with a country-by-country review; the declared aspirations of Middle Eastern countries, with likely economic trends including oil production; the complete political and economic picture and what the future may hold; the long- and short-term future for oil; how oil prices will change over the coming years; the impact of non-Opec production on the region; the opportunities and competitive advantages for companies wanting to do business in the region; fundamentalism versus democracy; and various political scenarios. (author)

Consented Autopsy and the Middle-East.

Science.gov (United States)

Kharoshah, Magdy A; Hussain, Syed Ather; Madadin, Mohammed; Menezes, Ritesh G

2017-02-01

Consented autopsy is almost non-existent in the Middle-East where established social and cultural beliefs regarding the procedure might discourage family members from requesting a consented autopsy. Evidence suggests that new information is obtained from consented autopsies. It would not be in the best interest of medicine if social and cultural misconceptions succeed in erasing the existence of consented autopsies entirely.

Dromedary camels and the transmission of Middle East Respiratory Syndrome Coronavirus (MERS-CoV)

Science.gov (United States)

Hemida, Maged G; Elmoslemany, Ahmed; Al-Hizab, Fahad; Alnaeem, Abdulmohsen; Almathen, Faisal; Faye, Bernard; Chu, Daniel KW; Perera, Ranawaka A; Peiris, Malik

2015-01-01

Middle East respiratory syndrome coronavirus (MERS-CoV) is an existential threat to global public health. The virus has been repeatedly detected in dromedary camels (Camelus dromedarius). Adult animals in many countries in the Middle East as well as in North and East Africa showed high (>90%) sero-prevalence to the virus. MERS-CoV isolated from dromedaries is genetically and phenotypically similar to viruses from humans. We summarise current understanding of the ecology of MERS-CoV in animals and transmission at the animal-human interface. We review aspects of husbandry, animal movements and trade and the use and consumption of camel dairy and meat products in the Middle East that may be relevant to the epidemiology of MERS. We also highlight the gaps in understanding the transmission of this virus in animals and from animals to humans. PMID:26256102

A welcoming policy in post-socialist East Germany

Directory of Open Access Journals (Sweden)

Anna Steigemann

2016-01-01

Full Text Available Apparently, East European countries are less willing to accept refugees than other European countries. Their experience of ethnic and cultural diversity is weak and a genuine welcome has still to be developed.

Interest Parity Conditions as Indicators of Financial Integration in East Asia

OpenAIRE

Gordon de Brouwer

1997-01-01

Market participants and policymakers have a growing interest in the development of East Asian financial markets, and to the extent to which these markets are open and influenced by world markets. This paper examines the information contained in interest parity conditions about the international integration of a wide range of economies in East Asia. Legal restrictions on the capital account and tests of covered, uncovered and real interest parity are presented in some detail. Using standard re...

Have East Asian stock markets calmed down? Evidence from a regime-switching model

NARCIS (Netherlands)

Chaudhuri, K.R.; Klaassen, F.

2001-01-01

The 1997-98 East Asian crisis was accompanied by high volatility of East Asian stock returns. This paper examines whether the volatility has already come down to the level of the years before the crisis. We use a regime-switching model to account for possible structural change in the unconditional

Thermal analysis of EAST neutral beam injectors for long-pulse beam operation

Science.gov (United States)

Chundong, HU; Yongjian, XU; Yuanlai, XIE; Yahong, XIE; Lizhen, LIANG; Caichao, JIANG; Sheng, LIU; Jianglong, WEI; Peng, SHENG; Zhimin, LIU; Ling, TAO; the NBI Team

2018-04-01

Two sets of neutral beam injectors (NBI-1 and NBI-2) have been mounted on the EAST tokamak since 2014. NBI-1 and NBI-2 are co-direction and counter-direction, respectively. As with in-depth physics and engineering study of EAST, the ability of long pulse beam injection should be required in the NBI system. For NBIs, the most important and difficult thing that should be overcome is heat removal capacity of heat loaded components for long-pulse beam extraction. In this article, the thermal state of the components of EAST NBI is investigated using water flow calorimetry and thermocouple temperatures. Results show that (1) operation parameters have an obvious influence on the heat deposited on the inner components of the beamline, (2) a suitable operation parameter can decrease the heat loading effectively and obtain longer beam pulse length, and (3) under the cooling water pressure of 0.25 MPa, the predicted maximum beam pulse length will be up to 260 s with 50 keV beam energy by a duty factor of 0.5. The results present that, in this regard, the EAST NBI-1 system has the ability of long-pulse beam injection.

