International Nuclear Information System (INIS)
Moore, J.R.
1988-03-01
A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs
Medical applications of californium-252
International Nuclear Information System (INIS)
Oliver, G.D. Jr.
1975-01-01
Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)
International Nuclear Information System (INIS)
Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.
1983-01-01
Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed
Californium-252 progress, report No. 7, April 1971
Energy Technology Data Exchange (ETDEWEB)
1971-12-31
This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.
Radiography using californium-252 neutron sources
International Nuclear Information System (INIS)
Ray, J.W.
1975-01-01
The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)
Historical review of californium-252 discovery and development
International Nuclear Information System (INIS)
Stoddard, D.H.
1985-01-01
This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed
International Nuclear Information System (INIS)
Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.
2008-07-01
The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)
Californium production at the transuranium processing plant
International Nuclear Information System (INIS)
King, L.J.
1976-01-01
The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material
Californium-252 sales and loans at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
King, L.J.
1987-01-01
The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point
Fabrication of californium-252 sources in the United Kingdom
International Nuclear Information System (INIS)
Ainsworth, A.; Brady, M.W.; Thornett, W.H.
1975-01-01
The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)
Biomedical neutron research at the Californium User Facility for neutron science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1997-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy
Biomedical neutron research at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Byrne, T.E.; Miller, L.F.
1998-01-01
The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)
Californium Multiplier. Part I. Design for neutron radiography
International Nuclear Information System (INIS)
Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.
1982-01-01
The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX
Californium-252 radiotherapy sources for interstitial afterloading
International Nuclear Information System (INIS)
Permar, P.H.; Walker, V.W.
1976-01-01
Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute
Uranium standards for Californium Shuffler
International Nuclear Information System (INIS)
Gibbs, A.; Boynton, S.P.
1978-10-01
The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis
Californium-252: a remarkable versatile radioisotope
International Nuclear Information System (INIS)
Osborne-Lee, I.W.; Alexander, C.W.
1995-01-01
A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein
Californium-252: a remarkable versatile radioisotope
Energy Technology Data Exchange (ETDEWEB)
Osborne-Lee, I.W.; Alexander, C.W.
1995-10-10
A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.
17 CFR 248.103-248.119 - [Reserved
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false [Reserved] 248.103-248.119 Section 248.103-248.119 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing §§ 248.103-248.119 [Reserved] ...
International Nuclear Information System (INIS)
Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.
2011-01-01
Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)
Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory
International Nuclear Information System (INIS)
Martin, R.C.; Laxson, R.R.; Knauer, J.B.
1996-01-01
The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests
International Nuclear Information System (INIS)
1974-01-01
The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September
Production, Distribution, and Applications of Californium-252 Neutron Sources
International Nuclear Information System (INIS)
Balo, P.A.; Knauer, J.B.; Martin, R.C.
1999-01-01
The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations
International Nuclear Information System (INIS)
Wallace, C.R.
1995-01-01
In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather
International Nuclear Information System (INIS)
1975-01-01
This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)
X-ray-diffraction study of californium metal to 16 GPa
International Nuclear Information System (INIS)
Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.
1983-01-01
The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa
Study of the shielding for spontaneous fission sources of Californium-252
International Nuclear Information System (INIS)
Davila R, I.
1991-06-01
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
International Nuclear Information System (INIS)
Landolt, R.R.; Hem, S.L.
1983-01-01
A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well
Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis
International Nuclear Information System (INIS)
Zimmer, W.H.
1976-08-01
The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized
Californium oxygen system for 1.50 < O/Cf < 1.72
International Nuclear Information System (INIS)
Turcotte, R.P.; Haire, R.G.
1975-01-01
The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 248.3 Section 248.3 Agriculture... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration. (a) Delegation to FNS. Within the Department, FNS shall act on behalf of the Department in the administration of...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Structures. 248.6 Section 248.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER INDIAN IN-LIEU FISHING SITES § 248.6 Structures. Dwellings, camping facilities, and other structures such as fish drying facilities...
Assessment of the neutron component in a neutron-gamma field of a californium-252 source
International Nuclear Information System (INIS)
Tetteh, G.K.
1978-12-01
Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%
Measurements of integral cross sections in the californium-252 fission neutron spectrum
International Nuclear Information System (INIS)
Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.
1977-01-01
In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed
International Nuclear Information System (INIS)
Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.
1983-01-01
A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)
International Nuclear Information System (INIS)
Muhammad Fakhrurreza; Kusminanto; Y Sardjono
2014-01-01
In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)
Calibration of a Modified Californium Shuffler
International Nuclear Information System (INIS)
Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.
1995-01-01
A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers
7 CFR 248.11 - Financial management system.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial status...
7 CFR 58.248 - Nonfat dry milk.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an official...
Prompt neutron spectrum of the spontaneous fission of californium-252
International Nuclear Information System (INIS)
Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.
1976-01-01
The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references
International Nuclear Information System (INIS)
Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.
1980-01-01
An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations
Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.
1990-01-01
The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined
Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)
International Nuclear Information System (INIS)
Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.
1990-01-01
Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined
A californium-252 source for radiobiological studies at Hiroshima University
International Nuclear Information System (INIS)
Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo
1987-01-01
A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)
7 CFR 248.9 - Nutrition education.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and may...
7 CFR 248.1 - General purpose and scope.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose and scope. 248.1 Section 248.1... AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.1 General purpose and scope. This part announces regulations under which the Secretary of Agriculture shall carry...
International Nuclear Information System (INIS)
Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.
1991-01-01
A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false FMNP income. 248.13 Section 248.13 Agriculture... FMNP income. Program income means gross income the State agency earns from grant supported activities... property. The State agency shall retain Program income earned during the agreement period and use it for...
14 CFR 248.2 - Filing of audit reports.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing of audit reports. 248.2 Section 248...) ECONOMIC REGULATIONS SUBMISSION OF AUDIT REPORTS § 248.2 Filing of audit reports. (a) Whenever any air... Information, in duplicate, a special report consisting of a true and complete copy of the audit report...
