Sample records for capture dissociation ai

  1. Electron capture dissociation of singly and multiply phosphorylated peptides

    Stensballe, A; Jensen, Ole Nørregaard; Olsen, J V; Haselmann, K F; Zubarev, R A


    Analysis of phosphotyrosine and phosphoserine containing peptides by nano-electrospray Fourier transform ion cyclotron resonance (FTICR) mass spectrometry established electron capture dissociation (ECD) as a viable method for phosphopeptide sequencing. In general, ECD spectra of synthetic and...... native phosphopeptides appeared less complex than conventional collision activated dissociation (CAD) mass spectra of these species. ECD of multiply protonated phosphopeptide ions generated mainly c- and z(.)-type peptide fragment ion series. No loss of water, phosphate groups or phosphoric acid from...... intact phosphopeptide ions nor from the c and z(.) fragment ion products was observed in the ECD spectra. ECD enabled complete or near-complete amino acid sequencing of phosphopeptides for the assignment of up to four phosphorylation sites in peptides in the mass range 1400 to 3500 Da. Nano-scale Fe...

  2. Collision-induced dissociation and dissociative capture of H2+ in Ar and Kr

    Measurements of the absolute total and differential cross sections for the production of protons and hydrogen atoms in the energy range of 1-5 keV for reactions of H2+ molecular ions in Ar and Kr targets are reported. The results show that the cross section for the dissociative capture (DC) proccess is about one order of magnitude higher than that for the collision-induced dissociation. The angular distribution of the fragments in both targets and for all acceleration energies shows a monotonic decrease in the differential cross section with increasing angle. A sharp increase in the angular distribution at scattering angles <1.6 deg. is observed for hydrogen atoms resulting from DC and in particular for the Kr target

  3. Ion induced dissociation of tetraphenyl iron(III) porphyrin chloride and electron-capture induced dissociation of protoporphyrin IX ions

    We performed experiments concerning the fragmentation of different porphyrin molecules. Multi-ionisation and ion-induced fragmentation of FeTPPCl''q''+ (q = 1 to 4) have been studied in slow collisions with multiply charged ions. We have shown also electron-capture induced dissociation of protoporphyrin cations, where two electrons in two successive have been captured in order to convert it to the corresponding even-electron anions. All fragmentation processes are discussed in terms of charge mobility.

  4. Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry.

    Sweet, Steve M.M.; Bailey, Christopher M; Cunningham, Debbie L.; Heath, John K.; Cooper, Helen J.


    We used on-line electron capture dissociation (ECD) for the large scale identification and localization of sites of phosphorylation. Each FT-ICR ECD event was paired with a linear ion trap collision-induced dissociation (CID) event, allowing a direct comparison of the relative merits of ECD and CID for phosphopeptide identification and site localization. Linear ion trap CID was shown to be most efficient for phosphopeptide identification, whereas FT-ICR ECD was superior for localization of si...

  5. Large Scale Localization of Protein Phosphorylation by Use of Electron Capture Dissociation Mass Spectrometry * S⃞

    Sweet, Steve M.M.; Bailey, Christopher M; Cunningham, Debbie L.; Heath, John K.; Cooper, Helen J.


    We used on-line electron capture dissociation (ECD) for the large scale identification and localization of sites of phosphorylation. Each FT-ICR ECD event was paired with a linear ion trap collision-induced dissociation (CID) event, allowing a direct comparison of the relative merits of ECD and CID for phosphopeptide identification and site localization. Linear ion trap CID was shown to be most efficient for phosphopeptide identification, whereas FT-ICR ECD was superior for localization of si...

  6. Probing the Mechanism of Electron Capture and Electron Transfer Dissociation Using Tags with Variable Electron Affinity

    Sohn, Chang Ho; Chung, Cheol K.; Yin, Sheng; Ramachandran, Prasanna; Loo, Joseph A; Beauchamp, J. L.


    Electron capture dissociation (ECD) and electron transfer dissociation (ETD) of doubly protonated electron affinity (EA)-tuned peptides were studied to further illuminate the mechanism of these processes. The model peptide FQpSEEQQQTEDELQDK, containing a phosphoserine residue, was converted to EA-tuned peptides via β-elimination and Michael addition of various thiol compounds. These include propanyl, benzyl, 4-cyanobenzyl, perfluorobenzyl, 3,5-dicyanobenzyl, 3-nitrobenzyl, and 3,5-dinitrobenz...

  7. Theory and Application of Dissociative Electron Capture in Molecular Identification

    Havey, C D; Jones, T; Voorhees, K J; Laramee, J A; Cody, R B; Clougherty, D P; Eberhart, Mark; Voorhees, Kent J.; Laramee, James A.; Cody, Robert B.; Clougherty, Dennis P.


    The coupling of an electron monochromator (EM) to a mass spectrometer (MS) has created a new analytical technique, EM-MS, for the investigation of electrophilic compounds. This method provides a powerful tool for molecular identification of compounds contained in complex matrices, such as environmental samples. EM-MS expands the application and selectivity of traditional MS through the inclusion of a new dimension in the space of molecular characteristics--the electron resonance energy spectrum. However, before this tool can realize its full potential, it will be necessary to create a library of resonance energy scans from standards of the molecules for which EM-MS offers a practical means of detection. Here, an approach supplementing direct measurement with chemical inference and quantum scattering theory is presented to demonstrate the feasibility of directly calculating resonance energy spectra. This approach makes use of the symmetry of the transition-matrix element of the captured electron to discriminat...

  8. The role of dissociative electron capture in collisions of slow He2+ ions with CO

    Translational energy spectroscopy (TES) has been used to study one-electron capture by 0.2-1 keV amu-1 He2+ ions in CO and identify, for the first time, the main excited product channels and determine cross sections for both dissociative and non-dissociative processes. Cross sections are shown to be strongly energy dependent over the energy range considered with the contribution from exothermic dissociative electron capture channels associated with He+(1s) formation accounting for about 99% of the total cross section at the lowest energy considered. Endothermic channels arising from non-dissociative one-electron capture have been observed which increase in relative importance as the impact energy increases. These lead to either He+(n=2) or He+(n=3) formation and various states of CO+ with some evidence of vibrational excitation. Of these, the He+(n=2)+CO+[X2Σ+] product channel (with an energy defect ΔE=-0.42 eV) is dominant and this accounts for about 40% of the total cross section at 1 keV amu-1. (author)

  9. Dipole-Guided Electron Capture Causes Abnormal Dissociations of Phosphorylated Pentapeptides

    Moss, Christopher L.; Chung, Thomas W.; Wyer, Jean A.; Nielsen, Steen Brøndsted; Hvelplund, Preben; Tureček, František


    Electron transfer and capture mass spectra of a series of doubly charged ions that were phosphorylated pentapeptides of a tryptic type (pS,A,A,A,R) showed conspicuous differences in dissociations of charge-reduced ions. Electron transfer from both gaseous cesium atoms at 100 keV kinetic energies and fluoranthene anion radicals in an ion trap resulted in the loss of a hydrogen atom, ammonia, and backbone cleavages forming complete series of sequence z ions. Elimination of phosphoric acid was negligible. In contrast, capture of low-energy electrons by doubly charged ions in a Penning ion trap induced loss of a hydrogen atom followed by elimination of phosphoric acid as the dominant dissociation channel. Backbone dissociations of charge-reduced ions also occurred but were accompanied by extensive fragmentation of the primary products. z-Ions that were terminated with a deaminated phosphoserine radical competitively eliminated phosphoric acid and H2PO4 radicals. A mechanism is proposed for this novel dissociation on the basis of a computational analysis of reaction pathways and transition states. Electronic structure theory calculations in combination with extensive molecular dynamics mapping of the potential energy surface provided structures for the precursor phosphopeptide dications. Electron attachment produces a multitude of low lying electronic states in charge-reduced ions that determine their reactivity in backbone dissociations and H- atom loss. The predominant loss of H atoms in ECD is explained by a distortion of the Rydberg orbital space by the strong dipolar field of the peptide dication framework. The dipolar field steers the incoming electron to preferentially attach to the positively charged arginine side chain to form guanidinium radicals and trigger their dissociations.

  10. Evaluation and optimization of electron capture dissociation efficiency in fourier transform ion cyclotron resonance mass spectrometry.

    McFarland, Melinda A; Chalmers, Michael J; Quinn, John P; Hendrickson, Christopher L; Marshall, Alan G


    Electron capture dissociation (ECD) efficiency has typically been lower than for other dissociation techniques. Here we characterize experimental factors that limit ECD and seek to improve its efficiency. Efficiency of precursor to product ion conversion was measured for a range of peptide (approximately 15% efficiency) and protein (approximately 33% efficiency) ions of differing sizes and charge states. Conversion of precursor ions to products depends on electron irradiation period and maximizes at approximately 5-30 ms. The optimal irradiation period scales inversely with charge state. We demonstrate that reflection of electrons through the ICR cell is more efficient and robust than a single pass, because electrons can cool to the optimal energy for capture, which allows for a wide range of initial electron energy. Further, efficient ECD with reflected electrons requires only a short (approximately 500 micros) irradiation period followed by an appropriate delay for cooling and interaction. Reflection of the electron beam results in electrons trapped in or near the ICR cell and thus requires a brief (approximately 50 micros) purge for successful mass spectral acquisition. Further electron irradiation of refractory precursor ions did not result in further dissociation. Possibly the ion cloud and electron beam are misaligned radially, or the electron beam diameter may be smaller than that of the ion cloud such that remaining precursor ions do not overlap with the electron beam. Several ion manipulation techniques and use of a large, movable dispenser cathode reduce the possibility that misalignment of the ion and electron beams limits ECD efficiency. PMID:15914017

  11. Electron capture dissociation proceeds with a low degree of intramolecular migration of peptide amide hydrogens

    Rand, Kasper D; Adams, Christopher M; Zubarev, Roman A;


    scrambling) that occurs during vibrational excitation of gas-phase ions. Unlike traditional collisional ion activation, electron capture dissociation (ECD) is not associated with substantial vibrational excitation. We investigated the extent of intramolecular backbone amide hydrogen (1H/2H) migration upon...... electrospray ion source by, e.g., high declustering potentials or during precursor ion selection (via sideband excitation) in the external linear quadrupole ion trap undergo nearly complete hydrogen (1H/2H) scrambling. Similarly, collision-induced dissociation (CID) in the external linear quadrupole ion trap...... closely mimic the known solution deuteration pattern of the selectively labeled peptides. This excellent correlation between the results obtained from gas phase and solution suggests that ECD holds great promise as a general method to obtain single residue resolution in proteins from solution 1H/2H...

  12. Hydrogen rearrangement to and from radical z fragments in electron capture dissociation of peptides

    Savitski, Mikhail M; Kjeldsen, Frank; Nielsen, Michael L;


    capture dissociation (ECD), including previously unreported double H. losses. Consistent with the radical character of H. abstraction, the residue determining the formation rate of z' = z. + H. species is found to be the N-terminal residue in z. species. The size of the complementary c(m)' fragment turned...... out to be another important factor, with z' species dominating over z. ions for m

  13. Dissociative electron capture in collisions between Ar8+ and CO2

    We are using the Cold Target Recoil Ion Spectroscopy (COLTRIMS) to investigate the break up of CO2 molecules in impact processes with slow highly charged ions. While the slow highly charged ions passes the CO2 molecule electron capture into the projectile causes a conformation change of the CO2 molecule. With the COLTRIMS set up we are able to measure the 4π solid angle in momentum space of the dissociating ion fragments. The motivation for this experiment is to ascertain the change of the CO2 molecule conformation

  14. A Variety of Activation Methods Employed in 'Activated-Ion' Electron Capture Dissociation Mass Spectrometry: A Test against Bovine Ubiquitin 7+ Ions

    Fragmentation efficiencies of various 'activated-ion' electron capture dissociation (AI-ECD) methods are compared for a model system of bovine ubiquitin 7+ cations. In AI-ECD studies, sufficient internal energy was given to protein cations prior to ECD application using IR laser radiation, collisions, blackbody radiation, or in-beam collisions, in turn. The added energy was utilized in increasing the population of the precursor ions with less intra-molecular noncovalent bonds or enhancing thermal fluctuations of the protein cations. Removal of noncovalent bonds resulted in extended structures, which are ECD friendly. Under their best conditions, a variety of activation methods showed a similar effectiveness in ECD fragmentation. In terms of the number of fragmented inter-residue bonds, IR laser/blackbody infrared radiation and 'in-beam' activation were almost equally efficient with ∼70% sequence coverage, while collisions were less productive. In particular, 'in-beam' activation showed an excellent effectiveness in characterizing a pre-fractionated single kind of protein species. However, its inherent procedure did not allow for isolation of the protein cations of interest

  15. Rapid electron capture dissociation of mass-selectively accumulated oligodeoxynucleotide dications

    Schultz, Kristin N.; Håkansson, Kristina


    We have performed extended characterization of the fragmentation patterns of oligodeoxynucleotide dications following electron capture dissociation (ECD) utilizing improved instrumentation. Our current results from a 9.4 T Fourier transform ion cyclotron resonance mass spectrometer equipped with mass-selective external ion accumulation and an indirectly heated dispenser cathode electron source demonstrate much richer fragmentation than from a previous 7 T instrument with a directly heated filament electron source. We propose the previous absence of backbone product ions from purine-containing oligonucleotides is a result of intramolecular hydrogen bonding, preventing product ions from separating. Similar behavior is observed at non-optimized ECD conditions with the current instrumentation. However, infrared laser heating of the resulting charge-reduced radical species results in extensive backbone fragmentation (different from infrared multiphoton dissociation) of the oligonucleotide dA6, demonstrating potential for ECD to characterize nucleic acid secondary structure. Under more optimized conditions, rich fragmentation, mostly in terms of w, (a/z-B), and (c/x-B) products, is observed for dA6, dC6, dG5, and d(GCATGC) following ECD only, allowing complete sequencing in several cases. The current ECD spectra contain some doubly charged products, indicating that populations of gas-phase oligodeoxynucleotide dications are zwitterionic.

  16. Advantages of external accumulation for electron capture dissociation in Fourier transform mass spectrometry.

    Haselmann, K F; Budnik, B A; Olsen, J V; Nielsen, M L; Reis, C A; Clausen, H; Johnsen, A H; Zubarev, R A


    A combination of external accumulation (XA) with electron capture dissociation (ECD) improves the electron capture efficiency, shortens the analysis time, and allows for rapid integration of multiple scans in Fourier transform mass spectrometry. This improves the signal-to-noise ratio and increases the number of detected products, including structurally important MS3 fragments. With XA-ECD, the range of the labile species amenable to ECD is significantly extended. Examples include the first-time determination of the positions of six GalNAc groups in a 60-residue peptide, five sialic acid and six O-linked GalNAc groups in a 25-residue peptide, and the sulfate group position in a 11-residue peptide. Even weakly bound supramolecular aggregates, including nonspecific peptide complexes, can be analyzed with XA-ECD. Preliminary results are reported on high-rate XA-ECD that uses an indirectly heated dispenser cathode as an electron source. This shortens the irradiation time to > or = 1 ms and increases the acquisition rate to 3 scans/s, an improvement by a factor of 10-100. PMID:11467546

  17. Combined infrared multiphoton dissociation and electron-capture dissociation using co-linear and overlapping beams in Fourier transform ion cyclotron resonance mass spectrometry.

    Mihalca, Romulus; van der Burgt, Yuri E M; McDonnell, Liam A; Duursma, Marc; Cerjak, Iliya; Heck, Albert J R; Heeren, Ron M A


    A novel set-up for Fourier transform ion cyclotron resonance mass spectrometry (FTICR) is reported for simultaneous infrared multiphoton dissociation (IRMPD) and electron-capture dissociation (ECD). An unmodified electron gun ensures complete, on-axis overlap between the electron and the photon beams. The instrumentation, design and implementation of this novel approach are described. In this configuration the IR beam is directed into the ICR cell using a pneumatically actuated mirror inserted into the ion-optical path. Concept validation was made using different combinations of IRMPD and ECD irradiation events on two standard peptides. The ability to perform efficient IRMPD, ECD and especially simultaneous IRMPD and ECD using lower irradiation times is demonstrated. The increase in primary sequence coverage, with the combined IRMPD and ECD set-up, also increases the confidence in peptide and protein assignments. PMID:16705647

  18. Probing the Electron Capture Dissociation Mass Spectrometry of Phosphopeptides with Traveling Wave Ion Mobility Spectrometry and Molecular Dynamics Simulations

    Kim, Doyong; Pai, Pei-Jing; Creese, Andrew J.; Jones, Andrew W.; Russell, David H.; Cooper, Helen J.


    Electron capture dissociation mass spectrometry offers several advantages for the analysis of peptides, most notably that backbone c and z fragments typically retain labile modifications such as phosphorylation. We have shown previously that, in some cases, the presence of phosphorylation has a deleterious effect on peptide sequence coverage, and hypothesized that intramolecular interactions involving the phosphate group were preventing separation of backbone fragments. In the present work, w...

  19. Capture cross-section and rate of the 14C(, )15C reaction from the Coulomb dissociation of 15C

    Shubhchintak; Neelam; R Chatterjee


    We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the photodisintegration of 15C, using the principle of detailed balance. Our theoretical model is free from the uncertainties associated with the multipole strength distributions of the projectile.

  20. Combined infrared multiphoton dissociation and electron capture dissociation with a hollow electron beam in Fourier transform ion cyclotron resonance mass spectrometry.

    Tsybin, Youri O; Witt, Matthias; Baykut, Gökhan; Kjeldsen, Frank; Håkansson, Per


    An electron injection system based on an indirectly heated ring-shaped dispenser cathode has been developed and installed in a 7 Tesla Fourier transform ion cyclotron resonance (FTICR) mass spectrometer. This new hardware design allows high-rate electron capture dissociation (ECD) to be carried out by a hollow electron beam coaxial with the ion cyclotron resonance (ICR) trap. Infrared multiphoton dissociation (IRMPD) can also be performed with an on-axis IR-laser beam passing through a hole at the centre of the dispenser cathode. Electron and photon irradiation times of the order of 100 ms are required for efficient ECD and IRMPD, respectively. As ECD and IRMPD generate fragments of different types (mostly c, z and b, y, respectively), complementary structural information that improves the characterization of peptides and proteins by FTICR mass spectrometry can be obtained. The developed technique enables the consecutive or simultaneous use of the ECD and IRMPD methods within a single FTICR experimental sequence and on the same ensemble of trapped ions in multistage tandem (MS/MS/MS or MS(n)) mass spectrometry. Flexible changing between ECD and IRMPD should present advantages for the analysis of protein digests separated by liquid chromatography prior to FTICRMS. Furthermore, ion activation by either electron or laser irradiation prior to, as well as after, dissociation by IRMPD or ECD increases the efficiency of ion fragmentation, including the w-type fragment ion formation, and improves sequencing of peptides with multiple disulfide bridges. The developed instrumental configuration is essential for combined ECD and IRMPD on FTICR mass spectrometers with limited access into the ICR trap. PMID:12872281

  1. AI Topics

    Buchanan, Bruce G; Glick, Jonathan


    The debut of the AI in the News column elsewhere in this issue of AI Magazine created a good opportunity to introduce the professional community to the AI Topics web site, home of the AI in the news virtual page. Although AI Topics is designed for the lay public, it serves a much larger audience.