Ideal MHD Stability Prediction and Required Power for EAST Advanced Scenario

International Nuclear Information System (INIS)

Chen Junjie; Li Guoqiang; Qian Jinping; Liu Zixi

2012-01-01

The Experimental Advanced Superconducting Tokamak (EAST) is the first fully superconducting tokamak with a D-shaped cross-sectional plasma presently in operation. The ideal magnetohydrodynamic (MHD) stability and required power for the EAST advanced tokamak (AT) scenario with negative central shear and double transport barrier (DTB) are investigated. With the equilibrium code TOQ and stability code GATO, the ideal MHD stability is analyzed. It is shown that a moderate ratio of edge transport barriers' (ETB) height to internal transport barriers' (ITBs) height is beneficial to ideal MHD stability. The normalized beta β N limit is about 2.20 (without wall) and 3.70 (with ideal wall). With the scaling law of energy confinement time, the required heating power for EAST AT scenario is calculated. The total heating power P t increases as the toroidal magnetic field B T or the normalized beta β N is increased. (magnetically confined plasma)

Ideal MHD Stability Prediction and Required Power for EAST Advanced Scenario

Science.gov (United States)

Chen, Junjie; Li, Guoqiang; Qian, Jinping; Liu, Zixi

2012-11-01

The Experimental Advanced Superconducting Tokamak (EAST) is the first fully superconducting tokamak with a D-shaped cross-sectional plasma presently in operation. The ideal magnetohydrodynamic (MHD) stability and required power for the EAST advanced tokamak (AT) scenario with negative central shear and double transport barrier (DTB) are investigated. With the equilibrium code TOQ and stability code GATO, the ideal MHD stability is analyzed. It is shown that a moderate ratio of edge transport barriers' (ETB) height to internal transport barriers' (ITBs) height is beneficial to ideal MHD stability. The normalized beta βN limit is about 2.20 (without wall) and 3.70 (with ideal wall). With the scaling law of energy confinement time, the required heating power for EAST AT scenario is calculated. The total heating power Pt increases as the toroidal magnetic field BT or the normalized beta βN is increased.

HIV in East London: ethnicity, gender and risk. Design and methods

Directory of Open Access Journals (Sweden)

Bukutu Cecilia

2006-06-01

Full Text Available Abstract Background While men who have sex with men remain the group at greatest risk of acquiring HIV infection in the UK, the number of new diagnoses among heterosexuals has risen steadily over the last five years. In the UK, three-quarters of heterosexual men and women diagnosed with HIV in 2004 probably acquired their infection in Africa. This changing epidemiological pattern is particularly pronounced in East London because of its ethnically diverse population. Design and methods The objective of the study was to examine the social, economic and behavioural characteristics of patients with HIV infection currently receiving treatment and care in hospitals in East London. The research focused on ethnicity, gender, sexuality, education, employment, housing, HIV treatment, stigma, discrimination, religion, migration and sexual risk behaviour. People diagnosed with HIV infection attending outpatient treatment clinics at St Bartholomew's, the Royal London, Whipp's Cross, Homerton, Newham and Barking hospitals (all in East London over a 4–6 month period were invited to participate in the study in 2004–2005. Those who agreed to participate completed a confidential, self-administered pen-and-paper questionnaire. During the study period, 2680 patients with HIV attended the outpatient clinics in the six participating hospitals, of whom 2299 were eligible for the study and 1687 completed a questionnaire. The response rate was 73% of eligible patients and 63% of all patients attending the clinics during the survey period. Discussion A clinic-based study has allowed us to survey nearly 1700 patients with HIV from diverse backgrounds receiving treatment and care in East London. The data collected in this study will provide valuable information for the planning and delivery of appropriate clinical care, social support and health promotion for people living with HIV not only in East London but in other parts of the capital as well as elsewhere in the UK.

North sea: a quarter of total's reserves (excluding the Middle East)

International Nuclear Information System (INIS)

Anon.