R248Q mutation--Beyond p53-DNA binding.
Ng, Jeremy W K; Lama, Dilraj; Lukman, Suryani; Lane, David P; Verma, Chandra S; Sim, Adelene Y L
2015-12-01
R248 in the DNA binding domain (DBD) of p53 interacts directly with the minor groove of DNA. Earlier nuclear magnetic resonance (NMR) studies indicated that the R248Q mutation resulted in conformation changes in parts of DBD far from the mutation site. However, how information propagates from the mutation site to the rest of the DBD is still not well understood. We performed a series of all-atom molecular dynamics (MD) simulations to dissect sterics and charge effects of R248 on p53-DBD conformation: (i) wild-type p53 DBD; (ii) p53 DBD with an electrically neutral arginine side-chain; (iii) p53 DBD with R248A; (iv) p53 DBD with R248W; and (v) p53 DBD with R248Q. Our results agree well with experimental observations of global conformational changes induced by the R248Q mutation. Our simulations suggest that both charge- and sterics are important in the dynamics of the loop (L3) where the mutation resides. We show that helix 2 (H2) dynamics is altered as a result of a change in the hydrogen bonding partner of D281. In turn, neighboring L1 dynamics is altered: in mutants, L1 predominantly adopts the recessed conformation and is unable to interact with the major groove of DNA. We focused our attention the R248Q mutant that is commonly found in a wide range of cancer and observed changes at the zinc-binding pocket that might account for the dominant negative effects of R248Q. Furthermore, in our simulations, the S6/S7 turn was more frequently solvent exposed in R248Q, suggesting that there is a greater tendency of R248Q to partially unfold and possibly lead to an increased aggregation propensity. Finally, based on the observations made in our simulations, we propose strategies for the rescue of R248Q mutants. © 2015 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)
1996-03-01
Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.
Czech Academy of Sciences Publication Activity Database
Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.
2005-01-01
Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005
Energy Technology Data Exchange (ETDEWEB)
Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)
2016-09-15
Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.
31 CFR 248.4 - Undertaking of indemnity.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Undertaking of indemnity. 248.4 Section 248.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... in the circumstances set forth below, a corporate surety authorized by the Secretary of the Treasury...
Energy Technology Data Exchange (ETDEWEB)
Davila R, I
1991-06-15
A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)
24 CFR 248.223 - Alternative State strategy.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low income...
International Nuclear Information System (INIS)
Payne, G.F.; Peterson, J.R.
1987-01-01
It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species
24 CFR 248.173 - Resident homeownership program.
2010-04-01
..., consistent with paragraph (f) of this section; (x) How the marketing of currently vacant units and units... 50 percent of such proceeds shall be returned to the Commissioner for use under §§ 248.157 and 248... homeowner under the homeownership program approved under this section shall be paid to the HOME Investment...
Experimental studies on californium bioavailability to marine benthic invertebrates
International Nuclear Information System (INIS)
Fowler, S.W.; Carvalho, F.P.; Aston, S.R.
1986-01-01
252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)
17 CFR 248.16 - Protection of Fair Credit Reporting Act.
2010-04-01
... Reporting Act. 248.16 Section 248.16 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.16 Protection of Fair Credit...
17 CFR 248.5 - Annual privacy notice to customers required.
2010-04-01
... customers required. 248.5 Section 248.5 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Safeguarding Personal Information Privacy and Opt Out Notices § 248.5 Annual privacy notice to customers required. (a)(1) General rule. You must provide a clear and conspicuous notice to customers that accurately...
7 CFR 248.21 - Procurement and property management.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Procurement and property management. 248.21 Section... Provisions § 248.21 Procurement and property management. (a) Requirements. State agencies shall comply with the requirements of 7 CFR part 3016 for procurement of supplies, equipment and other services with...
31 CFR 248.6 - Recovery of original check.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recovery of original check. 248.6... § 248.6 Recovery of original check. (a) If the claimant recovers an original check after he has... or agency concerned regarding the negotiability of such original check. (b) In the event the...
17 CFR 248.18 - Effective date; transition rule.
2010-04-01
... Safeguarding Personal Information Relation to Other Laws; Effective Date § 248.18 Effective date; transition... customers on the compliance date. By July 1, 2001, you must have provided an initial notice, as required by § 248.4, to consumers who are your customers on July 1, 2001. (2) Example. You provide an initial notice...
International Nuclear Information System (INIS)
Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong
2011-01-01
Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.
Teratogenic effect of Californium-252 irradiation in rats
International Nuclear Information System (INIS)
Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro
1989-01-01
The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)
Role of CD248 as a potential severity marker in idiopathic pulmonary fibrosis.
Bartis, Domokos; Crowley, Louise E; D'Souza, Vijay K; Borthwick, Lee; Fisher, Andrew J; Croft, Adam P; Pongrácz, Judit E; Thompson, Richard; Langman, Gerald; Buckley, Christopher D; Thickett, David R
2016-04-14
CD248 or Endosialin is a transmembrane molecule expressed in stromal cells binding to extracellular matrix (ECM) components. It has been previously implicated in kidney fibrosis, rheumatoid arthritis as well as in tumour-stromal interactions. This study investigates the role of CD248 in the pathogenesis of fibrotic diseases in Idiopathic Pulmonary Fibrosis (IPF). CD248 quantitative immunohistochemistry (IHC) was performed on lung samples from 22 IPF patients and its expression was assayed in cultured pulmonary fibroblasts and epithelial cells. Effects of CD248 silencing was evaluated on fibroblast proliferation and myofibroblast differentiation. IHC revealed strong CD248 expression in mesenchymal cells of normal lung structures such as pleura and adventitia but not in epithelium. Fibrotic areas showed markedly stronger staining than unaffected lung tissue. The extent of CD248 staining showed a significant negative correlation to lung function parameters FEV1, FVC, TLC, and TLCO (r2 > 0 · 35, p < 0 · 01). CD248 protein levels were significantly greater in IPF-derived lung fibroblasts vs normal lung fibroblasts (p < 0 · 01) and CD248 silencing significantly reduced the proliferation of lung fibroblasts, but did not affected myofibroblast differentiation. We conclude that CD248 overexpression is possibly involved in the pathogenesis of IPF and it has potential as a disease severity marker. Given that CD248 ligands are collagen type I, IV and fibronectin, we hypothesise that CD248 signalling represents a novel matrix-fibroblast interaction that may be a potential therapeutic target in IPF.