  2. Ai ai ai (4/4 F)


    Laulun sanat: Ai, ai ai, kun sydämen' on pois! Kuka sen jälleen takaisin tois? Joudu, joudu, ota häntä kii, Joka minun sydämeni varasti! Joudu, joudu, ota häntä kii, Joka minun sydämeni varasti!

  3. DNA hybridization on microparticles: determining capture-probe density and equilibrium dissociation constants.

    Wilkins Stevens, P; Henry, M. R.; Kelso, D M


    Many DNA-probe assays utilize oligonucleotide-coated microparticles for capture of complementary nucleic acids from solution. During development of these assays, as well as in other particle-based nucleic acid applications, it is useful to know both the amount of duplex formation expected under various experimental conditions and the coating density of the capture oligonucleotide on the particle surface. We examined the simplest form of a DNA-probe microparticle assay: hybridization of a part...

  4. Dipole-Guided Electron Capture Causes Abnormal Dissociations of Phosphorylated Pentapeptides

    Moss, Christopher L.; Chung, Thomas W.; Wyer, Jean; Nielsen, Steen Brøndsted; Hvelplund, Preben; Turecek, Frantisek


    phosphoserine radical competitively eliminated phosphoric acid and H2PO4 radicals. A mechanism is proposed for this novel dissociation on the basis of a computational analysis of reaction pathways and transition states. Electronic structure theory calculations in combination with extensive molecular dynamics...... in ECD is explained by a distortion of the Rydberg orbital space by the strong dipolar field of the peptide dication framework. The dipolar field steers the incoming electron to preferentially attach to the positively charged arginine side chain to form guanidinium radicals and trigger their...

  5. Probing the Electron Capture Dissociation Mass Spectrometry of Phosphopeptides with Traveling Wave Ion Mobility Spectrometry and Molecular Dynamics Simulations

    Kim, Doyong; Pai, Pei-Jing; Creese, Andrew J.; Jones, Andrew W.; Russell, David H.; Cooper, Helen J.


    Electron capture dissociation mass spectrometry offers several advantages for the analysis of peptides, most notably that backbone c and z fragments typically retain labile modifications such as phosphorylation. We have shown previously that, in some cases, the presence of phosphorylation has a deleterious effect on peptide sequence coverage, and hypothesized that intramolecular interactions involving the phosphate group were preventing separation of backbone fragments. In the present work, we seek to rationalize the observed ECD behavior through a combination of ECD of model peptides, traveling wave ion mobility mass spectrometry and molecular dynamics simulations. The results suggest that for doubly protonated ions of phosphopeptide APLpSFRGSLPKSYVK a salt-bridge structure is favored, whereas for the doubly-protonated ions of APLSFRGSLPKpSYVK ionic hydrogen bonds predominate.

  6. Determining the Binding Sites of β-Cyclodextrin and Peptides by Electron-Capture Dissociation High Resolution Tandem Mass Spectrometry

    Qi, Yulin; Geib, Timon; Volmer, Dietrich A.


    Cyclodextrins (CDs) are a group of cyclic oligosaccharides, which readily form inclusion complexes with hydrophobic compounds to increase bioavailability, thus making CDs ideal drug excipients. Recent studies have also shown that CDs exhibit a wide range of protective effects, preventing proteins from aggregation, degradation, and folding. These effects strongly depend on the binding sites on the protein surface. CDs only exhibit weak interactions with amino acids, however; conventional analytical techniques therefore usually fail to reveal the exact location of the binding sites. Moreover, some studies even suggest that CD inclusion complexes are merely electrostatic adducts. Here, electron capture dissociation (ECD) was applied in this proof-of-concept study to examine the exact nature of the CD/peptide complexes, and CD binding sites were unambiguously located for the first time via Fourier-transform ion cyclotron resonance (FTICR) tandem mass spectrometry.

  7. Dissociative electron capture by halogenated alkanes and kinetics of the low energy electron attachment by chloroalkanes

    Data are presented for a series of halogen containing hydrocarbons closely related to the freon molecules studied by the use of electron capture negative ion mass spectrometry. Temperature dependence of negative ion effective yield is discussed. Thermal electron attachment processes in the mixtures of chloroalkanes with carbon dioxide have been investigated using an electron swarm method. All of them (except CH2Cl2) attach electrons only in a two-body process. Corresponding rate constants have been determined. (author)

  8. Comment on "Structure effects in the $^{15}$N(n,$\\gamma$)$^{16}$N radiative capture reaction from the Coulomb dissociation of $^{16}$N"

    Mohr, Peter


    In their recent study Neelam, Shubhchintak, and Chatterjee have claimed that "it would certainly be useful to perform a Coulomb dissociation experiment to find the low energy capture cross section for the reaction" $^{15}$N(n,$\\gamma$)$^{16}$N. However, it is obvious that a Coulomb dissociation experiment cannot constrain this capture cross section because the dominating branchings of the capture reaction lead to excited states in $^{16}$N which do not contribute in a Coulomb dissociation experiment. An estimate of the total $^{15}$N(n,$\\gamma$)$^{16}$N cross section from Coulomb dissociation of $^{16}$N requires a precise knowledge of the $\\gamma$-ray branchings in the capture reaction. Surprisingly, the calculation of Neelam, Shubhchintak, and Chatterjee predicts a strongly energy-dependent ground state branching of the order of 0.05\\% to 0.6\\% at energies between 100 and 500 keV which is almost 2 orders of magnitude below calculations in the direct capture model. Additionally, this calculation of Neelam, S...

  9. AIS authentication


    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login ( Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  10. Electron capture dissociation and drift tube ion mobility-mass spectrometry coupled with site directed mutations provide insights into the conformational diversity of a metamorphic protein

    Harvey, Sophie R.; Porrini, Massimiliano; Tyler, Robert C.; MacPhee, Cait E.; Volkman, Brian F.; Barran, Perdita E.


    Ion mobility mass spectrometry can be combined with data from top-down sequencing to discern adopted conformations of proteins in the absence of solvent. This multi-technique approach has particular applicability for conformationally dynamic systems. Previously, we demonstrated the use of drift tube ion mobility-mass spectrometry (DT IM-MS) and electron capture dissociation (ECD) to study the metamorphic protein lymphotactin (Ltn). Ltn exists in equilibrium between distinct monomeric (Ltn10) ...

  11. Nanosolvation by acetonitrile and 18-crown-6 ether induce strongly different effects on the electron-capture induced dissociation of aromatic tripeptide cations in the gas phase

    MacLot, S.; Rangama, J.; Nielsen, Steen Brøndsted; Poully, J.-C.


    Experimental gas-phase Electron Capture-Induced Dissociation (ECID) coupled to mass-spectrometry has been performed on the doubly-protonated tripeptides Lys-Trp-Lys (KWK) and Lys-Tyr-Lys (KYK). In this report, we focus on the influence of non-covalent binding of two different molecules, acetonitr......Experimental gas-phase Electron Capture-Induced Dissociation (ECID) coupled to mass-spectrometry has been performed on the doubly-protonated tripeptides Lys-Trp-Lys (KWK) and Lys-Tyr-Lys (KYK). In this report, we focus on the influence of non-covalent binding of two different molecules......, acetonitrile and 18-crown-6 ether (CE), to these tripeptide cations on the relative probabilities of their main fragmentation channels (H loss, NH3 loss and N — Cα bond cleavage) after electron capture from sodium atoms. First, we recorded the spectra of bare peptide ions, and found that N — Cα bond cleavage...... by one and two molecules show that acetonitrile evaporation is almost complete a few microseconds after electron capture, whereas fragments nanosolvated by CE are abundant. This is consistent with the binding energy of these molecules to lysine-containing peptides, which is much higher for CE than...

  12. Reply to comments on `Structure effects in the $^{15}$N($n,\\gamma$)$^{16}$N radiative capture reaction from the Coulomb dissociation of $^{16}$N'

    Shubhchintak,; Chatterjee, R


    We reply to the comments (arXiv:1605.07499 [nucl-th]) on "Structure effects in the $^{15}$N($n,\\gamma$)$^{16}$N radiative capture reaction from the Coulomb dissociation of $^{16}$N". We have investigated the issue of "energy dependence of branching ratios" and believe that this energy dependence is due to the proper inclusion of the non-resonant continuum in the post-form reaction theory. Interestingly, this energy dependence is sensitive to the relative orbital angular momentum content of the state. We reiterate that we have attempted to resolve the discrepancy in the spectroscopic factors of low-lying $^{16}$N levels and that it is essential to know the low energy $^{15}$N($n,\\gamma$)$^{16}$N capture cross section, especially below 0.25 MeV.

  13. Conversion of 3-nitrotyrosine to 3-aminotyrosine residues facilitates mapping of tyrosine nitration in proteins by electrospray ionization-tandem mass spectrometry using electron capture dissociation.

    Guo, Jia; Prokai, Laszlo


    Protein tyrosine nitration is associated with oxidative stress and various human diseases. Tandem mass spectrometry has been the method of choice for the identification and localization of this posttranslational modification to understand the underlying mechanisms and functional consequences. Due to the electron predator effect of the nitro group limiting fragmentation of the peptide backbone, electron-based dissociation has not been applicable, however, to nitrotyrosine-containing peptides. A straightforward conversion of the nitrotyrosine to the aminotyrosine residues is introduced to address this limitation. When tested with nitrated ubiquitin and human serum albumin as model proteins in top-down and bottom-up approaches, respectively, this chemical derivatization enhanced backbone fragmentation of the corresponding nitroproteins and nitropeptides by electron capture dissociation (ECD). Increased sequence coverage has been obtained by combining in the bottom-up strategy the conversion of nitrotyrosine to aminotyrosine and introducing, in addition to trypsin, a further digesting enzyme of complementary specificity, when protein nitration was mapped by liquid chromatography-electrospray ionization tandem mass spectrometry using both collision-induced dissociation (CID) and ECD. PMID:23280749

  14. Distinguishing of Ile/Leu amino acid residues in the PP3 protein by (hot) electron capture dissociation in Fourier transform ion cyclotron resonance mass spectrometry.

    Kjeldsen, Frank; Haselmann, Kim F; Sørensen, Esben S; Zubarev, Roman A


    In hot electron capture dissociation (HECD), multiply protonated polypeptides fragment upon capturing approximately 11-eV electrons. The excess of energy upon the primary c, z* cleavage induces secondary fragmentation in z* fragments. The resultant w ions allow one to distinguish between the isomeric Ile and Leu residues. The analytical utility of HECD is evaluated using tryptic peptides from the bovine milk protein PP3 containing totally 135 amino acid residues. Using a formal procedure for Ile/Leu (Xle) residue assignment, the identities of 20 out of 25 Xle residues (80%) were determined. The identity of an additional two residues could be correctly guessed from the absence of the alternative w ions, and only two residues, for which neither expected nor alternative w ions were observed, remained unassigned. Reinspection of conventional ECD spectra also revealed the presence of Xle w ions, although at lower abundances, with 44% of all Xle residues distinguished. Using a dispenser cathode as an electron source, identification of four out of five Xle residues in a 2.7-kDa peptide was possible with one acquisition 2 s long, with identification of all five residues by averaging of five such acquisitions. Unlike the case of high-energy collision-induced dissociation, no d ions were observed in the HECD of tryptic peptides. PMID:12659185

  15. Combined electron capture and infrared multiphoton dissociation for multistage MS/MS in a Fourier transform ion cyclotron resonance mass spectrometer.

    Håkansson, Kristina; Chalmers, Michael J; Quinn, John P; McFarland, Melinda A; Hendrickson, Christopher L; Marshall, Alan G


    We have mounted a permanent on-axis dispenser cathode electron source inside the magnet bore of a 9.4-T Fourier transform ion cyclotron resonance mass spectrometer. This configuration allows electron capture dissociation (ECD) to be performed reliably on a millisecond time scale. We have also implemented an off-axis laser geometry that enables simultaneous access to ECD and infrared multiphoton dissociation (IRMPD). Optimum performance of both fragmentation techniques is maintained. The analytical utility of performing either ECD or IRMPD on a given precursor ion population is demonstrated by structural characterization of several posttranslationally modified peptides: IRMPD of phosphorylated peptides results in few backbone (b- and y-type) cleavages, and product ion spectra are dominated by neutral loss of H3PO4. In contrast, ECD provides significantly more backbone (c- and z*-type) cleavages without loss of H3PO4. For N-glycosylated tryptic peptides, IRMPD causes extensive cleavage of the glycosidic bonds, providing structural information about the glycans. ECD cleaves all backbone bonds (except the N-terminal side of proline) in a 3-kDa glycopeptide with no saccharide loss. However, only a charge-reduced radical species and some side chain losses are observed following ECD of a 5-kDa glycopeptide from the same protein. An MS3 experiment involving IR laser irradiation of the charge-reduced species formed by electron capture results in extensive dissociation into c- and z-type fragment ions. Mass-selective external ion accumulation is essential for the structural characterization of these low-abundance (modified) peptides. PMID:12964777

  16. Structure effects in the 15N(n ,γ )16N radiative capture reaction from the Coulomb dissociation of 16N

    Neelam, Shubhchintak, Chatterjee, R.


    Background: The 15N(n ,γ )16N reaction plays an important role in red giant stars and also in inhomogeneous big bang nucleosynthesis. However, there are controversies regarding spectroscopic factors of the four low-lying states of 16N, which have direct bearing on the total direct capture cross section and also on the reaction rate. Direct measurements of the capture cross section at low energies are scarce and available only at three energies below 500 keV. Purpose: The aim of this paper is to calculate the 15N(n ,γ )16N radiative capture cross section and its subsequent reaction rate by an indirect method and in that process investigate the effects of spectroscopic factors of different levels of 16N to the cross section. Method: A fully quantum mechanical Coulomb breakup theory under the aegis of post-form distorted wave Born approximation is used to calculate the Coulomb breakup of 16N on Pb at 100 MeV/u . This is then related to the photodisintegration cross section of 16N(γ ,n )15N and subsequently invoking the principle of detailed balance, the 15N(n ,γ )16N capture cross section is calculated. Results: The nonresonant capture cross section is calculated with spectroscopic factors from the shell model and those extracted (including uncertainties) from two recent experiments. The data seem to favor a more single particle nature for the low-lying states of 16N. The total neutron capture rate is also calculated by summing up nonresonant and resonant (significant only at temperatures greater than 1 GK) contributions and comparison is made with other charged particle capture rates. In the typical temperature range of 0.1 -1.2 GK, almost all the contributions to the reaction rate come from capture cross sections below 0.25 MeV. Conclusion: We have attempted to resolve the discrepancy in the spectroscopic factors of low-lying 16N levels and conclude that it would certainly be useful to perform a Coulomb dissociation experiment to find the low energy capture

  17. AI Magazine Poster: The AI Landscape

    Leake, David B.; Indiana University; Gary, James; Giacomo Marchesi Design


    AI's first half-century produced great accomplishments, but many of the field's successes have remained unsung beyond the AI community. AI's integration into the fabric of everyday life has had tremendous impact, but the public may not recognize its many roles or understand its fundamental goals. In response, AI Magazine has developed a poster to help educate students, faculty, and the public about AI and to spur them to find out more about the field.

  18. Difference of Electron Capture and Transfer Dissociation Mass Spectrometry on Ni2+-, Cu2+-, and Zn2+-Polyhistidine Complexes in the Absence of Remote Protons

    Asakawa, Daiki; De Pauw, Edwin


    Electron capture dissociation (ECD) and electron transfer dissociation (ETD) in metal-peptide complexes are dependent on the metal cation in the complex. The divalent transition metals Ni2+, Cu2+, and Zn2+ were used as charge carriers to produce metal-polyhistidine complexes in the absence of remote protons, since these metal cations strongly bind to neutral histidine residues in peptides. In the case of the ECD and ETD of Cu2+-polyhistidine complexes, the metal cation in the complex was reduced and the recombination energy was redistributed throughout the peptide to lead a zwitterionic peptide form having a protonated histidine residue and a deprotonated amide nitrogen. The zwitterion then underwent peptide bond cleavage, producing a and b fragment ions. In contrast, ECD and ETD induced different fragmentation processes in Zn2+-polyhistidine complexes. Although the N-Cα bond in the Zn2+-polyhistidine complex was cleaved by ETD, ECD of Zn2+-polyhistidine induced peptide bond cleavage accompanied with hydrogen atom release. The different fragmentation modes by ECD and ETD originated from the different electronic states of the charge-reduced complexes resulting from these processes. The details of the fragmentation processes were investigated by density functional theory.

  19. Evaluation of the internal temperatures of an 8.6 kDa protein cation exposed to a hot dispenser cathode employed in electron capture dissociation mass spectrometry.

    Yim, Yong-Hyeon; Kim, Byungjoo; Ahn, Seonghee; So, Hun-Young; Lee, Sunyoung; Oh, Han Bin


    The 'effective' internal temperature of an 8.6 kDa ubiquitin cation was estimated under electron capture dissociation (ECD) conditions, in which a dispenser cathode electron source was mounted just outside an ion cyclotron resonance (ICR) cell, i.e., axially displaced at a distance less than 1 cm from the rear trap plate of the ICR cell. In this ECD configuration, thermal activation of the molecular ions stored in the ICR cell was anticipated since the heated dispenser cathode (T(cathode surface) > 1000 degrees C) emitted a large amount of (both visible and infrared) radiation as well as electrons. An evaluation of the internal temperature of ubiquitin 6+ and 7+ cations was made by comparing our ECD fragmentation patterns with those obtained by McLafferty et al. (J. Am. Chem. Soc. 2002; 124: 6407) as a function of the ion temperature. In McLafferty's configuration, the heating (or thermal activation) effect of their filament source was minimal since the filament was displaced by a distance as far as 70 cm from their ICR cell. A careful comparison reveals that the fragmentation patterns obtained in this work are very similar to those previously measured at T approximately 125 degrees C. In terms of sequence coverage, our ECD configuration provides better results, and in particular without the aid of any other simultaneous activation method, such as thermal heating, infrared multiphoton irradiation, or collisional activation, except for the visible and infrared radiation from the heated cathode. PMID:16715464




    The AS-DB and AS-SU groups within the Administrative Support division now offer a central entry point to the computer based Information Services under their responsibilities: the AIS Web site at features comprehensive search and navigation facilities as well as an activity based business map to guide AIS users to the information they want. Users will be able to launch any AIS WEB application from its desktop.Enjoy a visit of the site, we value your feedback at!AS-DB/AS-SU

  1. Editorial: Ontogeny Recapitulates Ontegeny: AI and AI Magazine

    Rich, Elaine


    As the AI community has matured, the role of AI Magazine has continued to evolve. Rich outlines several ways that this community-wide publication can address the current needs of AI researchers, and encourages broad participation from community members.

  2. Welcome to AI Magazine

    Thompson, Alan M.


    As a major scientific society, the AAAI has a responsibility for promoting its field as well as informing its members of the latest technical developments. Since the latter function is adequately performed by the several journals and conference proceedings already mentioned, the editorial committee chose to assign to AI Magazine the task of providing AAAI members and the public as well with a broader perspective on the research activities within AI. The approach we intend to take includes pub...

  3. Formal Definition of AI

    Dobrev, Dimiter


    A definition of Artificial Intelligence was proposed in [1] but this definition was not absolutely formal at least because the word "Human" was used. In this paper we will formalize the definition from [1]. The biggest problem in this definition was that the level of intelligence of AI is compared to the intelligence of a human being. In order to change this we will introduce some parameters to which AI will depend. One of this parameters will be the level of intelligence and we will define o...