1995-01-01

In 1994, for the fifth successive year, Total increased its proven reserves of hydrocarbons which reach 4.3 Gboe (+ 6% compared to 1993). Outside the Middle East, the reserves show a development of 9% and reach the threshold of 2 Gboe. In 1994, Total's production of hydrocarbons reached 633,000 boe/d (+ 4%), despite a fall of 3% in oil production in the Middle East. Excluding the Middle East, production was increased to 345,000 boe/d (+ 12%), including 212,000 boe/d for gas (+ 20%). Exploration/production investments were 5.8 GF in 1994 (excluding labour) and the development program for reserves and production for the coming years is based on yearly investments of some 6 GF. Total's production in Europe, essentially in the North Sea, was 154,000 boe/d in 1994 (+ 12%). This zone has potential for significant growth for the group which has undertaken exploration surveys in the Western Shetlands and in Haltenbanken. In the British zone, the Dunbar field and its neighbour Ellon were brought into production in December 1994. In the Norwegian zone, the Froy field, was brought into production last June. In the Lille-Frigg field, whose production started in May, initial reserves are estimated at 6,7 Bcm of gas. Total Norge AS also has interests in the producing fields of Ekofisk, Frigg, East-Frigg, Heimdal, Sleipner East, Veslefrikk, Oseberg, Brage, in those of Sleipner West and Huldra (start-up scheduled for 1997) and in Troll (phase 1) which should be producing in 1996. In the Dutch zone, the K4b and K5a blocks brought into production last November hold reserves estimated at 20 Bcm; their production could reach 2 Bcm/year as from 1995. (authors). 1 tab., 1 photo

Efforts to promote scientific co-operation in South-East Europe

CERN Document Server

2001-01-01

On 13 and 14 May this year CERN hosted a meeting of a task force entrusted with the task of making recommendations for the reconstruction of scientific collaboration in the countries of South-East Europe (1). This meeting follows a conference attended by delegates from the countries of South-East Europe and international experts which was held in Venice between 24 and 27 March this year. The conference was organised under the aegis of UNESCO's Regional Office for Science and Technology for Europe (ROSTE), attended by representatives of the European Science Foundation (ESF), the European Union and the Academia Europaea as well as by observers from CERN. The aim of the conference was to seek resources and assess the prospects for integration of R&D facilities in the countries of South-East Europe into the networks of European countries. Les membres du groupe de Reconstruction d'une coopération scientifique dans l'Europe du sud-est, réunis au CERN, le 14 mai dernier, dé...

The design of remote participation platform for EAST plasma control

Energy Technology Data Exchange (ETDEWEB)

Yuan, Q.P., E-mail: qpyuan@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Xiao, B.J. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); University of Science & Technology of China, Hefei (China); Zhang, R.R. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); Chai, W.T.; Liu, J.; Xiao, R.; Zhou, Z.C.; Pei, X.F. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei (China); University of Science & Technology of China, Hefei (China)

2016-11-15

Highlights: • The remote participation platform for EAST plasma control is composed of real time control service and scenario management. • The web based interface has been developed for supporting remote participation. • The functionality module has been designed and assistant tools have been developed. - Abstract: EAST has become a physics experimental platform for high parameter and steady-state long-pulse plasma operation. A new remote participation platform for EAST plasma control is designed, which is composed of gatekeeper system, web-based user interface system, discharge scenario management system, online simulation system and data interface with on-site plasma control system (PCS). The identification and access privilege of remote participator is validated by the gatekeeper system. Only authorized users can set control parameters for next shot plasma control or making discharge scenario for future shot through WebPCS which is a web-based user interface and designed based on B/S structure. The systematic architecture design and preliminary deployment of such remote platform will be presented in this paper.