Energy Technology Data Exchange (ETDEWEB)
Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.
2011-02-01
The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.
International Nuclear Information System (INIS)
Gourgiotis, A.; Isnard, H.; Nonell, A.; Aubert, M.; Stadelmann, G.; Dupont, E.; AlMahamid, I.; Tiang, G.; Rao, L.; Lukens, W.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.
2013-01-01
The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248 Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios in the 248 Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249 Bk/ 248 Cm and 249 Cf/ 248 Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)
Energy Technology Data Exchange (ETDEWEB)
Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G
1976-07-01
..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.
2010-04-01
... S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.120 Definitions. As used in... Securities and Exchange Commission. (e) Company means any corporation, limited liability company, business... company means the power to exercise a controlling influence over the management or policies of a company...
Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K
2017-09-01
Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is
17 CFR 248.4 - Initial privacy notice to consumers required.
2010-04-01
... later than when you establish a customer relationship, except as provided in paragraph (e) of this... by §§ 248.14 and 248.15; and (2) You do not have a customer relationship with the consumer. (c) When you establish a customer relationship—(1) General rule. You establish a customer relationship when you...
Neutron activation analysis at the Californium User Facility for Neutron Science
International Nuclear Information System (INIS)
Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.
1997-12-01
The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis
Application of californium-252 neutron sources for analytical chemistry
International Nuclear Information System (INIS)
Ishii, Daido
1976-01-01
The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)
International Nuclear Information System (INIS)
Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.
1985-01-01
Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated
Reference: 248 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available 248 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16045474i Singh Sunil Kumar... the animal exostosins. 3 384-97 16045474 2005 Aug The Plant journal Eland Cathlene|Harholt Jesper|Marchant Alan|Scheller Henrik Vibe|Singh Sunil Kumar
17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.
2010-04-01
... include marketing of your own products or services or marketing of financial products or services offered... requirements for service providers and joint marketing. 248.13 Section 248.13 Commodity and Securities... Consumer Financial Information and Safeguarding Personal Information Exceptions § 248.13 Exception to opt...
Photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm
Tang, Yongxin; Zhu, Lei
2005-06-01
We have studied the photolysis of butenedial at 193, 248, 280, 308, 351, 400, and 450 nm by using laser photolysis combined with cavity ring-down spectroscopy. The HCO radical is a photodissociation product at 193 and 248 nm. The corresponding HCO quantum yields are 0.55 ± 0.07 and 0.12 ± 0.01, independent of butenedial pressure and nitrogen buffer gas pressure. Absorption cross-sections of butenedial are (6.88 ± 0.39) × 10 -18 and (3.62 ± 0.69) × 10 -19 cm 2 at 193 and 248 nm. The end-products from the photolysis of butenedial at 193, 248, 308, and 351 nm were measured by FTIR. Acrolein and 3H-furan-2-one were observed and their yields have been estimated.
International Nuclear Information System (INIS)
Sharma, S.
1986-01-01
A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields
Kr and Xe isotopes from spontaneous fission of 248Cm and 250Cf
International Nuclear Information System (INIS)
Srinivasan, B.
1980-01-01
Relative yields of Kr and Xe isotopes from the spontaneous fission of 248 Cm and 250 Cf have been determined mass spectrometrically. The yields are as follows: 83 Kr/ 84 Kr/ 85 Kr/ 86 Kr = 0.223/0.458/0.596/ identical 1.00 and 0.306/0.582/0.793/ identical 1.00; 131 Xe/ 134 Xe/ 136 Xe = 0.486/0.819/1.075 identical 1.00 and 0.343/0.506/0.851/ identical 1.00 from 248 Cm and 250 Cf, respectively. The Xe yields from 248 Cm agree with an earlier determination by Leich et al. Neither of these yield patterns matches that of fissiogenic Kr and Xe in carbonaceous chondrites and hence 248 Cm and 250 Cf are ruled out as progenitors of the meteoritic Kr and Xe. In general, none of the spontaneously fissioning nuclides of actinide elements can be identified as a possible progenitor. Even the mixtures of actinides, including a combination of 248 Cm and 250 Cm, are unsuitable. The origin of anomalous Kr and Xe in carbonaceous chondrites must then be traced either to the spontaneous fission of a superheavy element or to peculiarities in specific nucleosynthetic reactions. (orig.)
48 CFR 52.248-1 - Value Engineering.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering. 52.248... Value Engineering. As prescribed in 48.201, insert the following clause: Value Engineering (OCT 2010) (a) General. The Contractor is encouraged to develop, prepare, and submit value engineering change proposals...
17 CFR 248.12 - Limits on sharing account number information for marketing purposes.
2010-04-01
... account number information for marketing purposes. (a) General prohibition on disclosure of account... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Limits on sharing account number information for marketing purposes. 248.12 Section 248.12 Commodity and Securities Exchanges...
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-03-01
During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix
17 CFR 248.101 - Purpose and scope.
2010-04-01
...) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.101 Purpose and scope. (a...”), regulates the use of consumer information received from an affiliate to make marketing solicitations. (b) Scope. This subpart applies to any broker or dealer other than a notice-registered broker or dealer, to...
Energy Technology Data Exchange (ETDEWEB)
Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-07-01
This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.
Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252
International Nuclear Information System (INIS)
Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.
1975-01-01
Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr
International Nuclear Information System (INIS)
Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.
1979-01-01
With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women
Directory of Open Access Journals (Sweden)
Clayton Dickerson
2013-02-01
Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.