  4. MassAI


    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  5. AI and Mathematical Education

    Angel Garrido


    From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI). Great mathematical minds have played a key role in A...

  6. AI and Mathematical Education

    Angel Garrido


    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  7. User Interface Goals, AI Opportunities

    Lieberman, Henry; Massachusetts Institute of Technology Media Lab


    This is an opinion piece about the relationship between the fields of human-computer interaction (HCI), and artificial intelligence (AI). The ultimate goal of both fields is to make user interfaces more effective and easier to use for people. But historically, they have disagreed about whether "intelligence" or "direct manipulation" is the better route to achieving this. There is an unjustified perception in HCI that AI is unreliable. There is an unjustified perception in AI that interfaces a...

  8. Is Computer Vision Still AI?

    Fisher, Robert B.


    Recent general AI conferences show a decline in both the number and the quality of vision papers, but there is tremendous growth in, and specialization of, computer vision conferences. Hence, one might conclude that computer vision is parting or has parted company with AI. This article proposes that the divorce of computer vision and AI suggested here is actually an open marriage: Although computer vision is developing through its own research agenda, there are many shared areas of interest, ...

  9. AI 3D Cybug Gaming

    Ahmed, Zeeshan


    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  10. Code AI Personal Web Pages

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)


    The document consists of a publicly available web site ( for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  11. Typical and atypical AIS. Pathogenesis.

    Dudin, M; Pinchuk, D


    AIS hypothesis has the right to recognition, if it explains the transition of "healthy" vertebra column into status of "scoliotic" one. AIS is the most investigated disease in the history of orthopedics, but up the present time there is no clear explanation of some its phenomena: vertebra column mono-form deformation along with its poly etiology character, interrelation of its origin and development and child's growth process etc. The key for authors' view at AIS was scoliosis with non-standard (concave side) rotation. On the bases of its' multifunctional instrumental investigation results (Rtg, EMG, EEG, optical topography, hormonal and neuropeptides trials, thermo-vision methods and other) in comparison with typical AIS was worked out the new hypothesis, part of it is suggested for discussion. In the work under observation is the sequence of appearance of typical and atypical scoliosis symptomatology beginning from the preclinical stage. PMID:22744477

  12. AI And Early Vision - Part II

    Julesz, Bela


    A quarter of a century ago I introduced two paradigms into psychology which in the intervening years have had a direct impact on the psychobiology of early vision and an indirect one on artificial intelligence (AI or machine vision). The first, the computer-generated random-dot stereogram (RDS) paradigm (Julesz, 1960) at its very inception posed a strategic question both for AI and neurophysiology. The finding that stereoscopic depth perception (stereopsis) is possible without the many enigmatic cues of monocular form recognition - as assumed previously - demonstrated that stereopsis with its basic problem of finding matches between corresponding random aggregates of dots in the left and right visual fields became ripe for modeling. Indeed, the binocular matching problem of stereopsis opened up an entire field of study, eventually leading to the computational models of David Marr (1982) and his coworkers. The fusion of RDS had an even greater impact on neurophysiologists - including Hubel and Wiesel (1962) - who realized that stereopsis must occur at an early stage, and can be studied easier than form perception. This insight recently culminated in the studies by Gian Poggio (1984) who found binocular-disparity - tuned neurons in the input stage to the visual cortex (layer IVB in V1) in the monkey that were selectively triggered by dynamic RDS. Thus the first paradigm led to a strategic insight: that with stereoscopic vision there is no camouflage, and as such was advantageous for our primate ancestors to evolve the cortical machinery of stereoscopic vision to capture camouflaged prey (insects) at a standstill. Amazingly, although stereopsis evolved relatively late in primates, it captured the very input stages of the visual cortex. (For a detailed review, see Julesz, 1986a)

  13. Neutron Capture and Neutron Halos

    A.Mengoni; Otsuka, T; Nakamura, T.(International Center for Elementary Particle Physics and Department of Physics, The University of Tokyo, Tokyo, Japan); Ishihara, M.


    The connection between the neutron halo observed in light neutron rich nuclei and the neutron radiative capture process is outlined. We show how nuclear structure information such as spectroscopic factors and external components of the radial wave function of loosely bound states can be derived from the neutron capture cross section. The link between the direct radiative capture and the Coulomb dissociation process is elucidated.

  14. Dissociation dynamics of methylal

    Beaud, P.; Frey, H.-M.; Gerber, T.; Mischler, B.; Radi, P.P.; Tzannis, A.-P. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    The dissociation of methylal is investigated using mass spectrometry, combined with a pyrolytic radical source and femtosecond pump probe experiments. Based on preliminary results two reaction paths of methylal dissociation are proposed and discussed. (author) 4 fig., 3 refs.

  15. Capturing Thoughts, Capturing Minds?

    Nielsen, Janni


    Think Aloud is cost effective, promises access to the user's mind and is the applied usability technique. But 'keep talking' is difficult, besides, the multimodal interface is visual not verbal. Eye-tracking seems to get around the verbalisation problem. It captures the visual focus of attention....... However, it is expensive, obtrusive and produces huge amount of data. Besides, eye-tracking do not give access to user's mind. Capturing interface/cursor tracking may be cost effective. It is easy to install, data collection is automatic and unobtrusive and replaying the captured recording to the user and...


    Fauziah Elytha


    Fluburung atau Avian Influenza (AI) adalah penyakit zoonosis fatal dan menular serta dapat menginfeksi semua jenis burung, manusia, babi, kuda dan anjing, Virus Avian Influenza tipe A (hewan) dari keluarga Drthomyxoviridae telah menyerang manusia dan menyebabkan banyak korban meninggal dunia. Saat ini avian Influenza telah menjadi masalah kesehatan global yang sangat serius, termasuk di Indonesia. Sejak Juli 2005 Sampai 12 April 2006 telah ditemukan 479 kasus kumulatif dan dicurigai flu burun...

  17. Organisational Intelligence and Distributed AI

    Kirn, Stefan


    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  18. An SDR based AIS receiver for satellites

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard


    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One of...... the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility......, new detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  19. Catalytic methanol dissociation

    Results of the methanol dissociation study on copper/potassium catalyst with alumina support at various temperatures are presented. The following gaseous and liquid products at. The catalytic methanol dissociation is obtained: hydrogen, carbon monoxide, carbon dioxide, methane, and dimethyl ether. Formation rates of these products are discussed. Activation energies of corresponding reactions are calculated

  20. Tools and techniques for AIS Strategic Planning

    Monod, Emmanuel; Watson, Richard


    AIS went through and will continue to undergo evolution and revolution as it grows. This article analyzes the current state of AIS and concludes it is in or approaching a crisis of priorities. Planning is the recommended path for solving this crisis. Four planning methods are proposed: stakeholder analysis, service matrix analysis, missions matrix analysis, and a four-year budget cycle. Keywords: AIS, planning, planning methods, priority setting, stakeholder analysis, service matrix analysis,...

  1. Correlations in hadron diffraction dissociation

    Hadron diffractive dissociation reactions are studied based on three component Deck model. The correlations between the mass in dissociated particle subsystem and the dissociation angle/or partial waves) defined in gottfried-Jackson system, are interpreted. Several reactions with different spin and parity structures in dissociative verticles, are studied. The three component Deck model is extended to dissociation of light nuclei, in particular the deuteron dissociation. (M.C.K.)

  2. Beyond AI: Artificial Dreams Conference

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide


    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  3. JGOMAS: New Approach to AI Teaching

    Barella, A.; Valero, S.; Carrascosa, C.


    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  4. The Relevance of AI Research to CAI.

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  5. Coulomb dissociation studies for astrophysical thermonuclear reactions

    Motobayashi, T. [Dept. of Physics, Rikkyo Univ., Toshima, Tokyo (Japan)


    The Coulomb dissociation method was applied to several radiative capture processes of astrophysical interest. The method has an advantage of high experimental efficiency, which allow measurements with radioactive nuclear beams. The reactions {sup 13}N(p,{gamma}){sup 14}O and {sup 7}Be(p,{gamma}){sup 8}B are mainly discussed. They are the key reaction in the hot CNO cycle in massive stars and the one closely related to the solar neutrino problem, respectively. (orig.)

  6. Artificial intelligence. Fears of an AI pioneer.

    Russell, Stuart; Bohannon, John


    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity. PMID:26185241

  7. Satellittbasert system for AIS-meldinger

    Aas, Olav Ådne


    Innen 1.juli 2008 skal alle skip over 300 tonn i internasjonal trafikk og 500 tonn i nasjonal trafikk ha installert Automatic Identification System (AIS). AIS fungerer både som et antikollisjons og overvåkningssystem. I dag (2006) blir kun havområdet ut til 30 40 nautiske mil fra land overvåket ved bruk av AIS. For å øke rekkevidden til dette systemet, ser Forsvarets Forskningsinstitutt (FFI) på en løsning der det blir innført to nye segmenter: En bakkestasjon og en lavbanesatellitt. Det ...

  8. Consumer perceptions and reactions concerning AI

    Figuié, Muriel; Food and Agriculture Organization of the United Nations


    This paper focuses on the results of different consumer surveys conducted between 2004 and 2006 with regard to consumers’ perceptions and reactions concerning AI in Vietnam, (mainly in Hanoi). The main results observed are as follows: A high proportion of consumers consider AI to be a food-related risk. However, over time,there has been a slight shift from a fear of consuming poultry to a fear of preparing it (slaughtering it). AI has had a profound effect on poultry consumption, even outside...

  9. AIS Ship Traffic: Hawaii: 2011-2012

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  10. National AIS at 1 Minute Intervals

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  11. Duality in diffraction dissociations

    Diffractive dissociations (aN→a*πN) are naturally explained and a model that accounts for the three-variable correlation (mass-transfer-Jackson angle correlation) is presented. This model takes into account the three possible exchanges: t (pion), u(a*) and s(a) channel exchanger. The physical consequences of the model are: a strong mass-slope correlation due to the zeros of the amplitude, a factorization of diffractive dissociations (factorization of the Pomeron), the possibility of extending this model to double diffractive dissociation and diffraction by nuclei. This model was applied to the NN→NπN reaction. Using the usual parameters of the Deck model, a comparison is made with experiments for all available distributions. the strong slope of the peak at 1400 MeV is naturally explained

  12. Learning game AI programming with Lua

    Young, David


    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  13. From Constructionist to Constructivist A.I.

    Thórisson, Kristinn R.


    The development of artificial intelligence systems has to date been largely one of manual labor. This Constructionist approach to A.I. has resulted in a diverse set of isolated solutions to relatively small problems. Small success stories of putting these pieces together in robotics, for example, has made people optimistic that continuing on this path would lead to artificial general intelligence. This is unlikely. “The A.I. problem” has been divided up without much guidance from science or t...

  14. Dissociative charge exchange of H2+

    This thesis is devoted to molecular dissociation, in particular the dissociation of the hydrogen molecule H2 arising from electron capture of its ion H2+ in a collision. Thereby the important practical question how a chemical bond can be broken is implicitly addressed. This thesis opens (chapter I) with an overview of the available experimental approaches in molecular physics. Further the simple Demkov model for NRCE is described. In chapter II a novel experimental technique for measurements on dissociative processes is introduced which combines a high efficiency with a high energy resolution. A detailed description of the techniques applied in the detector, which has a high spatial and timing resolution with 30 μm and 350 psec FWHM respectively for the detection of one particle, is given in chapter III. A semi-classical theory for NRCE in the medium energy range between a diatomic molecular ion and an atom is developed in chapter IV. The experiments on dissociative charge exchange of H2+ with Ar, Mg, Na and Cs targets at keV energies are described in Chapter V. The predissociation of the c3PIsub(u)-state of H2 populated after charge exchange of H2 with several targets at keV energies; is the subject of chapter VI. In chapter VII, orientational oscillations in the cross section for charge exchange of H2+ with alkali targets are discussed. The last chapter deals with predissociation of highly excited states in H2. (Auth.)

  15. Dissociative recombination of N2H+

    dos Santos, S. Fonseca; Ngassam, V.; Orel, A. E.; Larson, Å.


    The direct and indirect mechanisms of dissociative recombination of N2H+ are theoretically studied. At low energies, the electron capture is found to be driven by recombination into bound Rydberg states, while at collision energies above 0.1 eV, the direct capture and dissociation along electronic resonant states becomes important. Electron-scattering calculations using the complex Kohn variational method are performed to obtain the scattering matrix as well as energy positions and autoionization widths of resonant states. Potential-energy surfaces of electronic bound states of N2H and N2H+ are computed using structure calculations with the multireference configuration interaction method. The cross section for the indirect mechanism is calculated using a vibrational frame transformation of the elements of the scattering matrix at energies just above the ionization threshold. Here vibrational excitations of the ionic core from v =0 to v =1 and v =2 for all three normal modes are considered and autoionization is neglected. The cross section for the direct dissociation along electronic resonant states is computed with wave-packet calculations using the multiconfiguration time-dependent Hartree method, where all three internal degrees of freedom are considered. The calculated cross sections are compared to measurements.

  16. Dissociative Reactions to Incest.

    Hall, J. Mark

    In contrast to Freud's later and revised view of the etiology of hysterical, or dissociative, symptoms, it is now known that real, and not fantasized, sexual experiences in childhood are experienced in disociative symptomatology. It is useful to understand that incest involves both traumatic events, that is, incidents of sexual violation per se,…

  17. Dissociation by acceleration

    Peeters, K.; Zamaklar, M.


    We show that mesons, described using rotating relativistic strings in a holographic setup, undergo dissociation when their acceleration 'a' exceeds a value which scales with the angular momentum 'J' as a_max ~ \\sqrt{T_s/J}, where 'T_s' is the string tension.

  18. Dissociation by acceleration


    We show that mesons, described using rotating relativistic strings in a holographic setup, undergo dissociation when their acceleration 'a' exceeds a value which scales with the angular momentum 'J' as a_max ~ \\sqrt{T_s/J}, where 'T_s' is the string tension.

  19. Sexuality of dissocial persons

    Marta Janus


    Full Text Available Introduction. The development of personality disorders as well as sexual disorders is defined by the common time spectrum as well as deficits and changes in such areas as biological, environmental and mental area. Dissocial (antisocial personality disorder is characterised by a pervasive pattern of disregard for, or violation of, the rights of others. The indices of the discussed disorder can be found in specific patterns of social inadequacy occurring during childhood and puberty. At the same time, characteristic indices of social functioning at a young age often indicate subsequent dysfunctions in the area of sexuality. Aim. The aim of this paper is to explain sexual functioning of persons with dissocial personality disorder (including the relation with sexual dysfunctions, and to ascertain issues that need further empirical studies. Method. As a result of analysis of available literature (matched with EBSCO database search fulfilling criteria of sample size, accuracy of examination procedure, conclusions and discussion 5 articles fulfilling criteria cited above has been found. Conclusions: Based on literature overview, it appeared to be impossible to determine one coherent way of sexual functioning of dissocial persons, and to establish causal relationship of sexual dysfunctions and dissocial personality disorder. However, it is possible to indicate group of most characteristic dysfunctional sexual behaviours. Noteworthy, available publication analyse only selected aspects of sexual behaviours in small, homogenous groups. There is a lack of review studies as well as multi-faceted studies.

  20. Pathological Dissociation as Measured by the Child Dissociative Checklist

    Wherry, Jeffrey N.; Neil, Debra A.; Taylor, Tamara N.


    The component structure of the Child Dissociative Checklist was examined among abused children. A factor described as pathological dissociation emerged that was predicted by participants being male. There also were differences in pathological dissociation between groups of sexually abused and physically abused children. Replication of this factor…

  1. The role of apolipoprotein AI domains in lipid binding

    Davidson, W. Sean; Hazlett, Theodore; Mantulin, William W.; Jonas, Ana


    Apolipoprotein AI (apoAI) is the principal protein constituent of high density lipoproteins and it plays a key role in human cholesterol homeostasis; however, the structure of apoAI is not clearly understood. To test the hypothesis that apoAI is organized into domains, three deletion mutants of human apoAI expressed in Escherichia coli were studied in solution and in reconstituted high density lipoprotein particles. Each mutant lacked one of three specific regions ...

  2. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications


    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  3. Iron-boron pair dissociation in silicon under strong illumination

    Xiaodong Zhu


    Full Text Available The dissociation of iron-boron pairs (FeB in Czochralski silicon under strong illumination was investigated. It is found that the dissociation process shows a double exponential dependence on time. The first fast process is suggested to be caused by a positive Fe in FeB capturing two electrons and diffusion triggered by the electron-phonon interactions, while the second slow one would involve the capturing of one electron followed by temperature dependent dissociation with an activation energy of (0.21 ± 0.03 eV. The results are important for understanding and controlling the behavior of FeB in concentrator solar cells.

  4. Bond dissociation & electronegativity equalization

    Verstraelen, Toon; Ayers, Paul W.; Van Speybroeck, Veronique; Waroquier, Michel


    It is well known that the Electrongativity Equalization Mtehod (EEM) fails to describe the charge distribution upon bond dissocation. In this presentation, the bond dissocation is studied with the Atom-Condensed Kohn-Sham DFT approximated to second order (ACKS2). After reviewing the basic equations, a two-fragment system is studied in the dissociation limit. The limiting behavior of the Coulomb interaction (1/r) and the Kohn-Sham matrix elements (exponentially decaying) are plugged into the e...

  5. Sexuality of dissocial persons

    Marta Janus; Agata Szulc


    Introduction. The development of personality disorders as well as sexual disorders is defined by the common time spectrum as well as deficits and changes in such areas as biological, environmental and mental area. Dissocial (antisocial) personality disorder is characterised by a pervasive pattern of disregard for, or violation of, the rights of others. The indices of the discussed disorder can be found in specific patterns of social inadequacy occurring during childhood and puberty. At the sa...

  6. AIS 2005与AIS 1998在评价创伤救治结局中的应用比较%Comparative study between AIS 1998 and AIS 2005 for evaluation of injury severity and major trauma outcome

    赵兴吉; 都定元; 孔令文; 张为民; 谭远康; 苏泓洁; 马丁


    目的比较简明损伤定级(AIS)2005与AIS 1998在评价创伤严重度及创伤救治结局的差异,探讨最新版AIS 2005应用的可行性及实用价值.方法采用AIS 2005和AIS 1998,对我院2003年1月~2005年5月救治的3110例创伤病例资料进行回顾性分析.结果 (1)随ISS值递增,两组病死率、并发症发生率均呈上升趋势;ISS>20,AIS 2005组病死率上升趋势更为明显,在ISS>15~≤20,AIS 2005组病死率较AIS 1998组有显著降低(P=0.001).除AIS 2005组ISS≤15并发症发生率较AIS 1998组下降外(P=0.035),其余各ISS分值段AIS 2005组并发症发生率较AIS 1998组上升趋势更为明显.(2)随ISS值升高,修正创伤评分(RTS)、创伤与损伤严重度评分(TRISS)、创伤严重度特征评分(ASCOT)、ASCOT-CHINA值逐渐降低,且AIS 2005生存概率预测值分布较AIS 1998大.AIS 2005预测性评分指标的区别度和敏感性均高于AIS 1998,除ASCOT-CHINA准确性、ASCOT特异性低于AIS 1998,ASCOT存活误判率高于AIS 1998外,ASCOT、TRISS准确性,ASCOT-CHINA、TRISS特异性均高于AIS 1998,ASCOT-CHINA、TRISS存活误判率较AIS 1998低,AIS 2005对生存组、死亡组生存概率预测优于AIS 1998.结论以AIS 2005为基础的ISS、TRISS、ASCOT等方法评价创伤及其结局预测总体上优于AIS 1998;建议使用AIS 2005评价多发伤时,以ISS>20界定为严重多发伤可能更为合理.