The New District of East Belitung: the Review Poliferation Process

Directory of Open Access Journals (Sweden)

Hendri Yani

2013-02-01

Full Text Available The regional autonomy conducted in many functions of government. One of its forms is proliferation of region. The aim of this study was to overview the proceed of proliferation in East Belitung District. This research was a qualitative research consisted of two main techniques to collect the data; they were interview and secondary data from documentations. The findings show that there were ten steps to create the new East Belitung District. The steps started from the preparations of local’s planning and administration to the final steps in the hand of national parliaments. This study found that the number of local government in Indonesia has increases, and the process at the central government level seem relatively easy. But, the eligibility criteria being compromised. Then, the political will from communities were not clear mention. Also there was a conflict interest between local government and central government in the feasibility study for proliferation in Belitung District. It concluded that we could not deny that political intervention in the bureaucracy has facilitated the formation of East Belitung districts.

The Pattern of Road Traffic Crashes in South East Iran.

Science.gov (United States)

Rad, Mahdieh; Martiniuk, Alexandra Lc; Ansari-Moghaddam, Alireza; Mohammadi, Mahdi; Rashedi, Fariborz; Ghasemi, Ardavan

2016-09-01

In the present study, the epidemiologic aspects of road traffic crashes in South East of Iran are described. This cross-sectional study included the profile of 2398 motor vehicle crashes recorded in the police office in one Year in South East of Iran. Data collected included: demographics, the type of crash, type of involved vehicle, location of crash and factors contributing to the crash. Descriptive statistics were used for data analysis. Collisions with other vehicles or objects contributed the highest proportion (62.4%) of motor vehicle crashes. Human factors including careless driving, violating traffic laws, speeding, and sleep deprivation/fatigue were the most important causal factors accounting for 90% of road crashes. Data shows that 41% of drivers were not using a seat belt at the time of crash. One- third of the crashes resulted in injury (25%) or death (5%). Reckless driving such as speeding and violation of traffic laws are major risk factors for crashes in the South East of Iran. This highlights the need for education along with traffic law enforcement to reduce motor vehicle crashes in future.

East Asian Developmental Path and Land-Use Rights in China

Directory of Open Access Journals (Sweden)

Ganesh K. Trichur

2015-08-01

Full Text Available This paper highlights contemporary China’s long-term continuities with the historical EastAsian developmental path in relation to its post-1978 revival of market-economy traditions. Therevival of market economy traditions does not exemplify the unfolding of processes associatedwith the “one-size-fits-all” Washington Consensus. Rural land reforms were driven from belowand strongly influenced policy changes from above. Neither rural nor urban land use relationssuggest a more general unfolding of neoliberal processes of capitalist accumulation bydispossession. Contemporary Chinese land relations reflect the effects of continuities withhistorical East Asian regional traditions more strongly than do some discontinuities andruptures that emerged in the conjuncture of the mid-1980s. These continuities remain moreimportant in understanding the future of the China-led East Asian region. Like the Ming andQing dynasties, China’s Party-State is sharply focused on problems of governance. Retaininglegitimacy and recreating a welfare state to promote harmonious development rather thangrowth fetishism appears to characterize China’s current trajectory.

Thermo-mechanical analysis of RMP coil system for EAST tokamak

International Nuclear Information System (INIS)

Wang, Songke; Ji, Xiang; Song, Yuntao; Zhang, Shanwen; Wang, Zhongwei; Sun, Youwen; Qi, Minzhong; Liu, Xufeng; Wang, Shengming; Yao, Damao

2014-01-01

Highlights: • Thermal design requirements for EAST RMP coils are summarized. • Cooling parameters based on both theoretical and numerical solutions are determined. • Compromise between thermal design and structural design is made on number of turns. • Thermo-mechanical calculations are made to validate its structural performance. - Abstract: Resonant magnetic perturbation (RMP) has been proved to be an efficient approach on edge localized modes (ELMs) control, resistive wall mode (RWM) control, and error field correction (EFC), RMP coil system under design in EAST tokamak will realize the above-mentioned multi-functions. This paper focuses on the thermo-mechanical analysis of EAST RMP coil system on the basis of sensitivity analysis, both normal and off-normal working conditions are considered. The most characteristic set of coil system is chosen with a complete modelling by means of three-dimensional (3D) finite element method, thermo-hydraulic and thermal-structural performances are investigated adequately, both locally and globally. The compromise is made between thermal performance and structural design requirements, and the results indicate that the optimized design is feasible and reasonable

A policy proposal for the introduction of solar home systems in East Timor

Energy Technology Data Exchange (ETDEWEB)