48 CFR 52.248-2 - Value Engineering-Architect-Engineer.
2010-10-01
... cycle cost consistent with required performance, reliability, quality, and safety. Value engineering... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering... Clauses 52.248-2 Value Engineering—Architect-Engineer. As prescribed in 48.201(f), insert the following...
Long-term effects of an intracavitary treatment with californium-252 on normal tissue
International Nuclear Information System (INIS)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra
Energy Technology Data Exchange (ETDEWEB)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1976-03-01
During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.
Actinide production in the reaction of heavy ions with curium-248
International Nuclear Information System (INIS)
Moody, K.J.
1983-07-01
Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248 Cm with 18 O, 86 Kr and 136 Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48 Ca and 238 U bombardments of 248 Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136 Xe and 238 U the new species 248 Am, 249 Am and 247 Pu should be produced with large cross sections from a 248 Cm target. A preliminary, unsuccessful attempt to isolate 247 Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251 Bk decay, necessary for calculating the 251 Bk cross section, are also determined
2010-04-01
... customer records and information; disposal of consumer report information. 248.30 Section 248.30 Commodity... of consumer report information. (a) Every broker, dealer, and investment company, and every... any customer. (b) Disposal of consumer report information and records—(1) Definitions (i) Consumer...
42 CFR 403.248 - Administrative review of CMS determinations.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Administrative review of CMS determinations. 403... Certification Program: General Provisions § 403.248 Administrative review of CMS determinations. (a) This section provides for administrative review if CMS determines— (1) Not to certify a policy; or (2) That a...
17 CFR 248.127 - Renewal of opt out elections.
2010-04-01
... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i) The....122(b). (3) Affiliates who may provide the notice. The notice required by this paragraph must be...
17 CFR 248.126 - Delivery of opt out notices.
2010-04-01
... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.126 Delivery... Internet Web site at which the consumer obtained a product or service electronically and requires the... by e-mail from the affiliate providing the notice; or (3) Posts the notice on an Internet Web site...
Feasibility and market potential of protein determination of wheat using californium-252
International Nuclear Information System (INIS)
Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.
1976-01-01
To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit
International Nuclear Information System (INIS)
Rothe, Erhard W; Manke, Charles W; Piparia, Reema; Baird, Ronald J
2008-01-01
Arrays of nanostructures are made starting with a template of close-packed, polystyrene spheres on a silicon surface. The spheres are either 1.091 or 2.99 μm in diameter (d) and are of polystyrene (PS). They are irradiated with a pulse of either 308 or 248 nm light to which they are transparent and semitransparent, respectively. A transparent sphere with d = 1.091 μm diameter concentrates incident light onto a small substrate area. As has been previously reported, that creates silicon nanobumps that rise from circular craters. At 248 nm and d = 2.99 μm, the light energy is mainly absorbed, destroys the sphere, and leaves a shrunken mass (typically about 500 nm wide and 100 nm high) of organic material that is probably polystyrene and its thermal degradation products. At 248 nm and d = 1.091 μm, the residual organic structures are on the order of 300 nm wide and 100 nm high. A distinctive feature is that these organic structures are connected by filaments that are on the order of 50 nm wide and 10 nm high. Filaments form because the close-packed PS spheres expand into each other during the early part of the laser pulse, and then, as the main structures shrink, their viscoelasticity leads to threads between them. Our results with 248 nm and d = 1.091 μm differ from those described by Huang et al with 248 nm and d = 1.0 μm. Future studies might include the further effect of wavelength and fluence upon the process as well the use of other materials and the replacement of nanospheres by other focusing shapes, such as ellipsoids or rods
International Nuclear Information System (INIS)
Cardoso, Antonio
1976-01-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene
Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan
2009-01-01
Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…
17 CFR 248.122 - Scope and duration of opt out.
2010-04-01
... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... information received from another affiliate as described in the notice to make marketing solicitations to the consumer. (2) Continuing relationship—(i) In general. If the consumer establishes a continuing relationship...
17 CFR 248.121 - Affiliate marketing opt out and exceptions.
2010-04-01
... business relationship with the consumer. (b) Making marketing solicitations—(1) In general. For purposes of... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Affiliate marketing opt out... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.121...
2010-07-01
... following solid and liquid wastes and discharges information and cooling water intake information must... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What solid and liquid wastes and discharges information and cooling water intake information must accompany the DPP or DOCD? 250.248 Section 250.248...
17 CFR 248.128 - Effective date, compliance date, and prospective application.
2010-04-01
... Affiliate Marketing § 248.128 Effective date, compliance date, and prospective application. (a) Effective date. This subpart is effective September 10, 2009. (b) Mandatory compliance date. Compliance with this... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Effective date, compliance...
17 CFR 248.11 - Limits on redisclosure and reuse of information.
2010-04-01
... Safeguarding Personal Information Limits on Disclosures § 248.11 Limits on redisclosure and reuse of... customer list from a nonaffiliated financial institution in order to provide account-processing services.... (2) Example. If you obtain a customer list from a nonaffiliated financial institution outside of the...
Actinide production from xenon bombardments of curium-248
International Nuclear Information System (INIS)
Welch, R.B.