  7. AI reference LMFBR steam-generator development

    The Design Data Sheets summarize the key parameters being used in the design and analysis of the AI Prototype LMFBR Steam Generator. These Data Sheets supplement SDD-097-330-002, Steam Generator System, 1450 psi Steam Conditions. This document will serve as the baseline design data control until a GE/RRD approved steam generator specification with ordering data is received

  8. SNAP and AI Fuel Summary Report

    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  9. SNAP and AI Fuel Summary Report

    Lords, R.E.


    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized.

  10. Coulomb dissociation in nonrelativistic and relativistic collisions

    Electromagnetic excitations in the Coulomb field of nuclei have been studied using quantum as well as semiclassical methods. Even at relatively modest incident energies, the Coulomb dissociation cross sections of projectiles with relatively low particle thresholds could be of sizeable order of magnitude. Such a study complements our knowledge about radiative capture processes, which are of interest for nuclear astrophysics. Quite a few questions remain to be answered, like the importance of nuclear interactions for small angle scattering, interference of different multipolarities for triple differentiial cross sections and distortion effects on the three-body final states. In the case of dissociation at relativistic energies it is shown that only for the total cross section both semiclassical and quantim-mechanical methods yield the same results. As an example the Primakoff effect is considered, where in an M1 excitation of ≅ 80 MeV a Λ hyperion is converted into a Σo hyperion by means of the virtual photon field of heavy target nuclei. Virtual photon spectra for all multipolarities can be calculated. This provides a sound basis for the analysis of electromagnetic dissociation experiments at relativistic heavy ion accelerators, like the BEVALAC. 10 figs., 25 refs

  11. Intracellular and extracellular processing of human apolipoprotein A-I: secreted apolipoprotein A-I isoprotein 2 is a propeptide.

    Zannis, V I; Karathanasis, S K; Keutmann, H. T.; Goldberger, G; Breslow, J L


    We have recently proposed that the major secreted isoprotein form of human apolipoprotein A-I (designated apo A-I2) is modified extracellularly to become the predominant apo A-I form seen in plasma (designated apo A-I4). In the current report we demonstrate that the primary translation product of human apo A-I (designated apo A-I2p) has a 24-amino-acid NH2-terminal extension with a sequence of Met-Lys-Ala-Ala-Val-Leu-Thr-Leu-Ala-Val-Leu-Phe- Leu-Thr-Gly-Ser-Gln-Ala-Arg-His-Phe-Trp-Gln-Gln. Th...

  12. Dicty_cDB: FC-AI05 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...// Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  13. Dicty_cDB: FC-AI23 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  14. Dicty_cDB: FC-AI10 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  15. Dicty_cDB: FC-AI11 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI11 (Link to dictyBase) - - - Contig-U15122-1 FC-AI11E (Li...nk to Original site) - - - - - - FC-AI11E 1040 Show FC-AI11 Library FC (Link to library) Clone ID FC-AI11 (L...// Representative seq. ID FC-AI...11E (Link to Original site) Representative DNA sequence >FC-AI11 (FC-AI11Q) /CSM/FC/FC-AI/FC-AI11Q.Seq...VLSPEIKKGSWDEAEEELLFQLVDKHGQSWKNVAIEIKTRTDIQCRYQYFKAI MSRQTEWNQLEDDILTKKIKLMTQNNEKISFQQVSKHLARAKTTKIPRTALECK

  16. Dicty_cDB: FC-AI04 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  17. Dicty_cDB: FC-AI21 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  18. Multiphoton dissociation of polyatomic molecules

    The dynamics of infrared multiphoton excitation and dissociation of SF6 was investigated under collision free conditions by a crossed laser-molecular beam method. In order to understand the excitation mechanism and to elucidate the requirements of laser intensity and energy fluence, a series of experiments were carried out to measure the dissociation yield dependences on energy fluence, vibrational temperature of SF6, the pulse duration of the CO2 laser and the frequency in both one and two laser experiments. Translational energy distributions of the SF5 dissociation product measured by time of flight and angular distributions and the dissociation lifetime of excited SF6 as inferred from the observation of secondary dissociation of SF5 into SF4 and F during the laser pulse suggest that the dynamics of dissociation of excited molecules is dominated by complete energy randomization and rapid intramolecular energy transfer on a nanosecond timescale, and can be adequately described by RRKM theory. An improved phenomenological model including the initial intensity dependent excitation, a rate equation describing the absorption and stimulated emission of single photons, and the unimolecular dissociation of excited molecules is constructed based on available experimental results. The model shows that the energy fluence of the laser determines the excitation of molecules in the quasi-continuum and the excess energy with which molecules dissociate after the laser pulse. The role played by the laser intensity in multiphoton dissociation is more significant than just that of overcoming the intensity dependent absorption in the lowest levels. 63 references

  19. Dissociation Energies of Diatomic Molecules

    FAN Qun-Chao; SUN Wei-Guo


    Molecular dissociation energies of 10 electronic states of alkali molecules of KH, 7LID, 7LiH, 6LiH, NaK, NaLi and NaRb are studied using the highest three accurate vibrational energies of each electronic state, and an improved parameter-free analytical formula which is obtained starting from the LeRoy-Bernstein vibrational energy expression near the dissociation limit. The results show that as long as the highest three vibrational energies are accurate, the current analytical formula will give accurate theoretical dissociation energies Detheory, which are in excellent agreement with the experimental dissociation energies Dexpte.

  20. A direct, local model of dissociative recombination of HF+

    The direct mechanism of dissociative recombination of HF+ have been studied by propagating wave packets on 30 resonant states. The relevant electronic states have been calculated ab initio with electron scattering calculations and multireference configuration interaction calculations. We obtain a qualitative good agreement with experiments for energies in the range from 0.04 eV to 10 eV. Some of the structures in the experimental cross section can be explained by the direct capture and dissociation along the resonant states. To fully describe the measured cross section, the electronic couplings between the neutral states cannot be neglected.

  1. Laser capture.

    Potter, S Steven; Brunskill, Eric W


    This chapter describes detailed methods used for laser capture microdissection (LCM) of discrete subpopulations of cells. Topics covered include preparing tissue blocks, cryostat sectioning, processing slides, performing the LCM, and purification of RNA from LCM samples. Notes describe the fine points of each operation, which can often mean the difference between success and failure. PMID:22639264

  2. Why Don't Accounting Students like AIS?

    Vatanasakdakul, Savanid; Aoun, Chadi


    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  3. Radar Image Processing and AIS Target Fusion

    Heymann, F.; P. Banys; Saez, C.


    Collision avoidance is one of the high-level safety objectives and requires a complete and reliable description of maritime traffic situation. A combined use of data provided by independent data sources is an approach to improve the accuracy and integrity of traffic situation related information. In this paper we study the usage of radar images for automatic identification system (AIS) and radar fusion. Therefore we simulate synthetic radar images and evaluate the tracking performance of t...

  4. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Chaudhari, Narendra S.; Edmond C. Prakash; John, Tng C. H.


    This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002), in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination i...

  5. AI & Law, logic and argument schemes

    Prakken, Henry


    This paper reviews the history of AI & Law research from the perspective of argument schemes. It starts with the observation that logic, although very well applicable to legal reasoning when there is uncertainty, vagueness and disagreement, is too abstract to give a fully satisfactory classification of legal argument types. It therefore needs to be supplemented with an argument-scheme approach, which classifies arguments not according to their logical form but according to their content, in p...

  6. Monitoring severe accidents using AI techniques

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  7. Online Adaptation of Game AI with Evolutionary Learning


    Since the beginning of computer games era,artificial intelligence (AI) has been a standard feature of games. The current emphasis in computer game AI is improving the quality of opponent AI. Our research question reads: How can unsupervised online learning be incorporated in Computer Role Playing Game (CRPG) to improve the strategy of the opponent AI? Our goal is to use online evolutionary learning to design strategies that can defeat the opponent. So we apply a novel technique called dynamic scripting that realizes online adaptation of scripted opponent AI and report on experiments performed in a simulated CRPG to assess the adaptive performance obtained with the technique.

  8. Dicty_cDB: FC-AI13 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  9. Dicty_cDB: FC-AI01 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  10. Will AI in pigs become more efficient?

    Roca, J; Parrilla, I; Bolarin, A; Martinez, E A; Rodriguez-Martinez, H


    AI is commercially applied worldwide to breed pigs, yielding fertility outcomes similar to those of natural mating. However, it is not fully efficient, as only liquid-stored semen is used, with a single boar inseminating about 2000 sows yearly. The use of liquid semen, moreover, constrains international trade and slows genetic improvement. Research efforts, reviewed hereby, are underway to reverse this inefficient scenario. Special attention is paid to studies intended to decrease the number of sperm used per pregnant sow, facilitating the practical use of sexed frozen-thawed semen in swine commercial insemination programs. PMID:26723133

  11. Dissociative Tendencies and Traffic Incidents

    Valle, Virginia


    Full Text Available This paper analyses the relationship between dissociative experiences and road traffic incidents (crashes and traffic tickets in drivers (n=295 from Mar del Plata (Argentina city. A self-report questionnaire was applied to assess traffic crash involvement and sociodemographic variables. Dissociative tendencies were assessed by a modified version of the DES scale. To examine differences in DES scores tests of the difference of means were applied. Drivers who reported to be previously involved in traffic incidents obtained higher puntuations in the dissociative experiences scale than drivers who did not report such events. This result is observed for the total scale and for the three sub-scales (absorption, amnesia and depersonalization. However, differences appeared mainly for minor damage collisions. Further studies are needed to evaluate the role of dissociative tendencies as a risk factor in road traffic safety.

  12. Neural complexity, dissociation, and schizophrenia

    Bob, P.; Šusta, M.; Chládek, Jan; Glaslová, K.; Fedor-Ferybergh, P.


    Roč. 13, č. 10 (2007), HY1-5. ISSN 1234-1010 Institutional research plan: CEZ:AV0Z20650511 Keywords : neural complexity * dissociation * schizophrenia Subject RIV: FH - Neurology Impact factor: 1.607, year: 2007

  13. Dissociation pressure of polonium dioxide

    Information on determining the temperature dependence of the vapour pressure during polonium-210 dissociation is given. To determine the vapour pressure of polonium during PoO2 dissociation, the method based on remote measuring the amount of the vapour of the radioactive element by its own radiation in a known volume with dynamic equilibrium inside an ampoule evacuated to 10-2 Torr has been used. The vapour pressure of P0 in vacuum within the temperature range from 530 to 595 deg C obeys the equation lg Psub(mm)=19.4440+-0.7140-(16920+-50O)/T. The polonium evaporation heat during PoO2 dissociation is 77.4+-2.3 kcal/mol. Enthalpy of PoO2 dissociation is 154.8 kcal/mol

  14. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  15. Monitoring Severe Accidents Using AI Techniques

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  16. Dissecting phenotypic variation among AIS patients

    We have created genital skin fibroblast cell lines directly from three patients in a Chinese family affected by androgen insensitivity syndrome (AIS). All patients in the family share an identical AR Arg840Cys mutant but show different disease phenotypes. By using the cell lines, we find that the mutation has not influenced a normal androgen-binding capacity at 37 deg C but has reduced the affinity for androgens and may cause thermolability of the androgen-receptor complex. The impaired nuclear trafficking of the androgen receptor in the cell lines is highly correlated with the severity of donors' disease phenotype. The transactivity of the mutant is substantially weakened and the extent of the reduced transactivity reflects severity of the donors' disease symptom. Our data reveal that although etiology of AIS is monogenic and the mutant may alter the major biological functions of its wild allele, the function of the mutant AR can also be influenced by the different genetic backgrounds and thus explains the divergent disease phenotypes

  17. Radar Image Processing and AIS Target Fusion

    F. Heymann


    Full Text Available Collision avoidance is one of the high-level safety objectives and requires a complete and reliable description of maritime traffic situation. A combined use of data provided by independent data sources is an approach to improve the accuracy and integrity of traffic situation related information. In this paper we study the usage of radar images for automatic identification system (AIS and radar fusion. Therefore we simulate synthetic radar images and evaluate the tracking performance of the particle filter algorithm as the most promising filter approach. During the filter process the algorithm estimates the target position and velocity which we finally compare with the known position of the simulation. This approach allows the performance analysis of the particle filter for vessel tracking on radar images. In a second extended simulation we add the respective AIS information of the target vessel and study the gained level of improvement for the particle filter approach. The work of this paper is integrated in the research and development activities of DLR Institute of Communications and Navigation dealing with the introduction of data and system integrity into the maritime traffic system. One of the aimed objectives is the automatic assessment of the traffic situation aboard a vessel including integrity information.

  18. AIS spectra of desert shrub canopies

    Murray, R.; Isaacson, D. L.; Schrumpf, B. J.; Ripple, W. J.; Lewis, A. J.


    Airborne Imaging Spectrometer (AIS) data were collected 30 August 1985 from a desert shrub community in central Oregon. Spectra from artificial targets placed on the test site and from bare soil, big sagebrush (Artemesia tridentata wyomingensis), silver sagebrush (Artemesia cana bolander), and exposed volcanic rocks were studied. Spectral data from grating position 3 (tree mode) were selected from 25 ground positions for analysis by Principal Factor Analysis (PFA). In this grating position, as many as six factors were identified as significant in contributing to spectral structure. Channels 74 through 84 (tree mode) best characterized between-class differences. Other channels were identified as nondiscriminating and as associated with such errors as excessive atmospheric absorption and grating positin changes. The test site was relatively simple with the two species (A. tridentata and A. cana) representing nearly 95% of biomass and with only two mineral backgrounds, a montmorillonitic soil and volcanic rocks. If, as in this study, six factors of spectral structure can be extracted from a single grating position from data acquired over a simple vegetation community, then AIS data must be considered rich in information-gathering potential.

  19. Analysis of received AIS data from a LEO Cubesat

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Tausen, Mathias;


    using their AIS broadcast signals as an indication of position by means of a simple dipole antenna. The SDR based receiver used on board the satellite is using a single chip front-end solution, which downconverts the AIS signal located around 162 MHz to an intermediate frequency at 200 kHz. This I....../Q signal is sampled with a 750 kSPS A/D converter and further processed by an Analog De- vices DSP. The algorithm first analyses the stream to identify possible AIS transmissions on the two different AIS channels. If likely transmissions are identified, the center frequency of the transmission is estimated...... mission of the satellite was to perform a feasibility study about the possibility of detecting AIS signals from a 1U cubesat in LEO. However, soon after launch it was found, that the AIS receiver performed very well and an improved algorithm which samples and decodes real-time was developed and uploaded...

  20. Risk Reducing Effect of AIS Implementation on Collision Risk

    Lützen, Marie; Friis-Hansen, Peter


    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and, as...... a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  1. AIC - An AI-system for Combination of senses

    Håkansson, Anne


    AI-complete systems developed today, are commonly used for solving different artificial intelligence problems.A problem is a typical image recognition or speech recognition, but it can also be language processing, as wellas, other complex systems dealing with general problem solving. However, no AI-complete system, whichmodels the human brain or behavior, can exist without looking at the totality of the whole situation and, andhence, incorporating an AI-computerized sensory systems into a tot...

  2. An AI-Based Approach to Destination Control in Elevators

    Koehler, Jana; Ottiger, Daniel


    Not widely known by the AI community, elevator control has become a major field of application for AI technologies. Techniques such as neural networks, genetic algorithms, fuzzy rules and, recently, multiagent systems and AI planning have been adopted by leading elevator companies not only to improve the transportation capacity of conventional elevator systems but also to revolutionize the way in which elevators interact with and serve passengers. In this article, we begin with an overview of...

  3. Humans and Machines in the Evolution of AI in Korea

    Zhang, Byoung-Tak; Seoul National University


    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  4. Dicty_cDB: FC-AI03 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  5. Dicty_cDB: FC-AI02 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI02 (Link to dictyBase) - - - Contig-U16513-1 FC-AI02E (Li...nk to Original site) - - - - - - FC-AI02E 535 Show FC-AI02 Library FC (Link to library) Clone ID FC-AI02 (Li.../ Representative seq. ID FC-AI...02E (Link to Original site) Representative DNA sequence >FC-AI02 (FC-AI02Q) /CSM/FC/FC-AI/FC-AI02Q.Seq....ogy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FC-AI02 (FC-AI

  6. Dicty_cDB: FC-AI17 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  7. Dicty_cDB: FC-AI18 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  8. Feasibility of large-scale phosphoproteomics with higher energy collisional dissociation fragmentation

    Nagaraj, Nagarjuna; D'Souza, Rochelle C J; Cox, Juergen;


    Mass spectrometry (MS)-based proteomics now enables the analysis of thousands of phosphorylation sites in single projects. Among a wide range of analytical approaches, the combination of high resolution MS scans in an Orbitrap analyzer with low resolution MS/MS scans in a linear ion trap has prov...... large-scale phosphoproteome analysis alongside collisional induced dissociation, (CID) and electron capture/transfer dissociation (ECD/ETD)....

  9. Trauma, Posttraumatic Stress and Dissociation Among Swedish Adolescents : Evaluation of Questionnaires

    Nilsson, Doris


    The main aim of this thesis has been to investigate trauma and dissociation among Swedish adolescents and to evaluate the psychometric properties such as reliability and various kinds of validity of three screening instruments for assessment of dissociation and other symptoms of post traumatic stress. The three instruments in question have been Dis-Q-Sweden, A-DES and TSCC, the symptoms measured by these instruments are neither easy to capture nor easy for the adolescent to talk about. Theref...

  10. Shattering dissociation in high-energy molecular collisions between nitrate esters

    Schweigert, Igor V.; Dunlap, Brett I.


    We present ab initio molecular dynamics simulations of head-on collisions between ethyl nitrate molecules at collisional energies from 200 to 1200 kJ/mol. Above a threshold energy, an increasing fraction of the collisions led to rapid dissociation on impact—"shattering." The probability of the shattering dissociation was derived from the quasiclassical trajectories sampling the initial vibrational motion at Tvib = 300 K. Even for the zero impact parameter and a fixed orientation considered, the observed dissociation probability exhibited a wide spread (much larger than kTvib) as a function of the collision energy. This is attributed to variations in the initial vibrational phase. We propose a closed-form expression for the energy-dependent dissociation probability that captures the dependence on the phase and use it to analyze the probability of the shattering dissociation of a larger nitrate ester, pentaerythritol tetranitrate.