Bond, M.; Fuller, R.J.; Aye, Lu [The University of Melbourne, Victoria (AU). Department of Civil and Environmental Engineering, International Technologies Centre (IDTC)

2007-12-15

The Government of East Timor aims to increase the rate of household electricity service from 20% to 80% over the next 20 years. With a largely rural population living in sparsely populated, remote locations, solar home systems (SHS) will play an important role in meeting the off-grid component of rural electrification in East Timor. This paper describes current experience and trials in East Timor with solar photovoltaic (PV) technology. It examines the East Timorese context against six 'key features' identified by the World Bank as typically included in solar PV projects: delivery infrastructure; access to finance; rural electrification policy; guarantees for minimum quality; understanding of customer needs; and scaling up capacity building. Of these issues, the authors contend that selection of the delivery infrastructure model is the most critical decision, and that for East Timor, in its present stage of development, a market-driven approach for SHS is unlikely to be successful. A model which subsidises capital costs but seeks full recovery of operating costs is recommended. Irrespective of the delivery infrastructure model, for sustainability, capacity must be developed in a range of other areas, particularly the commercial availability of high-quality components and spare parts; creation of a pool of skilled technicians for installation and maintenance; and development of a robust fee collection and maintenance infrastructure. (author)

A policy proposal for the introduction of solar home systems in East Timor

International Nuclear Information System (INIS)

Bond, M.; Fuller, R.J.; Aye, Lu

2007-01-01

The Government of East Timor aims to increase the rate of household electricity service from 20% to 80% over the next 20 years. With a largely rural population living in sparsely populated, remote locations, solar home systems (SHS) will play an important role in meeting the off-grid component of rural electrification in East Timor. This paper describes current experience and trials in East Timor with solar photovoltaic (PV) technology. It examines the East Timorese context against six 'key features' identified by the World Bank as typically included in solar PV projects: delivery infrastructure; access to finance; rural electrification policy; guarantees for minimum quality; understanding of customer needs; and scaling up capacity building. Of these issues, the authors contend that selection of the delivery infrastructure model is the most critical decision, and that for East Timor, in its present stage of development, a market-driven approach for SHS is unlikely to be successful. A model which subsidises capital costs but seeks full recovery of operating costs is recommended. Irrespective of the delivery infrastructure model, for sustainability, capacity must be developed in a range of other areas, particularly the commercial availability of high-quality components and spare parts; creation of a pool of skilled technicians for installation and maintenance; and development of a robust fee collection and maintenance infrastructure

ISSN 2073-9990 East Cent. Afr. J. surg

African Journals Online (AJOL)

Hp 630 Dual Core

To counteract this shortage, many countries are developing or expanding local training programs, both at ... East Africa and Europe. In 2011, the ... workload, work-life balance during the training and remuneration after training. Further studies ...

Methane from the East Siberian Arctic shelf

DEFF Research Database (Denmark)

Petrenko...[], Vasilii V.; Etheridge, David M.

2010-01-01

In their Report “Extensive methane venting to the atmosphere from sediments of the East Siberian Arctic Shelf” (5 March, p. 1246), N. Shakhova et al. write that methane (CH4) release resulting from thawing Arctic permafrost “is a likely positive feedback to climate warming.” They add...

Educational Transition of East Malaysian Distance Learners.

Science.gov (United States)

Saw, K. G.; Awang, M. N.; Idrus, R. M.; Atan, H.; Azli, N. A.; Jaafar, I.; Rahman, Z. A.; Latiff, Z. A.

1999-01-01

Describes results of a study of the changing perceptions of East Malaysian distance learners studying at the Universiti Sains Malaysia. Highlights include students' perceptions of their study skills; and the impact of their studies on other areas of their life, including social obligations, recreation, families, health, finances, work, and…

Ice age plant refugia in East Greenland

DEFF Research Database (Denmark)

Funder, Svend Visby

1979-01-01

From the distribution of plants it has been inferred by some botanists that ice-free areas existed in East Greenland accommodating a flora which survived one or several ice ages in the area. Comparing this evidence with recent information on the chronology of glaciations and post-glacial vegetation...