1985-01-01
Production cross sections for many actinide nuclides formed in the reaction of 129 Xe and 132 Xe with 248 Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136 Xe + 248 Cm reaction at a similar energy. When compared to the reaction with 136 Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129 Xe, 132 Xe, and 136 Xe with 197 Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions
SULFUR- AND SILICON-BEARING MOLECULES IN PLANETARY NEBULAE: THE CASE OF M2-48
Energy Technology Data Exchange (ETDEWEB)
Edwards, J. L.; Ziurys, L. M., E-mail: lziurys@email.arizona.edu [Department of Chemistry, The University of Arizona, P.O. Box 210041, Tucson, AZ 85721 (United States)
2014-10-20
Molecular-line observations of the bipolar planetary nebula (PN) M2-48 have been conducted using the Sub-Millimeter Telescope and the 12 m antenna of the Arizona Radio Observatory at 1, 2, and 3 mm. M2-48 is estimated to be ∼4800 yr old, midway through the PN evolutionary track. SiO and SO{sub 2} were detected in this source—the first identification of either molecule in a PN. CN, HCN, HNC, CS, SO, HCO{sup +}, N{sub 2}H{sup +}, and several {sup 13}C isotopologues such as {sup 13}CN, H{sup 13}CN, and H{sup 13}CO{sup +} were also observed toward this object. A radiative transfer analysis of multiple SiO transitions indicates a gas kinetic temperature of T {sub K} ∼ 55 K and a density of n(H{sub 2}) ∼ 9 × 10{sup 5} cm{sup –3} in M2-48, in agreement with previous CS and CO modeling. After CO, CN, and SO were found to be the most prevalent molecules in this nebula, with fractional abundances, relative to H{sub 2}, of f ∼ 3.8 × 10{sup –7} and 2.4 × 10{sup –7}, respectively. SO{sub 2} and HCN are also abundant, with f ∼ 1.2 × 10{sup –7}, indicating an [SO]/[SO{sub 2}] ratio of ∼2. Relatively high ion abundances were measured in M2-48 as well, with f ∼ 10{sup –7} for both HCO{sup +} and N{sub 2}H{sup +}. An [HCN]/[HNC] ratio of ∼2 was determined, as typically observed in other PNe, independent of age. The high abundances of SO and SO{sub 2}, along with the presence of SiO with f ∼ 2.9 × 10{sup –8}, suggest O/C > 1 in this source; furthermore, the prevalence of CN and N{sub 2}H{sup +} indicates nitrogen enrichment. The {sup 12}C/{sup 13}C ratio of ∼3 in the nebula was also established. These factors indicate hot-bottom burning occurred in the progenitor star of M2-48, suggesting an initial mass > 4 M {sub ☉}.
Directory of Open Access Journals (Sweden)
Marie S Hasemann
Full Text Available BACKGROUND: Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein α (C/EBPα is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPα is regulated on several levels including gene expression, alternative translation, protein interactions and posttranslational modifications, such as phosphorylation. In particular, the phosphorylation of serine 248 of the transactivation domain has been shown to be of crucial importance for granulocytic differentiation of 32Dcl3 cells in vitro. METHODOLOGY/PRINCIPAL FINDINGS: Here, we use mouse genetics to investigate the significance of C/EBPα serine 248 in vivo through the construction and analysis of Cebpa(S248A/S248A knock-in mice. Surprisingly, 8-week old Cebpa(S248A/S248A mice display normal steady-state hematopoiesis including unaltered development of mature myeloid cells. However, over time some of the animals develop a hematopoietic disorder with accumulation of multipotent, megakaryocytic and erythroid progenitor cells and a mild impairment of differentiation along the granulocytic-monocytic lineage. Furthermore, BM cells from Cebpa(S248A/S248A animals display a competitive advantage compared to wild type cells in a transplantation assay. CONCLUSIONS/SIGNIFICANCE: Taken together, our data shows that the substitution of C/EBPα serine 248 to alanine favors the selection of the megakaryocytic/erythroid lineage over the monocytic/granulocytic compartment in old mice and suggests that S248 phosphorylation may be required to maintain proper hematopoietic homeostasis in response to
Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine; Theilgaard-Mönch, Kim; Pedersen, Thomas Å; Nerlov, Claus; Porse, Bo T
2012-01-01
Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein α (C/EBPα) is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPα is regulated on several levels including gene expression, alternative translation, protein interactions and posttranslational modifications, such as phosphorylation. In particular, the phosphorylation of serine 248 of the transactivation domain has been shown to be of crucial importance for granulocytic differentiation of 32Dcl3 cells in vitro. Here, we use mouse genetics to investigate the significance of C/EBPα serine 248 in vivo through the construction and analysis of Cebpa(S248A/S248A) knock-in mice. Surprisingly, 8-week old Cebpa(S248A/S248A) mice display normal steady-state hematopoiesis including unaltered development of mature myeloid cells. However, over time some of the animals develop a hematopoietic disorder with accumulation of multipotent, megakaryocytic and erythroid progenitor cells and a mild impairment of differentiation along the granulocytic-monocytic lineage. Furthermore, BM cells from Cebpa(S248A/S248A) animals display a competitive advantage compared to wild type cells in a transplantation assay. Taken together, our data shows that the substitution of C/EBPα serine 248 to alanine favors the selection of the megakaryocytic/erythroid lineage over the monocytic/granulocytic compartment in old mice and suggests that S248 phosphorylation may be required to maintain proper hematopoietic homeostasis in response to changes in the wiring of cellular signalling networks. More broadly, the marked differences
Schuring, Ron P.; Hamann, Lutz; Faber, William R.; Pahan, David; Richardus, Jan Hendrik; Schumann, Ralf R.; Oskam, Linda
2009-01-01
We investigated the association between a polymorphism of a key innate immunity receptor, Toll-like receptor 1 (TLR1) N248S, and susceptibility to leprosy and its clinical presentation. TLR1 N248S has been shown elsewhere to diminish TLR1 signaling and subsequent leprosy disease. The homozygous
17 CFR 248.125 - Reasonable and simple methods of opting out.
2010-04-01
... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery of...
Evaluation of neutron cross sections for 244Cm, 246Cm, and 248Cm
International Nuclear Information System (INIS)
Benjamin, R.W.; McCrosson, F.J.; Gettys, W.E.
1977-01-01
An evaluation of neutron cross sections for 244 246 248 Cm using the ENDF/B format is presented. Primary data input included differential measurements, integral measurements, nuclear model calculations, and reactor production experience
Evidence for stepwise dissociation dynamics in acetone at 248 and 193 nm
North, Simon W.; Blank, David A.; Gezelter, J. Daniel; Longfellow, Cheryl A.; Lee, Yuan T.