  11. Dissociative experiences and dissociative minds: Exploring a nomological network of dissociative functioning.

    Schimmenti, Adriano


    In this study, the psychometric properties of the Dissociative Experiences Scale-II (DES-II) were tested in a sample of Italian adults, and a nomological network of dissociative functioning based on current psychodynamic research was examined. A total of 794 participants (55% females) ranging in age from 18 to 64 completed the DES-II and other measures of theory of mind, alexithymia, attachment style, and empathy. The Italian translation of the DES-II showed high internal consistency, adequate item-to-scale homogeneity, and good split-half reliability. A single-factor solution including the 8 items of pathological dissociation (DES-T) adequately fit the data. Participants who reported higher levels of dissociative experiences showed significantly lower scores on theory of mind and empathy than other participants. They also showed significantly higher scores on alexithymia, preoccupied attachment, and fearful attachment. Results of the study support the view that people who suffer from severe dissociative experiences may also have difficulties mentalizing and regulating affects and that they may feel uncomfortable in close relationships because they have a negative view of the self. This can inform clinical work with dissociative individuals, who could benefit from therapies that consider their potential problems with mentalization, empathy, affect regulation, and attachment. PMID:26507547

  12. The Ai project: historical and ecological contexts.

    Matsuzawa, Tetsuro


    This paper aims to review a long-term research project exploring the chimpanzee mind within historical and ecological contexts. The Ai project began in 1978 and was directly inspired by preceding ape-language studies conducted in Western countries. However, in contrast with the latter, it has focused on the perceptual and cognitive capabilities of chimpanzees rather than communicative skills between humans and chimpanzees. In the original setting, a single chimpanzee faced a computer-controlled apparatus and performed various kinds of matching-to-sample discrimination tasks. Questions regarding the chimpanzee mind can be traced back to Wolfgang Koehler's work in the early part of the 20th century. Yet, Japan has its unique natural and cultural background: it is home to an indigenous primate species, the Japanese snow monkey. This fact has contributed to the emergence of two previous projects in the wild led by the late Kinji Imanishi and his students. First, the Koshima monkey project began in 1948 and became famous for its discovery of the cultural propagation of sweet-potato washing behavior. Second, pioneering work in Africa, starting in 1958, aimed to study great apes in their natural habitat. Thanks to the influence of these intellectual ancestors, the present author also undertook the field study of chimpanzees in the wild, focusing on tool manufacture and use. This work has demonstrated the importance of social and ecological perspectives even for the study of the mind. Combining experimental approaches with a field setting, the Ai project continues to explore cognition and behavior in chimpanzees, while its focus has shifted from the study of a single subject toward that of the community as a whole. PMID:14566577

  13. FACE: the barefaced facts of AI potency

    The use of third-generation aromatase inhibitors (AIs), such as anastrozole and letrozole, as initial adjuvant hormonal therapy in postmenopausal women (PMW) with hormone receptor-positive (HR+) breast cancer offers a significant benefit over tamoxifen for reducing recurrence risk. Clinical studies, including the Arimidex Tamoxifen Alone or in Combination (ATAC) and the Breast International Group (BIG) 1–98 trials, have proven that both anastrozole and letrozole are, respectively, superior to tamoxifen in improving disease-free survival. Although differing in design, objectives, and follow-up time, these trials offer some insight into the comparative clinical efficacy of these two nonsteroidal AIs. In particular, results from BIG 1–98 show that letrozole significantly reduces early distant metastatic (DM) events, which constitute the majority of early recurrence events. Subsequently, there is a beneficial overall survival effect emerging in the trial, whereas survival is unchanged with anastrozole after 100 months of follow-up in ATAC. Significant differences in the potency of these two drugs, vis-à-vis their degree of aromatase inhibition, have been observed in comparative trials and show that letrozole causes a more complete suppression of estrogen levels than does anastrozole. Whether this difference in potency is relevant to reductions in DM events during adjuvant therapy remains unclear. The Femara Anastrozole Clinical Evaluation trial is addressing this issue in a more unequivocal manner by comparing initial adjuvant treatment with anastrozole or letrozole in a population of breast cancer patients at high risk of recurrence: PMW with HR+ disease and axillary lymph node involvement

  14. Grammaire progressive du français avec 400 exercices : niveau avancé

    Boularès, Michèle


    La Grammaire progressive du français, de niveau avancé, s'adresse à de grands adolescents et adultes ayant suivi environ 250 heures de cours.Par une méthode progressive, des exemples nombreux et pertinents pour renforcer les règles de grammaire, une langue authentique, cet ouvrage a pour objectif de rendre vivant et stimulant l'apprentissage de la grammaire.Elle présente et explique des points complexes (subjonctif, gérondif, adjectif verbal, participe présent...) et relie résolument la forme et le sens afin de ne pas dissocier grammaire et communication. La Grammaire progressive du français est une grammaire pédagogique: les explications grammaticales sont simples, le plus souvent de l'ordre de la phrase, elles utilisent un minimum de métalangage; des exemples clairs et nombreux illustrent chque explication grammaticale; la langue utilisée dans les exemples et les exercices est authentique. Quand l'exemple illustrant un point grammatical exige un niveau de langage soutenue, celui-ci est signalé...

  15. AI-2-dependent gene regulation in Staphylococcus epidermidis

    Sturdevant Daniel E


    Full Text Available Abstract Background Autoinducer 2 (AI-2, a widespread by-product of the LuxS-catalyzed S-ribosylhomocysteine cleavage reaction in the activated methyl cycle, has been suggested to serve as an intra- and interspecies signaling molecule, but in many bacteria AI-2 control of gene expression is not completely understood. Particularly, we have a lack of knowledge about AI-2 signaling in the important human pathogens Staphylococcus aureus and S. epidermidis. Results To determine the role of LuxS and AI-2 in S. epidermidis, we analyzed genome-wide changes in gene expression in an S. epidermidis luxS mutant and after addition of AI-2 synthesized by over-expressed S. epidermidis Pfs and LuxS enzymes. Genes under AI-2 control included mostly genes involved in sugar, nucleotide, amino acid, and nitrogen metabolism, but also virulence-associated genes coding for lipase and bacterial apoptosis proteins. In addition, we demonstrate by liquid chromatography/mass-spectrometry of culture filtrates that the pro-inflammatory phenol-soluble modulin (PSM peptides, key virulence factors of S. epidermidis, are under luxS/AI-2 control. Conclusion Our results provide a detailed molecular basis for the role of LuxS in S. epidermidis virulence and suggest a signaling function for AI-2 in this bacterium.

  16. Integrating the Wall Street Journal into AIS Courses

    Kohlmeyer, James M., III


    While it is important for accounting information systems (AIS) students to understand computer technology, internal controls and business processes, such knowledge is of little use without reference to appropriate contexts. Integrating Wall Street Journal (WSJ) readings and discussions into AIS classes can enrich learning by stimulating…

  17. Ai Weiwei - 21. sajandi märter? / Tanel Veenre

    Veenre, Tanel, 1977-


    Hiina kunstniku, inimõiguslase ja teisitimõtleja Ai Weiwei elust, õpingutest, loomingust ja tegevusest. Hiinas kunstniku tagakiusamisest, arreteerimisest, maksupettuses süüdistamisest jm. Kunstniku toetajatest. Inglise kunstileht Art Review valis Ai Weiwei 2011. a. kõige mõjuvõimsamaks kunstitegelaseks

  18. Pedagogy and the PC: Trends in the AIS Curriculum

    Badua, Frank


    The author investigated the array of course topics in accounting information systems (AIS), as course syllabi embody. The author (a) used exploratory data analysis to determine the topics that AIS courses most frequently offered and (b) used descriptive statistics and econometric analysis to trace the diversity of course topics through time,…

  19. The BSM-AI project: SUSY-AI - Generalizing LHC limits on Supersymmetry with Machine Learning

    Caron, Sascha; Rolbiecki, Krzysztof; de Austri, Roberto Ruiz; Stienen, Bob


    A key research question at the Large Hadron Collider (LHC) is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: It requires the time consuming generation of scattering events, the simulation of the detector response, the event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiment. In the BSM-AI project we attack this challenge with a new approach. Machine learning tools are thought to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300,000 pMSSM model sets - each tested with 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93 percent. It ...

  20. Dissociative symptoms and dissociative disorders comorbidity in obsessive compulsive disorder: Symptom screening, diagnostic tools and reflections on treatment

    Belli, Hasan


    Borderline personality disorder, conversion disorder and obsessive compulsive disorder frequently have dissociative symptoms. The literature has demonstrated that the level of dissociation might be correlated with the severity of obsessive compulsive disorder (OCD) and that those not responding to treatment had high dissociative symptoms. The structured clinical interview for DSM-IV dissociative disorders, dissociation questionnaire, somatoform dissociation questionnaire and dissociative expe...

  1. Dicty_cDB: FC-AI12 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  2. Dicty_cDB: FC-AI24 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  3. Dicty_cDB: FC-AI06 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...// Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  4. Dicty_cDB: FC-AI22 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  5. Dicty_cDB: FC-AI09 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  6. Dicty_cDB: FC-AI19 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  7. Dicty_cDB: FC-AI08 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  8. Dicty_cDB: FC-AI07 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  9. Dicty_cDB: FC-AI15 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  10. Dicty_cDB: FC-AI14 [Dicty_cDB

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  11. Molecular Dissociation Induced by Electron Collisions

    Wolf, Andreas


    Free electrons can efficiently break molecules or molecular ions in low-energy collisions by the processes of dissociative recombination or attachment. These processes make slow electrons efficient chemical agents in many environments. For dissociative recombination, in particular, studies of the underlying reaction paths and mechanisms have become possible on a uniquely elementary level in recent years both for theory and experiment. On the experimental side, collisions can be prepared at resolved collision energies down to the meV (10 Kelvin) level, increasingly gaining control also over the initial molecular quantum level, and individual events are detected and kinematically analyzed by fast-beam coincidence fragment imaging. Experiments are reported from the ion cooler ring TSR in Heidelberg. Stored beams of molecular ions cooled in their external and internal degrees of freedom are collinearly merged with intense and cold electron beams from cryogenic GaAs photocathodes, recently shown to yield fast cooling of the center-of-mass motion also for heavy and correspondingly slow molecular ion beams. To reconstruct the molecular fragmentation events multiparticle imaging can now be used systematically with collision energies set a wide range, especially aiming at specific electron capture resonances. Thus, for CF^+ it is found that the electronic state of the C fragment (^3P or ^1D) switches resonantly when the collision energy is changed by only a small fraction. As a new powerful tool, an energy-sensitive multi-strip surface-barrier detector (EMU) has been set up to measure with near-unity efficiency the masses of all fragments together with their hit positions in high-multiplicity events. Among many uses, this device allows internal molecular excitations to be derived for individual chemical channels in polyatomic fragmentation. New results will be presented in particular on the breakup of the hydronium ion (D3O^+).

  12. Hydrogen dissociation on metal surfaces

    Wijzenbroek, M.


    Dissociative chemisorption is an important reaction step in many catalytic reactions. An example of such a reaction is the Haber-Bosch process, which is used commercially to produce ammonia, an important starting material in the production of fertilisers. In theoretical descriptions of such chemical

  13. [Gender differences in dissociative disorders].

    Spitzer, C; Freyberger, H J


    The relationship between mental illness, on the one hand, and sex and gender, on the other hand, has received interest since the beginning of medicine in antique times. A prototypical example of a seemingly woman-specific disease is hysteria. The term itself, which is derived from the Greek word for womb, denotes a psychosexual dimension comprising the current attitude towards sexuality and the dominating gender relationship. In addition, the colourful history of hysteria indicates that illness is not exclusively determined by biological factors, but also significantly by socio-cultural influences, for example in the treatment of hysterical women. Even nowadays, there is a wide-spread belief that dissociative symptoms and disorders, which have succeeded hysteria in current classification systems, are predominantly seen in women. However, empirical studies in the general population and in different clinical samples using sound instruments have indicated that dissociative symptoms do not differ between the genders. The seemingly dominance of dissociative disorders in women may also depend on the socio-cultural context, because men with dissociative disorders usually do not enter the general health system, but rather the legal system, i.e. they can be found in jail or forensic institutions. PMID:18185968

  14. Chemotaxis to the Quorum-Sensing Signal AI-2 Requires the Tsr Chemoreceptor and the Periplasmic LsrB AI-2-Binding Protein▿

    Hegde, Manjunath; Englert, Derek L.; Schrock, Shanna; Cohn, William B.; Vogt, Christian; Wood, Thomas K.; Manson, Michael D.; Jayaraman, Arul


    AI-2 is an autoinducer made by many bacteria. LsrB binds AI-2 in the periplasm, and Tsr is the l-serine chemoreceptor. We show that AI-2 strongly attracts Escherichia coli. Both LsrB and Tsr are necessary for sensing AI-2, but AI-2 uptake is not, suggesting that LsrB and Tsr interact directly in the periplasm.

  15. Compact AIS substations with high availability

    Solver, C.E.; Haglund, L.; Wahl, P. [ABB, Vasteras (Sweden)


    The changing electricity market offers new opportunities to change traditional practices in the design of substations. This paper described 2 new types of switching devices for air insulated (AIS) outdoor high voltage substations. Both the withdrawable circuit-breaker (WCB) and the disconnecting circuit-breaker (DCB) eliminate the need for conventional disconnectors. When conventional disconnectors are removed, the main circuits of the substation are simplified and the electrical power losses decrease significantly. WCB and DCB devices achieve significant space savings compared to traditional open-air solutions, and lead to higher overall availability of the substation. They normally require fewer foundations than traditional equipment, and have short and simple installation and commissioning procedures. Total life cycle cost and environmental impact is generally lower than for traditional equipment. In addition to high reliability and low maintenance, there are several environmental advantages to WCB and DCB devices. Substations equipped with WCB or DCB have smaller space requirements than conventional substations and use less steel structures and foundations. They have simpler cable connections and have lower electrical power losses. The amount of SF6 gas in the live-tank WCB and DCB designs is many times lower than in corresponding devices bases on gas-insulating substation (GIS) technology. 10 refs., 1 tab., 10 figs.

  16. [Artificial intelligence] AI for protection systems

    Aggarwal, R.; Johns, A.


    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  17. AIS-MOB(AIS便携式应急示位标)技术与应用%AIS-MOB(AIS portable emergency position indicator) Technology and Application



    AIS-MOB(AIS个人便携应急示位标)是一种可以安装于救生衣或随身携带的便携式应急示位报警装备,该设备可通过人工或落水自动启动,应用AIS自组织时分多址技术在AIS信道或指配的专用信道上,定时发送个人位置和报警信息,该信息可被所有AIS终端设备和基站设备接收显示,提高搜救效率。设备由AIS发射电路、GNSS定位、天线、电池等部分组成,可在紧急情况下连续工作48小时以上,可广泛应用于各类搜救系统。%AIS-MOB(AIS portable emergency position indicator) is a kind of can be installed on the lifejacket or portable emergency position indicating and alarm equipment, the equipment can be manual or automatic start falling, the application of AIS self-organized time division multiple access technology in AIS channel or assigned a dedicated channel, regularly send personal position and the alarm information, the information can be all AIS terminal equipment and base station equipment receiving display, improve search efficiency. Equipment from the AIS emission circuit, GNSS positioning, antenna, battery components, in an emergency situation more than 48 hours of continuous work, can be widely used in various types of search and rescue system.

  18. Dissociating Prediction Failure: Considerations from Music Perception

    Ross, Suzi; Hansen, Niels Christian


    Dissociating Prediction Failure: Considerations from Music Perception The Journal of Neuroscience, 16 March 2016, 36(11): 3103-3105;......Dissociating Prediction Failure: Considerations from Music Perception The Journal of Neuroscience, 16 March 2016, 36(11): 3103-3105;...

  19. Highlights on artificial insemination (AI) technology in the pig

    Tarek Khalifa; Constantinos Rekkas; Foteini Samartzi; Aristotelis Lymberopoulos; Kostas Kousenidis; Toni Dovenski


    Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a) the current status of swine AI in the world, (b) significance and limitation of AI with liquid and frozen semen, (c) the biological traits of porcine semen in relation to in-vitro sperm storage, (d) the criteria used for selection of a boar stud as a semen supplier, (e) how to process boar s...

  20. Dictionnaire igbo-français - suivi d'un index français-igbo

    Ugochukwu, Francoise; Okafor, Peter


    The first bilingual dictionary of standard Igbo ever published, sponsored by the French Institute in Africa, Nigeria. L'igbo est l'une des trois principales langues nigérianes de par le nombre de ses locuteurs. Ce volume, qui compte près de 4000 entrées igbo, est le premier véritable dictionnaire igbo-français. On y trouve le vocabulaire courant, le vocabulaire technique et spécialisé approuvé par le comité de standardisation de l'igbo, ainsi qu'un bon nombre de mots du milieu naturel et d...

  1. Comparison of collision-induced dissociation and electron-induced dissociation of phillyrin using FT-ICR MS.

    Lin, Zhenguang; Lin, Zhiwei; Mu, Yingdi; Yan, Dong


    Electrospray ionization Fourier transform ion cyclotron resonance mass spectrometry using collision-induced dissociation (CID) and electron capture dissociation (ECD) at high mass resolution was first applied to investigate the characteristic fragment ions of phillyrin. The CID experimental results demonstrated the elemental composition of fragment ions unambiguously, so a reasonable fragmentation pathway of phillyrin was proposed. The ECD fragmentation mechanism was believed to be fundamentally different from the CID method. ECD could be used not only in the biological field but also as a powerful complement to the structural identification of small molecular compounds. The characteristic fragmentation pathways were helpful in analyzing and interpreting the stability and property of the parent ion. PMID:27258687

  2. Correlations in the hadronic double diffractive dissociation

    A given reaction of double diffractive dissociation is studied based on the three-component Deck Model. The correlations among the diffractive slope, the effective mass of the dissociated particle sub-system and the dissociation angle in the Gottfried-Jackson are studied based in this model. 9 refs, 19 figs

  3. Creating an AI modeling application for designers and developers

    Houlette, Ryan; Fu, Daniel; Jensen, Randy


    Simulation developers often realize an entity's AI by writing a program that exhibits the intended behavior. These behaviors are often the product of design documents written by designers. These individuals, while possessing a vast knowledge of the subject matter, might not have any programming knowledge whatsoever. To address this disconnect between design and subsequent development, we have created an AI application whereby a designer or developer sketches an entity's AI using a graphical "drag and drop" interface to quickly articulate behavior using a UML-like representation of state charts. Aside from the design-level benefits, the application also features a runtime engine that takes the application's data as input along with a simulation or game interface, and makes the AI operational. We discuss our experience in creating such an application for both designer and developer.

  4. 4th June: AIS and NICE/MAIL unique authentication

    The AIS and NICE teams


    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on the 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. Thus starting on the 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  5. 4th June: AIS and NICE/MAIL unique authentication

    AIS and NICE teams


    Over the past few years, the IT department has been in the process of streamlining CERN users' access to all central computing services. The long term goal is to converge on a unique computer account, which will increase computer security and simplify account maintenance. The next step of this process will occur on 4th June 2007, as of when authenticating on the AIS applications (EDH, HRT, CET, APT, ERT, CRA, Foundation, ...) and on NICE (Windows) and MAIL will be done using the same username and password. As a reminder, this account can also be used on EDMS, INDICO, CDS and SIMBA. So starting on 4th June 2007, authentication on the AIS applications must be done using your AIS username and your MAIL/NICE password. Thanks for your understanding, The AIS and NICE teams

  6. Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS

    National Oceanic and Atmospheric Administration, Department of Commerce — Liquid Robotics Wave Glider, Honey Badger (G3), 2015, AIS. The MAGI mission is to use the Wave Glider to sample the late summer chlorophyll bloom that develops near...

  7. Dissociation of ozonide in water

    Bentley, J.; Collins, J.Y.; Chipman, D.M.