East African Journal of Sciences: Editorial Policies

African Journals Online (AJOL)

Open Access Policy. This journal provides immediate open access to its content, upon registration, on the principle that making research freely available to the public supports a greater global exchange of knowledge. Creative Commons License East African Journal of Sciences by Haramaya University is licensed under a ...

Venemaa ja Georgia sõda : suurvõimu lõks / Ivan Krastev ; tõlk. Triinu Pakk

Index Scriptorium Estoniae

Krastev, Ivan

2008-01-01

Autor kirjutab, et Venemaa-Gruusia konflikti puhul on tegemist 19. sajandi sõjaga 21. sajandi Euroopas, millele on iseloomulik võimukonfrontatsioon ilma laiema ideoloogilise polarisatsioonita. Konflikt näitas kolmekordset nurjumist: Gruusia presidendil Mihheil Saakashvilil ei õnnestunud taastada riigi territoriaalset terviklikkust, USA administratsioon näitas oma võimetust strateegilise liitlase abistamisel ning vaatamata sõjalisele edule, ei õnnestunud Venemaal mõjutada Euroopa poliitikat

Chayote (Sechium edule) causing hypokalemia in pregnancy.

Science.gov (United States)

Jensen, L P; Lai, A R

1986-11-01

A case of severe hypokalemia in pregnancy is presented. Chayote, a subtropical vegetable with potent diuretic action, is implicated, as the potassium level returned to normal, without recurrence of hypokalemia, once the ingestion was stopped.

East Carnduff Unit: corrosion problems

Energy Technology Data Exchange (ETDEWEB)

Banks, C D

1966-07-01

Waterflooding of the East Carnduff Unit began in late 1962. The first injection line leak was discovered April 29, 1965. The first 6 leaks in the East Carnduff Unit occurred within a period of less than one month--a very startling and serious warning of pending problems. Analysis of the pipe removed showed a deep pit covered by a severe scale in the piping fitting. Several remedial actions were tried in order to develop the present inhibition program. First, the lines were cleaned as well as possible utilizing rubber pig spheres with normal injection pressure. This proved very effective and 2 passes wiped out most of the scale in the lines. Only one line required acid. After the lines had been cleaned, a water treating rate of an organic amine corrosion inhibitor, 10 ppm of the scale inhibitor, and bactericide at the rate of 40 ppm slugs 2 days per month was initiated. The above treating program is in use at the present time and is maintaining a very low leak frequency. This experience has demonstrated 2 important points in waterflood operations: (1) a bare piping system in warm brine service requires constant attention to insure that it is being kept clean; and (2) reliance cannot be placed on any one method of checking corrosion rates.

SPECIFICS OF GERMAN FOREIGN POLICY IN THE MIDDLE EAST AND NORTH AFRICA

Directory of Open Access Journals (Sweden)

Г А Ханнанова

2017-12-01

Full Text Available The article is devoted to an analysis of the main factors, determining German policy in the Middle East and North Africa (MENA. More active German military-technical engagement in the settlement of the crises in the region on the modern stage determines relevance of this article’s topic. Based on historical method, author considers the development of German foreign policy in the Arab world, examining the main aspects of the colonial policy of German empire on the threshold of the First and Second World Wars, as well as the prerequisites of the intensification of German-Arabic contacts in the period of Cold War. In accordance with the principals of system analysis Germany’s Middle East policy was investigated in complex, given geopolitical, economic and military aspects. Special emphasis is put on the problem of transformation of Middle East regional order as a factor of political instability. Notwithstanding the rea-sonableness of Germany’s standing for stable and predictable regional order, these goals were challenged owing to the fact that Germany benefits from the regional disorder in terms of increase of its influence. In reliance on the German goals in the Middle East and North Africa, mentioned in the Coalition Agreement of 2013, the author points out the priority of crisis management. At the same time the ethno-confessional conflict potential of the region meets the interests of German military-industrial complex. Increase of Germany’s export of weapons to the Arab states as well as neglecting the restrictions on export go to prove that Germany backs the armaments race in the Middle East. In this regard, German policy is characterized by “double standards” and inconsistency. These specifics can be explained by the ongoing process of Middle East policy shift and searching for new priorities on a long-term horizon. In the conclusion, the author analyzes the specifics and prospects of German policy in MENA region.