1995-03-01
The technique of molecular beam photofragment translational spectroscopy has been used to study the dissociation of acetone following S1←S0 (248 nm) and S2←S0 (193 nm) excitation. Excitation at 248 nm resulted in the production of CH3 and CH3CO with 14.2±1.0 kcal/mole on average of the available energy appearing as translation of the photofragments. Comparison of the measured with values reported at 266 nm suggest that the energy partitioning is dominated by the exit barrier caused by an avoided crossing on the potential energy surface. A substantial fraction (30±4%) of the nascent acetyl radicals from the primary dissociation contain sufficient energy to undergo spontaneous secondary decomposition. From the onset of the truncation of the CH3CO P(ET) a threshold of 17.8±3.0 kcal/mole for the dissociation of the acetyl radical has been determined in agreement with recent results on the photodissociation of acetyl chloride. The translational energy release in the dissociation of CH3CO closely matches the experimentally determined exit barrier. At 193 nm the only observed dissociation pathway was the formation of two methyl radicals and carbon monoxide. On average ˜38% of the available energy is found in product translation suggesting that significant internal energy resides in the nascent CH3 fragments consistent with the results of Hall et al. [J. Chem. Phys. 94, 4182 (1991)]. We conclude that the dynamics and energy partitioning for dissociation at 193 nm is similar to that at 248 nm.
Stable formation of ultrahigh power-density 248 nm channels in Xe cluster targets
Energy Technology Data Exchange (ETDEWEB)
Borisov, Alex B.; Racz, Ervin; Khan, Shahab F.; Poopalasingam, Sankar; McCorkindale, John C.; Boguta, John; Longworth, James W.; Rhodes, Charles K. [Laboratory for X-ray Microimaging and Bioinformatics, Department of Physics, University of Illinois at Chicago, Chicago, IL 60607-7059 (United States); KFKI Research Institute for Particle and Nuclear Physics, EURATOM Association, P.O. Box 49, 1525 Budapest (Hungary)
2012-07-11
The optimization of relativistic and ponderomotive self-channeling of ultra-powerful 248 nm laser pulses launched in underdense plasmas with an appropriate longitudinal gradient in the electron density profile located at the initial stage of the self-channeling leads to (1) stable channel formation and (2) highly efficient power compression producing power densities in the 10{sup 19}-10{sup 20} W/cm{sup 3} range. The comparison of theoretical studies with experimental results involving the correlation of (a) Thomson images of the electron density with (b) x-ray images of the channel morphology demonstrates that more than 90% of the incident 248 nm power can be trapped in stable channels and that this stable propagation can be extended to power levels significantly exceeding the critical power of the self-channeling process.
Branching ratios of α-decay to ground and excited states of Fm, Cf, Cm and Pu
Hassanabadi, H.; Hosseini, S. S.
2018-06-01
We use the well-known Wentzel-Kramers-Brillouin (WKB) barrier penetration probability to calculate α-decay branching ratios for ground and excited states of heavy even-even nuclei of Fermium (248-254Fm), Californium (244-252Cf), Curium (238-248Cm) and Plutonium (234-244Pu) with 94 ≤Zp ≤100. We obtained the branching ratios for the excited states of daughter nucleus by the α-decay energy (Qα), the angular momentum of α-particle (ℓα), and the excitation probability of the daughter nucleus with the excitation energy of state ℓ in the daughter nucleus (i.e. Eℓ*). α-Decay half-lives have been evaluated by using the proximity potential model for the heavy even-even nuclei. We have reported the half-lives and compared the results with the experimental data. The theoretical branching ratios of α-transitions in our calculation are found to agree with the available experimental data well for 0+→ 0+, 0+→ 2+, 0+→ 4+, 0+→ 6+ and 0+ → 8+α-transitions.
Energy Technology Data Exchange (ETDEWEB)
Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.
1976-01-01
About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.
A laser photofragmentation time-of-flight mass spectrometric study of acetophenone at 193 and 248 nm
Zhao, H.-Q.; Cheung, Y.-S.; Liao, C.-L.; Liao, C.-X.; Ng, C. Y.; Li, Wai-Kee
1997-11-01
The photodissociation of acetophenone (C6H5COCH3) at 193 and 248 nm has been studied using the time-of-flight mass spectrometric technique. For hν=193 nm, two major primary channels, C6H5COCH3+hν→C6H5CO+CH3 [channel (1)] and C6H5+CH3CO [channel (2)], are observed with comparable cross sections. Data analysis shows that ≈30%-50% of primary C6H5CO and CH3CO radicals further decomposes, yielding secondary products C6H5+CO and CH3+CO, respectively. The translational energy release measurements indicate that for both channels (1) and (2) at 193 nm, ≈25%-30% of the available energy is channeled into kinetic energies of the primary photofragments. Measurements at hν=248 nm reveal that the branching ratio of channel (2) to channel (1) is ≈0.01. For channel (1) at hν=248 nm, ≈42% of the available energy is directed as the kinetic energy of the photofragments. The observed maximum kinetic energy release for channel (1) at 248 nm yields a value of 85.0±2.2 kcal/mol for the C6H5CO-CH3 bond dissociation energy at 0 K (D0). The photofragment angular distributions are found to be isotropic for both channels (1) and (2) at hν=193 nm and for channel (1) at hν=248 nm. A minor photodissociation channel C6H5COCH3+hν→C6H5CH3+CO is identified at both hν=193 and 248 nm. The energetics for the dissociation reactions of acetophenone have also been investigated using ab initio Gaussian-2-type procedures. The heats of formation at 0 K (ΔfH°0) for C6H5CO and C6H5 calculated using the isodesmic reaction scheme are 33.9±1.3 and 87.6±1.0 kcal/mol, respectively. These results suggest that the literature ΔfH°0 values for C6H5CO and C6H5 are likely to be low by 3-4 kcal/mol. These theoretical ΔfH° values for C6H5CO and C6H5 yield a theoretical D0(C6H5CO-CH3) value of 85.1±1.4 kcal/mol, which is in excellent accord with the experimental results obtained in the present study.