    The free energy of bond dissociation for ozonide ion radical is found to be lowered in aqueous solution by about 20 kcal/mol relative to that in the gas phase, based on electronic structure calculations. Explicit treatment of anion-water clusters indicates that the stronger hydrogen bonds to first-shell water molecules formed by O{sup {minus}} relative to O{sub 3}{sup {minus}} account for much of the lowering. Reaction field methods show that nonspecific electrostatic polarization of the bulk solvent further contributes noticeably to the lowering. The study clearly demonstrates that the aqueous free energy of ozonide bond dissociation is small, and probably endothermic. The best semitheoretical prediction of the actual value is 5 {+-} 5 kcal/mol.

  8. [Prison psychosis and dissociative disorders].

    al Chaabani, S; Bataille, M


    Through a few clinical case histories stemming from their daily activities at the psychiatric section of the Lantin Prison, the authors propose to revisit the classic concept of Prison psychosis. They broaden its limits to include other psychotic and dissociative phenomena common to the jail population. This requires a strict differential diagnosis, allowing to eliminate some similar pathologies; nevertheless, some difficulties and imperfections persist. The development of the psychosis, the input from the jail architecture and milieu, the predisposing as well as facilitating factors linked to the personality of the inmate, and triggering phenomena are discussed. Finally, the comorbidity between these psychotic/dissociative phenomena and the borderline & histrionic personality disorders is envisaged. PMID:12632838

  9. Coulomb dissociation of N,2120

    Röder, Marko; Adachi, Tatsuya; Aksyutina, Yulia; Alcantara, Juan; Altstadt, Sebastian; Alvarez-Pol, Hector; Ashwood, Nicholas; Atar, Leyla; Aumann, Thomas; Avdeichikov, Vladimir; Barr, M.; Beceiro, Saul; Bemmerer, Daniel; Benlliure, Jose; Bertulani, Carlos; Boretzky, Konstanze; Borge, Maria J. G.; Burgunder, G.; Caamaño, Manuel; Caesar, Christoph; Casarejos, Enrique; Catford, Wilton; Cederkäll, Joakim; Chakraborty, S.; Chartier, Marielle; Chulkov, Leonid; Cortina-Gil, Dolores; Crespo, Raquel; Datta Pramanik, Ushasi; Diaz-Fernandez, Paloma; Dillmann, Iris; Elekes, Zoltan; Enders, Joachim; Ershova, Olga; Estrade, A.; Farinon, F.; Fraile, Luis M.; Freer, Martin; Freudenberger, M.; Fynbo, Hans; Galaviz, Daniel; Geissel, Hans; Gernhäuser, Roman; Göbel, Kathrin; Golubev, Pavel; Gonzalez Diaz, D.; Hagdahl, Julius; Heftrich, Tanja; Heil, Michael; Heine, Marcel; Heinz, Andreas; Henriques, Ana; Holl, Matthias; Ickert, G.; Ignatov, Alexander; Jakobsson, Bo; Johansson, Hâkan; Jonson, Björn; Kalantar-Nayestanaki, Nasser; Kanungo, Rituparna; Kelic-Heil, Aleksandra; Knöbel, Ronja; Kröll, Thorsten; Krücken, Reiner; Kurcewicz, J.; Kurz, Nikolaus; Labiche, Marc; Langer, Christoph; Le Bleis, Tudi; Lemmon, Roy; Lepyoshkina, Olga; Lindberg, Simon; Machado, Jorge; Marganiec, Justyna; Mostazo Caro, Magdalena; Movsesyan, Alina; Najafi, Mohammad Ali; Nilsson, Thomas; Nociforo, Chiara; Panin, Valerii; Paschalis, Stefanos; Perea, Angel; Petri, Marina; Pietri, S.; Plag, Ralf; Prochazka, A.; Rahaman, Md. Anisur; Rastrepina, Ganna; Reifarth, Rene; Ribeiro, Guillermo; Ricciardi, M. Valentina; Rigollet, Catherine; Riisager, Karsten; Rossi, Dominic; Sanchez del Rio Saez, Jose; Savran, Deniz; Scheit, Heiko; Simon, Haik; Sorlin, Olivier; Stoica, V.; Streicher, Branislav; Taylor, Jon; Tengblad, Olof; Terashima, Satoru; Thies, Ronja; Togano, Yasuhiro; Uberseder, Ethan; Van de Walle, J.; Velho, Paulo; Volkov, Vasily; Wagner, Andreas; Wamers, Felix; Weick, Helmut; Weigand, Mario; Wheldon, Carl; Wilson, G.; Wimmer, Christine; Winfield, J. S.; Woods, Philip; Yakorev, Dmitry; Zhukov, Mikhail; Zilges, Andreas; Zuber, Kai; R3B Collaboration


    Neutron-rich light nuclei and their reactions play an important role in the creation of chemical elements. Here, data from a Coulomb dissociation experiment on N,2120 are reported. Relativistic N,2120 ions impinged on a lead target and the Coulomb dissociation cross section was determined in a kinematically complete experiment. Using the detailed balance theorem, the 19N (n ,γ )20N and 20N (n ,γ ) 21N excitation functions and thermonuclear reaction rates have been determined. The 19 (n ,γ )20N rate is up to a factor of 5 higher at T <1 GK with respect to previous theoretical calculations, leading to a 10% decrease in the predicted fluorine abundance.

  10. NASA space station automation: AI-based technology review

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.


    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  11. Using AI Planning Techniques for Army Small Unit Operations

    Tate, Austin; Levine, John; Jarvis, Peter; Dalton, Jeffrey


    In this paper, we outline the requirements of a planning and decision aid to support US Army small unit operations in urban terrain and show how AI planning technologies can be exploited in that context. The work is a rare example of a comprehensive use of AI technologies across the whole planning lifecycle, set in a realistic application in which the actual user community set the requirements. The phases involved include: * Domain knowledge elicitation * Rich plan representation and use ...

  12. Giving the AI definition a form suitable for the engineer

    Dobrev, Dimiter


    Artificial Intelligence - what is this? That is the question! In earlier papers we already gave a formal definition for AI, but if one desires to build an actual AI implementation, the following issues require attention and are treated here: the data format to be used, the idea of Undef and Nothing symbols, various ways for defining the "meaning of life", and finally, a new notion of "incorrect move". These questions are of minor importance in the theoretical discussion, but we already know t...

  13. Tissue Dissociation for Metastasis Studies.

    Kabeer, Farhia; Podsypanina, Katrina


    The main requirement for most metastasis-related applications is the conversion of solid tissue into a single-cell suspension. In theory, this suspension represents the diversity of cells present in the tissue, whether malignant or benign. We have found that cell viability, as measured by trypan blue staining or fluorescence-activated cell sorting (FACS), is critical for evaluating the success of the tissue-dissociation procedure. The recommended goal is at least 70% cell viability. PMID:26832679

  14. Coulomb dissociation of 8B and solar neutrino problem

    We measured the cross section for Coulomb dissociation of 8B using a radioactive 8B beam of 46.5MeV/u energy with a 208Pb target. The cross section for the 7Be(p,γ)8B capture reaction was deduced at Ecm=0.6-1.7MeV. The extracted astrophysical S17 factors were consistent with the values measured by Vaughn et al. and Filippone et al. Possible corrections due to 7Be excited state population, E1 and M2 contribution, nuclear contribution and post acceleration effects are considered. ((orig.))

  15. Highlights on artificial insemination (AI technology in the pig

    Tarek Khalifa


    Full Text Available Over the past decade, there has been a tremendous increase in the development of field AI services in the majority of countries concerned with pig production. The objective of this paper is to review: (a the current status of swine AI in the world, (b significance and limitation of AI with liquid and frozen semen, (c the biological traits of porcine semen in relation to in-vitro sperm storage, (d the criteria used for selection of a boar stud as a semen supplier, (e how to process boar semen for liquid and frozen storage in the commercial settings and (f how to improve fertility and prolificacy of boar semen. More than 99% of the inseminations conducted worldwide are made with liquid-stored semen. AI with frozen semen is used only for upgrading the genetic base in a particular country or herd. Determining the initial quality of semen ejaculates along with the selection of the optimum storage extender has a profound effect on the quality and fertility of AI doses. Different procedures have been used for improving the fertility of preserved spermatozoa including colloidal centrifugation of the semen, intrauterine insemination and modulation of the uterine defense mechanism after AI. Development of an efficient protocol for synchronizing the time of ovulation in sows and gilts coupled with improving uterine horn insemination technique will make a breakthrough in the commercial use of frozen boar semen.

  16. AI-2 of Aggregatibacter actinomycetemcomitans Inhibits Candida albicans Biofilm Formation

    Endang W. Bachtiar


    Full Text Available Aggregatibacter actinomycetemcomitans, a Gram-negative bacterium, and Candida albicans, a polymorphic fungus, are both commensals of the oral cavity but both are opportunistic pathogens that can cause oral diseases. A. actinomycetemcomitans produces a quorum-sensing molecule called autoinducer-2 (AI-2, synthesized by LuxS, that plays an important role in expression of virulence factors, in intra- but also in interspecies communication. The aim of this study was to investigate the role of AI-2 based signaling in the interactions between C. albicans and A. actinomycetemcomitans. A. actinomycetemcomitans adhered to C. albicans and inhibited biofilm formation by means of a molecule that was secreted during growth. C. albicans biofilm formation increased significantly when co-cultured with A. actinomycetemcomitans luxS, lacking AI-2 production. Addition of wild-type-derived spent medium or synthetic AI-2 to spent medium of the luxS strain, restored inhibition of C. albicans biofilm formation to wild-type levels. Addition of synthetic AI-2 significantly inhibited hypha formation of C. albicans possibly explaining the inhibition of biofilm formation. AI-2 of A. actinomycetemcomitans is synthesized by LuxS, accumulates during growth and inhibits C. albicans hypha- and biofilm formation. Identifying the molecular mechanisms underlying the interaction between bacteria and fungi may provide important insight into the balance within complex oral microbial communities.

  17. Two-temperature models for nitrogen dissociation

    da Silva, M. Lino; Guerra, V.; Loureiro, J.


    Accurate sets of nitrogen state-resolved dissociation rates have been reduced to two-temperature (translational T and vibrational Tv) dissociation rates. The analysis of such two-temperature dissociation rates shows evidence of two different dissociation behaviors. For Tv 0.3 T dissociation proceeds predominantly form the near-dissociative vibrational levels, with an abrupt change of behavior at Tv = 0.3 T. These two-temperature sets have then been utilized as a benchmark for the comparison against popular multitemperature dissociation models (Park, Hansen, Marrone-Treanor, Hammerling, Losev-Shatalov, Gordiets, Kuznetsov, and Macheret-Fridman). This has allowed verifying the accuracy of each theoretical model, and additionally proposing adequate values for any semi-empirical parameters present in the different theories. The Macheret-Fridman model, who acknowledges the existence of the two aforementioned dissociation regimes, has been found to provide significantly more accurate results than the other models. Although these different theoretical approaches have been tested and validated solely for nitrogen dissociation processes, it is reasonable to expect that the general conclusions of this work, regarding the adequacy of the different dissociation models, could be extended to the description of arbitrary diatomic dissociation processes.

  18. 76 FR 44045 - Establishment of the SANE/SART AI/AN Initiative Committee


    ... of Justice Programs Establishment of the SANE/SART AI/AN Initiative Committee AGENCY: Office for... (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or... (FACA), as amended, 5 U.S.C., App. 2. The SANE/SART AI/AN Initiative Committee will provide the...

  19. Controlling dissociation by trapping trajectories in highly energetic states

    de Almeida, A. K., Jr.; Egydio de Carvalho, R.; de Lima, E. F.


    We consider the non-linear dynamics of a polar diatomic molecule under the action of laser-field interactions and in the presence of a dissipation mechanism, described by the classical damped and driven one-dimensional Morse oscillator. In the absence of laser fields and dissipation, the phase space consists of a negative-energy bound region and a positive-energy dissociative region. Laser-molecule interaction changes the phase space allowing transitions from the bound to the dissociative region through chaotic routes. We show that for a spatially dependent dipole force, resonances with positive energies allow the trapping of trajectories in pseudo-bound states. We also show that, upon the introduction of dissipation, there exist non-trivial point attractors as well as chaotic attractors, which capture the trajectories in pseudo-bound states. Consequently, in addition to the parameters associated with the laser-molecule interaction, the amplitude of the dissipation acts as a control parameter of the photo-dissociation dynamics.

  20. Characteristics of covert and overt visual orienting: Evidence from attentional and oculomotor capture

    Wu, Shu-Chieh; Remington, Roger W.


    Five visual search experiments found oculomotor and attentional capture consistent with predictions of contingent orienting, contrary to claims that oculomotor capture is purely stimulus driven. Separate saccade and attend-only conditions contained a color target appearing either singly, with an onset or color distractor, or both. In singleton mode, onsets produced oculomotor and attentional capture. In feature mode, capture was absent or greatly reduced, providing evidence for top-down modulation of both types of capture. Although attentional capture by color abstractors was present throughout, oculomotor capture by color occurred only when accompanied by transient change, providing evidence for a dissociation between oculomotor and attentional capture. Oculomotor and attentional capture appear to be mediated by top-down attentional control settings, but transient change may be necessary for oculomotor capture. ((c) 2003 APA, all rights reserved).

  1. Celebrating AI's Fiftieth Anniversary and Continuing Innovation at the AAAI/IAAI-06 Conferences

    Hedberg, Sara R.


    The seeds of AI were sewn at the Dartmouth Conference in the summer of 1956. John McCarthy, then an assistant mathematics professor at Dartmouth, organized the conference and coined the name "artificial intelligence" in his conference proposal. This summer AAAI celebrates the first 50 years of AI; and continues to foster the fertile fields of AI at the National AI conference (AAAI-06) and Innovative Applications of AI conference (IAAI-06) in Boston.

  2. Diffractive dissociation and new quarks

    We argue that the chiral limit of QCD can be identified with the strong (diffractive dissociation) coupling limit of reggeon field theory. Critical Pomeron scaling at high energy must then be directly related to an infra-red fixed-point of massless QCD and so requires a large number of flavors. This gives a direct argument that the emergence of diffraction-peak scaling, KNO scaling etc. at anti p-p colliders are evidence of a substantial quark structure still to be discovered

  3. Discovering Knowledge from AIS Database for Application in VTS

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  4. Proceedings of conference on AI applications in physical sciences

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  5. Maritime traffic monitoring using a space-based AIS receiver

    Eriksen, Torkild; Høye, Gudrun; Narheim, Bjørn; Meland, Bente Jensløkken


    The Automatic Identification System (AIS) is a maritime safety and vessel traffic system imposed by the International Maritime Organization (IMO). The system broadcasts position reports and short messages with information about the ship and the voyage. Using frequencies in the maritime VHF band, the coverage is similar to other VHF applications, and is essentially dependent on the altitude of the antenna. For ship-to-ship communications the range is typically 20 nautical miles and for ship-to-shore up to 40 nm. A space-based AIS receiver in low earth orbit will have a range to the horizon of more than 1000 nm, giving an excellent opportunity for large-area ocean surveillance. The Norwegian Defence Research Establishment (FFI) has performed a feasibility study on reception of AIS messages from space. The results show that a ship detection probability of near 100% can be obtained for up to 1000 ships within the coverage area, and that for a standard AIS receiver a signal power margin of 10-20 dB can be achieved. On this background, swath-width analyses for European scenarios are done. It is argued that space-based reception of AIS messages is a promising way of achieving long-range identification and tracking services at marginal cost.

  6. Mirror Writing and a Dissociative Identity Disorder

    Catherine Le; Joyce Smith; Lewis Cohen


    Individuals with dissociative identity disorder (DID) have been known to show varied skills and talents as they change from one dissociative state to another. For example, case reports have described people who have changed their handedness or have spoken foreign languages during their dissociative states. During an interview with a patient with DID, a surprising talent emerged when she wrote a sentence for the Folstein Mini-Mental State Exam—mirror writing. It is not known whether her mirror...

  7. Radiolytic dissociative gas power conversion cycles

    A gas or combined gas/steampower cycle is described. A portion of the working fluid is dissociated by radiolysis at a temperature below the thermal equilibrium temperature of the dissociated working fluid, such that the fluid is at macroscopic thermal non-equilibrium. The dissociated fluid components are then recombined to heat the working fluid. Recombination may be carried out while expanding the fluid components so as to maintain a constant temperature in a rotatory fluid engine

  8. Charmonium dissociation cross sections and charmonium dissociation rates in hadronic matter

    Liu, Feng-Rong; Xu, Xiao-Ming


    K*-charmonium dissociation reactions in hadronic matter are studied in the Born approximation, in the quark-interchange mechanism, and with a temperature-dependent quark potential. We obtain the temperature dependence of unpolarized cross sections for K*-charmonium dissociation reactions which produce charmed mesons and charmed strange mesons. We use the cross sections for charmonium dissociation in collisions with pion, rho meson, kaon, vector kaon, and eta meson to calculate dissociation rates of charmonium with the five types of mesons. Because of the temperature dependence of the meson masses, dissociation cross sections, and meson distribution functions, the charmonium dissociation rates generally increase with the increase of temperature and decrease with the increase of charmonium momentum from 2.2 GeV/c. We find that the first derivative of the dissociation rate with respect to the charmonium momentum is zero when the charmonium is at rest. While the eta + psi' and eta + chi_c dissociation reactions c...

  9. Analysis of raw AIS spectrum recordings from a LEO satellite

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter


    The AAUSAT3 satellite is a 1U cubesat, which has been developed by students at Aalborg University, Denmark in collaboration with the Danish Maritime Authority. The satellite was launched in February 2013 on a mission to monitor ships from space using their AIS broadcast signals as an indication of...... position. The SDR receiver developed to listen for these AIS signals also allows for sampling and storing of the raw intermediate frequency spectrum, which has been used in order to map channel utilization over the areas of interest for the mission, which is mainly the arctic regions. The SDR based...... receiver used onboard the satellite is using a single chip front-end solution, which down converts the AIS signal located around 162 MHz into an intermediate frequency, with a up to 200 kHz bandwidth. This I/F signal is sampled with a 750 kSPS A/D converter and further processed by an Analog Devices DSP...

  10. Video Screen Capture Basics

    Dunbar, Laura


    This article is an introduction to video screen capture. Basic information of two software programs, QuickTime for Mac and BlueBerry Flashback Express for PC, are also discussed. Practical applications for video screen capture are given.

  11. Dissociative recombination of organic molecular ions of relevance for interstellar clouds and Titan's upper atmosphere

    Vigren, Erik


    This thesis presents experimental studies on the dissociative recombination (DR) of the organic molecular ions CD3CND+, CH2CHCNH+, CH3CH2CNH+, CD3CDO+, CH3CHO+ and DCOOD2+. The experiments were all performed at the heavy ion storage ring CRYRING at the Manne Siegbahn Laboratory in Stockholm, Sweden. DR is the process in which a singly charged molecular cation captures a free electron, forming a highly excited intermediate molecule which then dissociates into exclusively neutral fragments. The...

  12. Radiative electron capture

    Some data are presented for radiative electron capture by fast moving ions. The radiative electron capture spectrum is shown for O8+ in Ag, along with the energy dependence of the capture cross-section. A discrepancy between earlier data, theoretical prediction, and the present data is pointed out. (3 figs) (U.S.)

  13. What AI Pratitioners Should Know about the Law Part Two

    Frank, Steven J.


    This is Part 2 of a two-part article and discusses issues of tort liability and the use of computers in the courtroom. [The legal dimensions of topics covered in this part are given comprehensive attention by the author in Tort Adjudication and the Emergence of Artificial Intelligence Software, 21 Suffolk University Law Review 623 (1987)]. Part 1 of this article, which appeared in the Spring 1988 issue of AI Magazine, discussed steps that developers of AI systems can take to protect their eff...