Development and test of decoupler for ICRF antenna in EAST

Energy Technology Data Exchange (ETDEWEB)

Chen, Gen, E-mail: chengen@ipp.ac.cn; Mao, Yuzhou; Zhao, Yanping; Yuan, Shuai; Zhang, Xinjun; Qing, Chengming

2016-06-15

Highlights: • The mechanism of decoupler for ICRF antenna is proposed. • Three candidate assembly positions for the decouper can be used. • The performance relies on the ohmic dissipation and the assembly position of decoupler. - Abstract: Ion Cyclotron Range of Frequency (ICRF) heating has been adopted in EAST tokamak as one of main auxiliary heating methods. The ICRF antenna usually consists of multiple launching elements because of limited port and space of tokamak device. Mutual coupling between straps has been observed in previous EAST ICRF current drive experiments. Due to adverse effects of such mutual coupling, many issues induced by cross power cannot be ignored, such as power imbalance in feed lines, high voltage standing wave ratio (VSWR), and etc. To restrain such mutual coupling, A device named decoupler was developed and tested in EAST ICRF system. According to the admittance matrix of load, three assembly positions (oscillation position, optimum position, and smooth position) along transmission line for the decoupler were taken into account and tested. The test results showed that ohmic dissipation in decoupler could not be neglected, which partly influenced the decoupling performance. The oscillation position and optimum position could restrain such adverse effects of ohmic dissipation and showed good decoupling performance. However, they cannot ensure the steady operation during H-mod due to the load variation. Finally, the smooth position has been adopted for EAST I port antenna because of steady decoupling performance comprised with engineering error and load resilience, which sincerely enhance the capability of system operation.

Autonomous Energy Sources in the North of the Far East: Current State and Directions of Diversification

Directory of Open Access Journals (Sweden)

Boris Grigorievich Saneev

2018-03-01

Full Text Available The paper presents the current state of autonomous energy sources in the north of the Far East. Consideration is given to the capacity structures with a focus on industrial and residential autonomous energy sources. One of the main problems facing power supply to residential consumers in the north of the Far East is the insufficiently developed transport infrastructure, which causes complicated fuel delivery patterns, fuel price rise, and hence high electricity generation cost. The changes in the installed capacity of renewable energy sources (RES in the north of the Far East are demonstrated for the period between 2011 and 2015. The research shows the main directions of power production diversification in the north of the Far East. The directions include the use of local fuel types, the development of cogeneration, the involvement of renewable energy sources and small-scale nuclear power plants. The paper presents a forecast for the renewable energy development in the north of the Far East up to 2035, made by the authors. The priority RES projects in the off-grid power supply in the north of the Far East are wind and solar power plants

Filterscope diagnostic system on EAST tokamak

International Nuclear Information System (INIS)

Xu, Z.; Wu, Z.W.; Gao, W.; Zhang, L.; Huang, J.; Chen, Y.J.; Wu, C.R.; Zhang, P.F.

2015-01-01

Filterscope diagnostic system, which is designed for monitoring the line emission in fusion plasma has been widely used on fusion devices such as DIII-D, NSTX, CDX-U, KSTAR etc. On EAST (Experimental Advanced Superconducting Tokamak), a filterscope diagnostic system has been mounted to observe the line emission and visible bremsstrahlung emission in plasma from discharge campaign of 2014. It plays a crucial role in studying Edge Localized Modes (ELM) and H-mode, thanks to its high temporal resolution (0.005ms) and good spatial resolution (∼2cm). Furthermore, multi-channel signals at up to 200kHz sampling rates can be digitized simultaneously. The wavelength covers He II (468.5nm), Li I (670.8nm), Li II (548.3nm), C III (465.0nm), O II (441.5nm), Mo I (386.4nm), W I (400.9nm) and visible bremsstrahlung radiation at 538nm besides Dα (656.1nm) and Dγ (433.9nm) with the corresponding wavelength filters. The new developed filterscope system was operating during the EAST 2014 fall experimental campaign and several types ELMs has been observed. (author)

General practitioners and clinical guidelines | Bhagat | East African ...

African Journals Online (AJOL)

East African Medical Journal. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 78, No 1 (2001) >. Log in or Register to get access to full text downloads.