Single-mode 37-core fiber with a cladding diameter of 248 μm
DEFF Research Database (Denmark)
Sasaki, Y.; Takenaga, K.; Aikawa, K.
2017-01-01
A heterogeneous single-mode 37-core fiber with a cladding diameter of 248 μm is designed and fabricated. The fiber provides the highest core count and low total-crosstalk less than −20 dB/1000 km in C+L band....
International Nuclear Information System (INIS)
Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.
2015-01-01
The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz
Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad
2014-03-01
In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.
29 CFR 779.248 - Purchase or receive “goods for resale.”
2010-07-01
... section 3(s)(1) of the prior Act if they are purchased or received with the intention of being resold... purchased or received by the enterprise with the intention of reselling them in the same form or after... 29 Labor 3 2010-07-01 2010-07-01 false Purchase or receive âgoods for resale.â 779.248 Section 779...
17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.
2010-04-01
... EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out...) The name of the affiliate(s) providing the notice. If the notice is provided jointly by multiple...
Formation of copper tin sulfide films by pulsed laser deposition at 248 and 355 nm
DEFF Research Database (Denmark)
Ettlinger, Rebecca Bolt; Crovetto, Andrea; Canulescu, Stela
2016-01-01
The influence of the laser wavelength on the deposition of copper tin sulfide (CTS) and SnS-rich CTS with a 248-nm KrF excimer laser (pulse length τ = 20 ns) and a 355-nm frequency-tripled Nd:YAG laser (τ = 6 ns) was investigated. A comparative study of the two UV wavelengths shows that the CTS...... film growth rate per pulse was three to four times lower with the 248-nm laser than the 355-nm laser. SnS-rich CTS is more efficiently ablated than pure CTS. Films deposited at high fluence have submicron and micrometer size droplets, and the size and area density of the droplets do not vary significantly...
Directory of Open Access Journals (Sweden)
Jinquan Chen
Full Text Available Semen is a major vehicle for HIV transmission. Prostatic acid phosphatase (PAP fragments, such as PAP248-286, in human semen can form amyloid fibrils to enhance HIV infection. Other endogenous or exogenous factors present during sexual intercourse have also been reported to promote the formation of seminal amyloid fibrils.Here, we demonstrated that a synthetic 15-residue peptide derived from the HIV-1 gp120 coreceptor-binding region, designated enhancing peptide 2 (EP2, can rapidly self-assemble into nanofibers. These EP2-derivated nanofibers promptly accelerated the formation of semen amyloid fibrils by PAP248-286, as shown by Thioflavin T (ThT and Congo red assays. The amyloid fibrils presented similar morphology, assessed via transmission electron microscopy (TEM, in the presence or absence of EP2. Circular dichroism (CD spectroscopy revealed that EP2 accelerates PAP248-286 amyloid fibril formation by promoting the structural transition of PAP248-286 from a random coil into a cross-β-sheet. Newly formed semen amyloid fibrils effectively enhanced HIV-1 infection in TZM-bl cells and U87 cells by promoting the binding of HIV-1 virions to target cells.Nanofibers composed of EP2 promote the formation of PAP248-286 amyloid fibrils and enhance HIV-1 infection.
2012-05-07
... RITA 2008-0002] Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports.... SUPPLEMENTARY INFORMATION: OMB Approval No. 2138-0004. Title: Submission of Audit Reports--Part 248. Form No...: BTS collects independent audited financial reports from U.S. certificated air carriers. Carriers not...
International Nuclear Information System (INIS)
Pissadakis, S.; Michelakaki, I.
2009-01-01
The effect of 248 nm laser radiation, with pulse duration of 5 picoseconds, 500 femtosecond, and 120 femtosecond, on the optical properties and the Knoop hardness of a commercial Er/Yb-codoped phosphate glass is presented here. Refractive index changes of the order of few parts of 10-4 are correlated with optical absorption centers induced in the glass volume, using Kramers-Kroning relationship. Accordingly, substantially lower refractive index changes are measured in volume Bragg gratings inscribed in the glass, indicating that, in addition to the optical density changes, volume dilation changes of negative sign may also be associated with the 248 nm ultrafast irradiation. The Knoop hardness experimental results reveal that the glass matrix undergoes an observable initial hardening and then a reversing softening and volume dilation process for modest accumulated energy doses, where the Knoop hardness follows a nonmonotonic trend. Comparative results on the Knoop hardness trend are also presented for the case of 193 nm excimer laser radiation. The above findings denote that the positive or negative evolution of refractive index changes induced by the 248 0nm ultrafast radiation in the glass is dominated by the counteraction of the color center formation and the volume modification effects.
Damage thresholds of thin film materials and high reflectors at 248 nm
International Nuclear Information System (INIS)
Rainer, F.; Lowdermilk, W.H.; Milam, D.; Carniglia, C.K.; Hart, T.T.; Lichtenstein, T.L.
1982-01-01
Twenty-ns, 248-nm KrF laser pulses were used to measure laser damage thresholds for halfwave-thick layers of 15 oxide and fluoride coating materials, and for high reflectance coatings made with 13 combinations of these materials. The damage thresholds of the reflectors and single-layer films were compared to measurements of several properties of the halfwave-thick films to determine whether measurements of these properties of single-layer films to determine whether measurements of these properties of single-layer films were useful for identifying materials for fabrication of damage resistant coatings
International Nuclear Information System (INIS)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1977-10-01
During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix
International Nuclear Information System (INIS)
Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong
2016-01-01
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
Energy Technology Data Exchange (ETDEWEB)
Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)
2016-01-11
This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.