  14. Molecular dissociation in dilute gas

    The charge state distributions (CSD) produced during molecular dissociation are important to both Trace Element Accelerator Mass Spectrometry (TEAMS) and the ion implantation industry. The CSD of 1.3 - 1.7 MeV SiN+, SiMg+, SiMn+, and SiZn+ molecules have been measured for elements that do not form atomic negative ions (N, Mg, Mn, and Zn) using a NEC Tandem Pelletron accelerator. The molecules were produced in a Cs sputter negative ion source, accelerated, magnetically analyzed, and then passed through an N2 gas cell. The neutral and charged breakups where analyzed using an electrostatic deflector and measured with particle detectors. Equilibrium CSD were determined and comparisons made between molecular and atomic ion data. copyright 1999 American Institute of Physics

  15. Theory of dissociative tunneling ionization

    Svensmark, Jens; Madsen, Lars Bojer


    We present a theoretical study of the dissociative tunneling ionization process. Analytic expressions for the nuclear kinetic energy distribution of the ionization rates are derived. A particularly simple expression for the spectrum is found by using the Born-Oppenheimer (BO) approximation in conjunction with the reflection principle. These spectra are compared to exact non-BO ab initio spectra obtained through model calculations with a quantum mechanical treatment of both the electronic and nuclear degrees freedom. In the regime where the BO approximation is applicable imaging of the BO nuclear wave function is demonstrated to be possible through reverse use of the reflection principle, when accounting appropriately for the electronic ionization rate. A qualitative difference between the exact and BO wave functions in the asymptotic region of large electronic distances is shown. Additionally the behavior of the wave function across the turning line is seen to be reminiscent of light refraction. For weak fiel...

  16. Capture Their Attention: Capturing Lessons Using Screen Capture Software

    Drumheller, Kristina; Lawler, Gregg


    When students miss classes for university activities such as athletic and academic events, they inevitably miss important class material. Students can get notes from their peers or visit professors to find out what they missed, but when students miss new and challenging material these steps are sometimes not enough. Screen capture and recording…

  17. Sedation and dissociative anaesthesia in the horse

    Marntell, Stina


    The overall aim of this investigation was to study the effects of different drug combinations for premedication and dissociative anaesthesia, to examine their suitability for field conditions and their ability to maintain cardiorespiratory function and provide sufficient analgesia for common, but challenging procedures such as castration. Haemodynamic parameters, pulmonary ventilation-perfusion relationships, and clinical effects were studied during sedation and dissociative anaesthesia. The ...

  18. The expectancy of threat and peritraumatic dissociation

    Pamela McDonald


    Full Text Available Background: Peritraumatic dissociation is one of the most critical acute responses to a traumatic experience, partly because it predicts subsequent posttraumatic stress disorder. Despite this, there is little understanding about the factors that influence peritraumatic dissociation. This study investigated the extent to which peritraumatic dissociation is predicted by the amount of perceived warning that participants had of the impact of the trauma. Method: Randomized eligible admissions to four major trauma hospitals (N =243 were assessed during hospital admission with the Peritraumatic Dissociation Experiences Questionnaire (PDEQ and the perceived warning that participants had before the trauma impact occurred. Results: Whereas female gender predicted both Awareness and Derealization subscale scores on the PDEQ, perceived warning also predicted scores on the Derealization subscale. Conclusions: This finding suggests that the degree of anticipated threat may contribute to peritraumatic dissociation.

  19. The 2010 Mario AI Championship: Level Generation Track

    Shaker, Noor; Togelius, Julian; Yannakakis, Georgios N.;


    The Level Generation Competition, part of the IEEE CIS-sponsored 2010 Mario AI Championship, was to our knowledge the world’s first procedural content generation competition. Competitors participated by submitting level generators — software that generates new levels for a version of Super Mario...

  20. A Systems Development Life Cycle Project for the AIS Class

    Wang, Ting J.; Saemann, Georgia; Du, Hui


    The Systems Development Life Cycle (SDLC) project was designed for use by an accounting information systems (AIS) class. Along the tasks in the SDLC, this project integrates students' knowledge of transaction and business processes, systems documentation techniques, relational database concepts, and hands-on skills in relational database use.…

  1. Artificial Intelligence: Is the Future Now for A.I.?

    Ramaswami, Rama


    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  2. The hidden dangers of experimenting in distributed AI

    Meyer, A.P.; Smit, A.; Kempen, M.; Wijngaards, N.


    Research on multi-agent systems often involves experiments, also in situations where humans interact with agents. Consequently, the field of experimental (human) sciences becomes more and more relevant. This paper clarifies how things can and often do go wrong in distributed AI experiments. We show

  3. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  4. The Shutdown Dissociation Scale (Shut-D

    Inga Schalinski


    Full Text Available The evolutionary model of the defense cascade by Schauer and Elbert (2010 provides a theoretical frame for a short interview to assess problems underlying and leading to the dissociative subtype of posttraumatic stress disorder. Based on known characteristics of the defense stages “fright,” “flag,” and “faint,” we designed a structured interview to assess the vulnerability for the respective types of dissociation. Most of the scales that assess dissociative phenomena are designed as self-report questionnaires. Their items are usually selected based on more heuristic considerations rather than a theoretical model and thus include anything from minor dissociative experiences to major pathological dissociation. The shutdown dissociation scale (Shut-D was applied in several studies in patients with a history of multiple traumatic events and different disorders that have been shown previously to be prone to symptoms of dissociation. The goal of the present investigation was to obtain psychometric characteristics of the Shut-D (including factor structure, internal consistency, retest reliability, predictive, convergent and criterion-related concurrent validity.A total population of 225 patients and 68 healthy controls were accessed. Shut-D appears to have sufficient internal reliability, excellent retest reliability, high convergent validity, and satisfactory predictive validity, while the summed score of the scale reliably separates patients with exposure to trauma (in different diagnostic groups from healthy controls.The Shut-D is a brief structured interview for assessing the vulnerability to dissociate as a consequence of exposure to traumatic stressors. The scale demonstrates high-quality psychometric properties and may be useful for researchers and clinicians in assessing shutdown dissociation as well as in predicting the risk of dissociative responding.

  5. AIS - Milestone of Marine Communication and Navigation%AIS-海事通信和导航的里程碑




  6. Overriding auditory attentional capture.

    Dalton, Polly; Lavie, Nilli


    Attentional capture by color singletons during shape search can be eliminated when the target is not a feature singleton (Bacon & Egeth, 1994). This suggests that a "singleton detection" search strategy must be adopted for attentional capture to occur. Here we find similar effects on auditory attentional capture. Irrelevant high-intensity singletons interfered with an auditory search task when the target itself was also a feature singleton. However, singleton interference was eliminated when the target was not a singleton (i.e., when nontargets were made heterogeneous, or when more than one target sound was presented). These results suggest that auditory attentional capture depends on the observer's attentional set, as does visual attentional capture. The suggestion that hearing might act as an early warning system that would always be tuned to unexpected unique stimuli must therefore be modified to accommodate these strategy-dependent capture effects. PMID:17557587

  7. Neutron Capture Nucleosynthesis

    Kiss, Miklos


    Heavy elements (beyond iron) are formed in neutron capture nucleosynthesis processes. We have proposed a simple unified model to investigate the neutron capture nucleosynthesis in arbitrary neutron density environment. We have also investigated what neutron density is required to reproduce the measured abundance of nuclei assuming equilibrium processes. We found both of these that the medium neutron density has a particularly important role at neutron capture nucleosynthesis. About these resu...

  8. Overriding auditory attentional capture

    Dalton, Polly; Lavie, Nilli


    Attentional capture by color singletons during shape search can be eliminated when the target is not a feature singleton (Bacon & Egeth, 1994). This suggests that a "singleton detection" search strategy must be adopted for attentional capture to occur. Here we find similar effects on auditory attentional capture. Irrelevant high-intensity singletons interfered with an auditory search task when the target itself was also a feature singleton. However, singleton interference was eliminated when ...

  9. From state dissociation to status dissociatus.

    Antelmi, Elena; Ferri, Raffaele; Iranzo, Alex; Arnulf, Isabelle; Dauvilliers, Yves; Bhatia, Kailash P; Liguori, Rocco; Schenck, Carlos H; Plazzi, Giuseppe


    The states of being are conventionally defined by the simultaneous occurrence of behavioral, neurophysiological and autonomic descriptors. State dissociation disorders are due to the intrusion of features typical of a different state into an ongoing state. Disorders related to these conditions are classified according to the ongoing main state and comprise: 1) Dissociation from prevailing wakefulness as seen in hypnagogic or hypnopompic hallucinations, automatic behaviors, sleep drunkenness, cataplexy and sleep paralysis 2) Dissociation from rapid eye movement (REM) sleep as seen in REM sleep behavior disorder and lucid dreaming and 3) Dissociation from NREM sleep as seen in the disorders of arousal. The extreme expression of states dissociation is characterized by the asynchronous occurrence of the various components of the different states that prevents the recognition of any state of being. This condition has been named status dissociatus. According to the underlying disorders/diseases and to their severity, among status dissociatus we may recognize disorders in which such an extreme dissociation occurs only at night time or intermittently (i.e., autoimmune encephalopathies, narcolepsy type 1 and IgLON5 parasomnia), and others in which it occurs nearly continuously with complete loss of any conventionally defined state of being, and of the circadian pattern (agrypnia excitata). Here, we render a comprehensive review of all diseases/disorders associated with state dissociation and status dissociatus and propose a critical classification of this complex scenario. PMID:26431902


    Lean YU; Shouyang WANG; Kin Keung LAI


    Due to the complexity of economic system and the interactive effects between all kinds of economic variables and foreign trade, it is not easy to predict foreign trade volume. However, the difficulty in predicting foreign trade volume is usually attributed to the limitation of many conventional forecasting models. To improve the prediction performance, the study proposes a novel kernel-based ensemble learning approach hybridizing econometric models and artificial intelligence (AI) models to predict China's foreign trade volume. In the proposed approach, an important econometric model, the co-integration-based error correction vector auto-regression (EC-VAR) model is first used to capture the impacts of all kinds of economic variables on Chinese foreign trade from a multivariate linear anal-ysis perspective. Then an artificial neural network (ANN) based EC-VAR model is used to capture the nonlinear effects of economic variables on foreign trade from the nonlinear viewpoint. Subsequently, for incorporating the effects of irregular events on foreign trade, the text mining and expert's judgmental adjustments are also integrated into the nonlinear ANN-based EC-VAR model. Finally, all kinds of economic variables, the outputs of linear and nonlinear EC-VAR models and judgmental adjustment model are used as input variables of a typical kernel-based support vector regression (SVR) for en-semble prediction purpose. For illustration, the proposed kernel-based ensemble learning methodology hybridizing econometric techniques and AI methods is applied to China's foreign trade volume predic-tion problem. Experimental results reveal that the hybrid econometric-AI ensemble learning approach can significantly improve the prediction performance over other linear and nonlinear models listed in this study.

  11. Neutron Capture Nucleosynthesis

    Kiss, Miklos


    Heavy elements (beyond iron) are formed in neutron capture nucleosynthesis processes. We have proposed a simple unified model to investigate the neutron capture nucleosynthesis in arbitrary neutron density environment. We have also investigated what neutron density is required to reproduce the measured abundance of nuclei assuming equilibrium processes. We found both of these that the medium neutron density has a particularly important role at neutron capture nucleosynthesis. About these results most of the nuclei can formed at medium neutron capture density environment e.g. in some kind of AGB stars. Besides these observations our model is capable to use educational purpose.

  12. Energy distribution in dissociations of polyatomic molecules

    In this thesis studies are reported of fragmentation processes in polyatomic molecules. In order to find out which dessocaciation reactions take place, how they are brought about by the internal energy of the reactant, and to investigate the structure of the dissociating 'transition state', the fragment mass and the corresponding kinetic energy release (KER) are determined by differential translational spectroscopy using a position and time sensitive two-particle coincidence detector. The results are interpreted using the statistical theory of unimolecular dissociation. It turns out that the standard assumptions of the theory, especially in calculating KER-distributions, are not realistic in all molecules considered. Dissociation is induced by the neutralization with alkali metal vapour. In ch. 2 the experimental method and the analysis of the data (dissociation pathways, branching ratios and ε-d-distributions) are introduced and exemplified by measurements of cyclohexane, which represents the upper limit in precursor and fragment mass accessible in the apparatus. In ch. 3 a study is reported of the molecules methylchloride (CH3Cl) and the acetylradical (CH3CO). In spite of their similar geometric structures, completely different dissociation mechanisms have been found. Methylchloride dissociates via a repulsive state; acetyl radicals show energy scrambling. The energy distribution from dissociating acetyl exemplifies dynamical effects in the dissociation. In ch. 4 an investigation of a number of prototype hydrocarbons is presented. The dissociation pathways of several small linear alkanes indicate that neutralization takes place to unknown repulsive potentials, of which the position and steepness are determined from the kinetic energy release. (author). 118 refs.; 40 figs.; 5 tabs

  13. Dissociation in schizophrenia and borderline personality disorder

    Pec O


    Full Text Available Ondrej Pec,1,2 Petr Bob,1,3 Jiri Raboch1 1Center for Neuropsychiatric Research of Traumatic Stress, Department of Psychiatry, First Faculty of Medicine, Charles University, Prague, 2Psychotherapeutic and Psychosomatic Clinic ESET, Prague, 3Central European Institute of Technology, Faculty of Medicine, Masaryk University, Brno, Czech Republic Background: Dissociation likely plays a key role in schizophrenia and borderline personality disorder (BPD, although empirical studies that compare specific manifestations of these symptoms in schizophrenia and BPD are rare. In this context, the purpose of this study was to compare the occurrence of dissociative and other psychopathological symptoms in these disorders, and to assess the possible influence of antipsychotic medication on the dissociative symptoms. Methods: We assessed 31 patients with schizophrenia and 36 patients with BPD. Dissociative symptoms were measured by the Dissociative Experiences Scale (DES, symptoms related to stress and traumatic experiences were assessed using the Trauma Symptom Checklist-40 (TSC-40, and other psychopathological symptoms were measured with the Health of the Nation Outcome Scales (HoNOS. We also assessed actual daily doses of antipsychotic medication in chlorpromazine equivalents in all participants. Results: The results show that symptoms of traumatic stress measured by the TSC-40 had significantly higher scores in the BPD group. The data also show that dissociative symptoms (DES were significantly correlated with symptoms of traumatic stress (TSC-40 and with symptoms assessed by the HoNOS. Remarkably significant correlations were found between levels of antipsychotic medication and the DES and between antipsychotic medication and the depersonalization/derealization component of the DES in BPD patients. Conclusion: The results support an important role of dissociative processes in schizophrenia and BPD and suggest a significant relationship between manifestations

  14. Theory of dissociative tunneling ionization

    Svensmark, Jens; Tolstikhin, Oleg I.; Madsen, Lars Bojer


    We present a theoretical study of the dissociative tunneling ionization process. Analytic expressions for the nuclear kinetic energy distribution of the ionization rates are derived. A particularly simple expression for the spectrum is found by using the Born-Oppenheimer (BO) approximation in conjunction with the reflection principle. These spectra are compared to exact non-BO ab initio spectra obtained through model calculations with a quantum mechanical treatment of both the electronic and nuclear degrees of freedom. In the regime where the BO approximation is applicable, imaging of the BO nuclear wave function is demonstrated to be possible through reverse use of the reflection principle, when accounting appropriately for the electronic ionization rate. A qualitative difference between the exact and BO wave functions in the asymptotic region of large electronic distances is shown. Additionally, the behavior of the wave function across the turning line is seen to be reminiscent of light refraction. For weak fields, where the BO approximation does not apply, the weak-field asymptotic theory describes the spectrum accurately.

  15. Atom capture and loss in ion molecule collisions

    Progress is reported in measuring the energy and angular distribution of protons emerging with velocity close to the beam velocity from the target region when Ar+ beams collide with a CH4 target and ArH+ beams collide with a He target at asymptotically high speeds. The protons result from the transfer of a target constituent to the projectile (atom capture) or from the dissociation of the projectile molecule in the collision (atom loss). For atom capture processes the Thomas peak is clearly observed. 10 refs., 3 figs

  16. 78 FR 17232 - Meeting of the SANE/SART AI/AN Initiative Committee


    ... of Justice Programs Meeting of the SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of... Indian/ Alaska Native (AI/AN) Sexual Assault Nurse Examiner (SANE)--Sexual Assault Response Team (SART..., victim-centered responses to sexual violence within AI/AN communities. DATES AND LOCATIONS: The...

  17. 77 FR 68150 - Meeting of the SANE/SART AI/AN Initiative Committee


    ... of Justice Programs Meeting of the SANE/SART AI/AN Initiative Committee AGENCY: Office for Victims of... Assault Nurse Examiner (SANE) Sexual Assault Response Team (SART) American Indian/Alaskan Native (AI/AN) Initiative (``SANE/SART AI/AN Initiative Committee'' or ``Committee'') will meet to carry out its mission...

  18. Peptide and protein sequence analysis by electron transfer dissociation mass spectrometry

    Syka, John E. P.; Coon, Joshua J.; Schroeder, Melanie J.; Shabanowitz, Jeffrey; Hunt, Donald F.


    Peptide sequence analysis using a combination of gas-phase ion/ion chemistry and tandem mass spectrometry (MS/MS) is demonstrated. Singly charged anthracene anions transfer an electron to multiply protonated peptides in a radio frequency quadrupole linear ion trap (QLT) and induce fragmentation of the peptide backbone along pathways that are analogous to those observed in electron capture dissociation. Modifications to the QLT that enable this ion/ion chemistry are presented, and automated ac...

  19. Characteristics of CO2 Hydrate Formation and Dissociation in Glass Beads and Silica Gel

    Qingping Li; Jiafei Zhao; Yu Liu; Xuke Ruan; Yongchen Song; Mingjun Yang


    CO 2 hydrate formation and dissociation is crucial for hydrate-based CO 2 capture and storage. Experimental and calculated phase equilibrium conditions of carbon dioxide (CO 2 ) hydrate in porous medium were investigated in this study. Glass beads were used to form the porous medium. The experimental data were generated using a graphical method. The results indicated the decrease of pore size resulted in the increase of the equilibrium pressure of CO 2 hydrate. Magnetic resonance imaging (MRI...

  20. Carbon Capture and Storage

    Benson, S.M.; Bennaceur, K.; Cook, P.; Davison, J.; Coninck, H. de; Farhat, K.; Ramirez, C.A.; Simbeck, D.; Surles, T.; Verma, P.; Wright, I.


    Emissions of carbon dioxide, the most important long-lived anthropogenic greenhouse gas, can be reduced by Carbon Capture and Storage (CCS). CCS involves the integration of four elements: CO 2 capture, compression of the CO2 from a gas to a liquid or a denser gas, transportation of pressurized CO 2

  1. CAPTURED India Country Evaluation

    O'Donoghue, R.; Brouwers, J.H.A.M.


    This report provides the findings of the India Country Evaluation and is produced as part of the overall CAPTURED End Evaluation. After five years of support by the CAPTURED project the End Evaluation has assessed that results are commendable. I-AIM was able to design an approach in which health fol

  2. Precursor anion states in dissociative electron attachment to chlorophenol isomers

    Kossoski, F.; Varella, M. T. do N.


    We report a theoretical study on low-energy (chlorophenol isomers, namely, para-chlorophenol (pCP), meta-chlorophenol (mCP), and ortho-chlorophenol (oCP). The calculations were performed with the Schwinger multichannel method with pseudopotentials, and analysis of the computed integral cross sections and virtual orbitals revealed one σCCl ∗ , one σOH ∗ , and three π∗ shape resonances. We show that electron capture into the two lower lying π∗ orbitals initiates dissociative processes that lead to the elimination of the chloride ion, accounting for the two overlapping peaks where this fragment was observed. Despite the relatively small differences on the energetics of the π∗ resonances, a major isomeric effect was found on their corresponding autodetachment lifetimes, which accounts for the observed increasing cross sections in the progression pCP chlorophenols and phenol actually takes place by a mechanism in which the incoming electron is directly attached to the dissociative σOH ∗ orbital.

  3. CO2 dissociation in vortex-stabilised microwave plasmas

    Welzel, S.; Bongers, W. A.; Graswinckel, M. F.; van de Sanden, M. C. M.


    Plasma-assisted gas conversion techniques are widely considered as efficient building blocks in a future energy infrastructure which will be based on intermittent, renewable electricity sources. CO2 dissociation in high-frequency plasmas is of particular interest in carbon capture and utilisation process chains for the production of CO2-neutral fuels. In order to achieve efficient plasma processes of high throughput specifically designed gas flow and power injection regimes are required. In this contribution vortex-stabilised microwave plasmas in undiluted CO2 were studied in a pressure range from 170 to 1000 mbar at up to 1 kW (forward) injected power, respectively. The CO2 depletion was measured downstream, e.g. by means of mass spectrometry. Although the system configuration was entirely not optimised, energy efficiencies of nearly 40%, i.e. close to the thermal dissociation limit, and conversion efficiencies of up to 23% were achieved. Additionally, spatially-resolved emission spectroscopy was applied to map the axial and radial distribution of excited atomic (C, O) and molecular (CO, C2) species along with their rotational temperatures. Eindhoven University of Technology, Postbox 513, 5600 MB Eindhoven.

  4. Reach tracking reveals dissociable processes underlying cognitive control.

    Erb, Christopher D; Moher, Jeff; Sobel, David M; Song, Joo-Hyun


    The current study uses reach tracking to investigate how cognitive control is implemented during online performance of the Stroop task (Experiment 1) and the Eriksen flanker task (Experiment 2). We demonstrate that two of the measures afforded by reach tracking, initiation time and reach curvature, capture distinct patterns of effects that have been linked to dissociable processes underlying cognitive control in electrophysiology and functional neuroimaging research. Our results suggest that initiation time reflects a response threshold adjustment process involving the inhibition of motor output, while reach curvature reflects the degree of co-activation between response alternatives registered by a monitoring process over the course of a trial. In addition to shedding new light on fundamental questions concerning how these processes contribute to the cognitive control of behavior, these results present a framework for future research to investigate how these processes function across different tasks, develop across the lifespan, and differ among individuals. PMID:27045465

  5. Future role of AI/Robotics in physical security

    Manpower requirements for physical security systems place a heavy burden on operating security budgets. Technology innovations which free personnel or which make security personnel more efficient in carrying out their tasks is an important means of dealing with budget and manpower constraints. It is believed that AI/Robotics will be important technologies to alleviate these problems in the future. There are three types of applications for AI and Robotics technology that may: (l) help security personnel perform their tasks more effectively or efficiently, (2) perform tasks that security personnel would otherwise perform (free up people), and (3) perform tasks that cannot be performed by security personnel at this time. This paper discusses the various types of security applications that are presently being considered for the above areas and briefly describes a few examples of the application of this technology

  6. Le système d’identification automatique (AIS)

    Serry, Arnaud; Lévêque, Laurent


    Le système automatique d’identification (AIS) des navires est un outil destiné à accroitre la sécurité de la navigation et l’efficacité de la gestion du trafic maritime. Son utilisation renforce à la fois la sécurité et la sureté maritime. Ses apports sont indéniables malgré quelques carences et limites techniques. Cet article présente les apports et les utilisations de la technologie AIS à l’origine d’une importante manne d’informations riches pour l’étude et la compréhension des circulation...

  7. Research Reports: Hallucinogens and Dissociative Drugs

    ... dangerous behavior. Hallucinogens such as LSD, psilocybin, peyote, DMT, and ayahuasca cause emotions to swing wildly and ... Dissociative Drugs? How Do Hallucinogens (LSD, Psilocybin, Peyote, DMT, and Ayahuasca) Affect the Brain and Body? What ...

  8. Coulomb dissociation at nonrelativistic and relativistic energies

    The author studies the breakup of deuterons on nuclei in the framework of DWBA theories which are based on the spectator model. The discrepancies for heavy targets are explained by the mechanism of the Coulomb dissociation. (HSI)

  9. Direct thermal neutron capture

    We discuss the direct-capture theory pertaining to primary electric dipole (E1) transitions following slow-neutron capture. For light nuclides that we have studied (including 9Be, 12C, 13C, 24Mg, 25Mg, 26Mg, 32S, 33S, 34S, 40Ca, and 44Ca), estimates of direct-capture cross sections using optical-model potentials with physically realistic parameters, are in reasonable agreement with the data. Minor disagreements that exist are consistent with extrapolations to light nuclides of generally accepted formulations of compound-nucleus capture. We also discuss the channel-capture approximation which is, in general, a good representation of these cross sections in heavier nuclei particularly if the scattering lengths are not different from the corresponding potential radii. We also draw attention to cases where the use of this formula leads to inaccurate predictions. 9 refs., 1 fig., 2 tab

  10. Muon capture in hydrogen

    In this lecture I will mainly speak about the recent results obtained by the Saclay-CERN-Bologna (SCB) collaboration on the muon capture rate at rest in liquid hydrogen.In the first talk I shall first briefly remind the theoretical description of the capture process, then describe the experimental difficulties and procedures and finally present the results obtained. In the second talk I shall compare them to other capture experiments on the proton and present the informations that are provided by muon capture in hydrogen, especially for the PCAC hypothesis, the second class currents and the μ-e universality. Finally I shall present the possible muon capture experiments on the proton that could still be undertaken in order to improve our present knowledge of the subject

  11. Combining gas phase electron capture and IRMPD action spectroscopy to probe the electronic structure of a metastable reduced organometallic complex containing a non-innocent ligand.

    Katari, Madanakrishna; Payen de la Garanderie, Eleonore; Nicol, Edith; Steinmetz, Vincent; van der Rest, Guillaume; Carmichael, Duncan; Frison, Gilles


    Combining electron capture dissociation mass spectrometry and infrared multiple photon dissociation action spectroscopy allows the formation, selection and characterisation of reduced metal complexes containing non-innocent ligands. Zinc complexes containing diazafluorenone ligands have been studied and the localisation of the single electron on the metal atom in the mono-ligated complex has been demonstrated. PMID:26051020

  12. A tour of Machine Learning: an AI perspective

    Sebag, Michèle


    Machine Learning has been at the core of Artificial Intelligence since its inception. Many promises have been held, if one is to consider that Google is a living demonstration of AI. This paper presents a historical perspective on Machine Learning, describing how the emphasis was gradually shifted from logical to statis-tical induction, from induction to optimization, from the search of hypotheses to the search of representa-tions. The paper concludes with a discussion about the new frontier ...

  13. Parler français en algerie jujements et attitudes

    Belkaid, Nihal


    Après l'accession de l’Algérie à son indépendance en 1962 l'usage de langue français en Algérie a fait l'objet de nombreuse polémique et connotation négative par les arabophone détracteurs de la langues française

  14. Oil spills and AI: How to manage resources through simulation

    Today, in the Mediterranean theater of the Upper Tyrrhenian, the ecological risk involving oil installations is still quite high. This is due to the fact that valuable environmental and tourist areas exist together with large industrial and port structures; in particular, recent events have demonstrated the danger involving oil spills along the Ligurian coastline. This study proposes an approach to plan the operations that should be performed when accidents occur, based on the use of AI techniques

  15. RoboCup: A Challenge Problem for AI

    Kitano, Hiroaki; Asada, Minoru; Kuniyoshi, Yasuo; Noda, Itsuki; Osawa, Eiichi; Matsubara, Hitoshi


    The Robot World-Cup Soccer (RoboCup) is an attempt to foster AI and intelligent robotics research by providing a standard problem where a wide range of technologies can be integrated and examined. The first RoboCup competition will be held at the Fifteenth International Joint Conference on Artificial Intelligence in Nagoya, Japan. A robot team must actually perform a soccer game, incorporating various technologies, including design principles of autonomous agents, multiagent collaboration, st...

  16. Oligonucleotide-mediated gene editing of Apolipoprotein A-I.

    Disterer, P


    Apolipoprotein A-I (ApoA-I) is the major protein constituent of high density lipoprotein (HDL) and controls reverse cholesterol transport, an important process in preventing atherosclerosis. A natural point mutation, ApoA-lMiiano (ApoA-Im) enhances the atheroprotective potential of HDL. Here, I attempt to introduce this specific modification into the genome of mammalian cells using the gene therapy strategy of oligonucleotide-mediated gene editing. I showed successful APOA-I gene editing in r...

  17. Assessing an AI knowledge-base for asymptomatic liver diseases.

    Babic, A.; Mathiesen, U.; Hedin, K.; Bodemar, G.; Wigertz, O.


    Discovering not yet seen knowledge from clinical data is of importance in the field of asymptomatic liver diseases. Avoidance of liver biopsy which is used as the ultimate confirmation of diagnosis by making the decision based on relevant laboratory findings only, would be considered an essential support. The system based on Quinlan's ID3 algorithm was simple and efficient in extracting the sought knowledge. Basic principles of applying the AI systems are therefore described and complemented ...

  18. NewsFinder: Automating an AI News Service

    Eckroth, Joshua; The Ohio State University; Dong, Liang; Clemson University; Smith, Reid G.; Marathon Oil Corporation; Buchanan, Bruce G.; University of Pittsburgh


    NewsFinder automates the steps involved in finding, selecting, categorizing, and publishing news stories that meet relevance criteria for the Artificial Intelligence community. The software combines a broad search of online news sources with topic-specific trained models and heuristics. Since August 2010, the program has been used to operate the AI in the News service that is part of the AAAI AITopics website.

  19. A Novel Hybrid CNN-AIS Visual Pattern Recognition Engine

    Bhalla, Vandna; Chaudhury, Santanu; Jain, Arihant


    Machine learning methods are used today for most recognition problems. Convolutional Neural Networks (CNN) have time and again proved successful for many image processing tasks primarily for their architecture. In this paper we propose to apply CNN to small data sets like for example, personal albums or other similar environs where the size of training dataset is a limitation, within the framework of a proposed hybrid CNN-AIS model. We use Artificial Immune System Principles to enhance small ...


    Wolff, Jeremy J.; Laremore, Tatiana N.; BUSCH, ALEXANDER M.; Linhardt, Robert J.; Amster, I. Jonathan


    The structural characterization of glycosaminoglycans (GAG) oligosaccharides has been a longstanding challenge in the field of mass spectrometry. In this work, we present the application of electron detachment dissociation (EDD) Fourier transform mass spectrometry to the analysis of dermatan sulfate (DS) oligosaccharides up to 10 residues in length. The EDD mass spectra of DS oligosaccharides were compared to their infrared multiphoton dissociation (IRMPD) mass spectra. EDD produces more abun...

  1. Dissociation of ultracold molecules with Feshbach resonances

    Dürr, Stephan; Volz, Thomas; Rempe, Gerhard


    Ultracold molecules are associated from an atomic Bose-Einstein condensate by ramping a magnetic field across a Feshbach resonance. The reverse ramp dissociates the molecules. The kinetic energy released in the dissociation process is used to measure the widths of 4 Feshbach resonances in 87Rb. This method to determine the width works remarkably well for narrow resonances even in the presence of significant magnetic-field noise. In addition, a quasi-mono-energetic atomic wave is created by ju...

  2. Dissociated Prostate Regeneration under the Renal Capsule.

    Zong, Yang; Goldstein, Andrew S; Witte, Owen N


    Tissue recombination models are useful for studying cancer initiation, progression, and metastasis. They also provide an in vivo environment in which to investigate the functional role of stem cells in tissue repair. In this protocol, we describe in detail the dissociated prostate regeneration assay. Dissociated adult murine prostate cells are combined with embryonic urogenital sinus mesenchymal cells and implanted under the renal capsule. Morphological tissue structures with appropriate epithelial-stroma interactions are reconstituted in the grafts. PMID:26527760

  3. Compulsive symptoms in dissociative (conversion) disorder

    Agarwal, Arun Lata


    According to Mayer-Gross, Slater and Roth's classical textbook Clinical psychiatry, obsessive-compulsive symptoms are rarely seen in hysteria. The release of obsessive-compulsive symptoms is said to occur only in those who are constitutionally predisposed. In this context, the case of a young woman with dissociative (conversion) disorder, who presented with compulsive symptoms, is reported. In her case, the dissociative phenomena manifested as compulsive symptoms without concomitant predispos...

  4. Spontaneous exciton dissociation in carbon nanotubes

    Kumamoto, Y.; Yoshida, M.; Ishii, A; Yokoyama, A.; Shimada, T; Kato, Y. K.


    Simultaneous photoluminescence and photocurrent measurements on individual single-walled carbon nanotubes reveal spontaneous dissociation of excitons into free electron-hole pairs. Correlation of luminescence intensity and photocurrent shows that a significant fraction of excitons are dissociating during their relaxation into the lowest exciton state. Furthermore, the combination of optical and electrical signals also allows for extraction of the absorption cross section and the oscillator st...

  5. LUT observations of the mass-transferring binary AI Dra

    Liao, Wenping; Qian, Shengbang; Li, Linjia; Zhou, Xiao; Zhao, Ergang; Liu, Nianping


    Complete UV band light curve of the eclipsing binary AI Dra was observed with the Lunar-based Ultraviolet Telescope (LUT) in October 2014. It is very useful to adopt this continuous and uninterrupted light curve to determine physical and orbital parameters of the binary system. Photometric solutions of the spot model are obtained by using the W-D (Wilson and Devinney) method. It is confirmed that AI Dra is a semi-detached binary with secondary component filling its critical Roche lobe, which indicates that a mass transfer from the secondary component to the primary one should happen. Orbital period analysis based on all available eclipse times suggests a secular period increase and two cyclic variations. The secular period increase was interpreted by mass transfer from the secondary component to the primary one at a rate of 4.12 ×10^{-8}M_{⊙}/yr, which is in agreement with the photometric solutions. Two cyclic oscillations were due to light travel-time effect (LTTE) via the presence of two cool stellar companions in a near 2:1 mean-motion resonance. Both photometric solutions and orbital period analysis confirm that AI Dra is a mass-transferring binary, the massive primary is filling 69 % of its critical Roche lobe. After the primary evolves to fill the critical Roche lobe, the mass transfer will be reversed and the binary will evolve into a contact configuration.

  6. Absolute parameters for AI Phoenicis using WASP photometry

    Kirkby-Kent, J A; Serenelli, A M; Turner, O D; Evans, D F; Anderson, D R; Hellier, C; West, R G


    AI Phe is a double-lined, detached binary, in which a K-type sub-giant star totally eclipses its main-sequence companion every 24.6 days. This configuration makes AI Phe ideal for testing stellar evolutionary models. Difficulties in obtaining a complete lightcurve mean the precision of existing radii measurements could be improved. Our aim is to improve the precision of the radius measurements for the stars in AI Phe using high-precision photometry from WASP, and use these improved radius measurements together with estimates of the masses, temperatures and composition of the stars to place constraints on the mixing length, helium abundance and age of the system. A best-fit ebop model is used to obtain lightcurve parameters, with their standard errors calculated using a prayer-bead algorithm. These were combined with previously published spectroscopic orbit results, to obtain masses and radii. A Bayesian method is used to estimate the age of the system for model grids with different mixing lengths and helium a...

  7. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    McManus, John W.; Goodrich, Kenneth H.


    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  8. The AI Bus architecture for distributed knowledge-based systems

    Schultz, Roger D.; Stobie, Iain


    The AI Bus architecture is layered, distributed object oriented framework developed to support the requirements of advanced technology programs for an order of magnitude improvement in software costs. The consequent need for highly autonomous computer systems, adaptable to new technology advances over a long lifespan, led to the design of an open architecture and toolbox for building large scale, robust, production quality systems. The AI Bus accommodates a mix of knowledge based and conventional components, running on heterogeneous, distributed real world and testbed environment. The concepts and design is described of the AI Bus architecture and its current implementation status as a Unix C++ library or reusable objects. Each high level semiautonomous agent process consists of a number of knowledge sources together with interagent communication mechanisms based on shared blackboards and message passing acquaintances. Standard interfaces and protocols are followed for combining and validating subsystems. Dynamic probes or demons provide an event driven means for providing active objects with shared access to resources, and each other, while not violating their security.

  9. Extracting uranium from seawater: Promising AI series adsorbents

    A series of adsorbent (AI10 through AI17) were successfully developed at ORNL by radiation induced graft polymerization (RIGP) of acrylonitrile (AN) and vinylphosphonic acid (VPA) (at different mole/mole ratios) onto high surface area polyethylene fiber, with higher degree of grafting which ranges from 110 300%. The grafted nitrile groups were converted to amidoxime groups by reaction with 10 wt% hydroxylamine at 80 C for 72 hours. The amidoximated adsorbents were then conditioned with 0.44M KOH at 80 C followed by screening at ORNL with simulated seawater spiked with 8 ppm uranium. Uranium adsorption capacity in simulated seawater screening ranged from 171-187 g-U/kg-ads irrespective of %DOG. The performance of the adsorbents for uranium adsorption in natural seawater was also carried out using flow-through-column at Pacific Northwest National Laboratory (PNNL). The three hours KOH conditioning was better for higher uranium uptake than one hour. The adsorbent AI11 containing AN and VPA at the mole ration of 3.52, emerged as the potential candidate for higher uranium adsorption (3.35 g-U/Kg-ads.) after 56 days of exposure in the seawater in the flow-through-column. The rate vanadium adsorption over uranium was linearly increased throughout the 56 days exposure. The total vanadium uptake was ~5 times over uranium after 56 days

  10. Excited State Formation in Electron Capture by Slow Multiply Charged Ions

    Translational energy spectroscopy (TES) has been used to study one-electron capture by H and He-like ions of C, N and O in both H and H2 at energies below 1 keV amu-1. Similar measurements have been carried out for He2+ ions in the hydrocarbons CH4, C2H4, C2H6 and H2O at energies within the range 250-2000 eV amu-1. One-electron capture by O6+ ions in H2O, CO2 and CH4 and by C4+ ions in CH4 have also been studied in the range 200-1500 eV amu-1. The main excited product states have been identified, their relative importance assessed and, in some cases, cross-sections determined. In the molecular targets, contributions to one-electron capture from non-dissociative and dissociative mechanisms as well as from two-electron capture into autoionizing states has also been determined. In all cases, the highly selective nature of the electron capture process is confirmed even in the case of molecules with many possible fragmentation channels involving a wide range of energy defects. In the case of H, the main product channels are well predicted by reaction windows calculated using a Landau-Zener approach. However, the same approach applied to molecules, where both non-dissociative and dissociative mechanisms are significant, is found to be of limited use. (author)