Confirmed results of the 248Cm(48Ca,4n)292116 experiment
International Nuclear Information System (INIS)
Patin, J B; Moody, K J; Stoyer, M A; Wild, J F; Shaughnessy, D A; Stoyer, N J
2003-01-01
The results of a detailed analysis performed on the data obtained in the 248 Cm( 48 Ca,4n) 292 116 reaction is presented. This analysis is independent of the original data analysis performed in Dubna in which three separate decay chains were found. Each decay chain began with an evaporation residue followed by three α decays and ended in a spontaneous fission event, all correlated in time and position. The analysis presented confirms that the three events are present in the data. A summary of the three events will be given as well as a description of the analysis performed
Search for superheavy elements in the bombardment of 248Cm with 48Ca
International Nuclear Information System (INIS)
Hulet, E.K.; Lougheed, R.W.; Wild, J.F.; Landrum, J.H.; Stevenson, P.C.; Ghiorso, A.; Nitschke, J.M.; Otto, R.J.; Morrissey, D.J.; Baisden, P.A.; Gavin, B.F.; Lee, D.; Silva, R.J.; Fowler, M.M.; Seaborg, G.T.
1977-01-01
We have searched for superheavy elements 110 to 116 with half-lives between 10 4 and 10 8 s in fractions chemically separated after each of a series of bombardments of 248 Cm made with 267-MeV 48 Ca ions. After 6 months of α and spontaneous-fission counting, our results provide no persuasive evidence for the presence of super-heavy elements. The most plausible explanation for not finding the superheavy elements is that they have either short half-lives or very small formation cross sections
Malik, Ruchi; Bunkar, Devendra; Choudhary, Bhanwar Singh; Srivastava, Shubham; Mehta, Pakhuri; Sharma, Manish
2016-10-01
Human semen is principal vehicle for transmission of HIV-1 and other enveloped viruses. Several endogenous peptides present in semen, including a 39-amino acid fragments of prostatic acid phosphatase (PAP248-286) assemble into amyloid fibrils named as semen-derived enhancer of viral infection (SEVI) that promote virion attachment to target cells which dramatically enhance HIV virus infection by up to 105-fold. Epigallocatechin-3-gallate (EGCG), a polyphenolic compound, is the major catechin found in green tea which disaggregates existing SEVI fibers, and inhibits the formation of SEVI fibers. The aim of this study was to screen a number of relevant polyphenols to develop a rational approach for designing PAP248-286 aggregation inhibitors as potential anti-HIV agents. The molecular docking based virtual screening results showed that polyphenolic compounds 2-6 possessed good docking score and interacted well with the active site residues of PAP248-286. Amino acid residues of binding site namely; Lys255, Ser256, Leu258 and Asn265 are involved in binding of these compounds. In silico ADMET prediction studies on these hits were also found to be promising. Polyphenolic compounds 2-6 identified as hits may act as novel leads for inhibiting aggregation of PAP248-286 into SEVI.
Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation
Pereira, L.; Pospori, A.; Antunes, Paulo; Domingues, Maria Fatima; Marques, S.; Bang, Ole; Webb, David J.; Marques, Carlos A.F.
2017-01-01
In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly duri...
DEFF Research Database (Denmark)
Marques, C. A.F.; Min, R.; Leal, A.
2018-01-01
This paper presents fiber Bragg grating (FBG) inscription with a pulsed 248 nm UV KrF laser in polymer optical fibers (POFs) made of different polymers, namely polymethyl methacrylate (PMMA), cyclic-olefin polymer and co-polymer, and Polycarbonate. The inscribed gratings and the corresponding...... inscription parameters are compared with grating inscribed in POFs made of the aforementioned materials but with the hitherto most used laser for inscription, which is a continuous wave 325 nm UV HeCd laser. Results show a reduction of the inscription time of at least 16 times. The maximum time reduction...... is more than 130 times. In addition, a reflectivity and a bandwidth close to or higher than the ones with the 325 nm laser were obtained. The polymer optical fiber Bragg gratings (POFBGs) inscribed with the 248 nm laser setup present high stability with small variations in their central wavelength...
International Nuclear Information System (INIS)
Ma Jianhua; Lin Weizheng; Wang Wenfen; Yao Side; Lin Nianyun
1999-01-01
Transient absorption spectrum of triplet state of 9,10-anthraquinone-2-sulfonate (AQS) in aqueous solution has been investigated using 248 nm (KrF) laser photolysis. A whole transient absorption spectrum with absorption maxim at 380 nm and 580 nm has been assigned to triple AQS from detailed kinetic analysis of decay of 380 nm and 580 nm signals, which is the neat characteristic absorption of triplet AQS reported for the first time. In addition, the difference in feature of the spectrum of triplet AQS in H 2 O and that in CH 3 CN was eliminated by further study using 248 nm laser pulses
Energy Technology Data Exchange (ETDEWEB)
Harrison, Aaron W.; Ryazanov, Mikhail; Sullivan, Erin N.; Neumark, Daniel M., E-mail: dneumark@berkeley.edu [Department of Chemistry, University of California, Berkeley, California 94720, USA and Chemical Sciences Division, Lawrence Berkeley National Laboratory, Berkeley, California 94720 (United States)
2016-07-14
The photodissociation dynamics of the methyl perthiyl radical (CH{sub 3}SS) have been investigated using fast-beam coincidence translational spectroscopy. Methyl perthiyl radicals were produced by photodetachment of the CH{sub 3}SS{sup −} anion followed by photodissociation at 248 nm (5.0 eV) and 193 nm (6.4 eV). Photofragment mass distributions and translational energy distributions were measured at each dissociation wavelength. Experimental results show S atom loss as the dominant (96%) dissociation channel at 248 nm with a near parallel, anisotropic angular distribution and translational energy peaking near the maximal energy available to ground state CH{sub 3}S and S fragments, indicating that the dissociation occurs along a repulsive excited state. At 193 nm, S atom loss remains the major fragmentation channel, although S{sub 2} loss becomes more competitive and constitutes 32% of the fragmentation. The translational energy distributions for both channels are very broad at this wavelength, suggesting the formation of the S{sub 2} and S atom products in several excited electronic states.
Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation
DEFF Research Database (Denmark)
Pereira, L.; Pospori, A.; Antunes, Paulo
2017-01-01
In this work we experimentally validate and characterize the first phase-shifted polymer optical fiber Bragg gratings (PS-POFBGs) produced using a single pulse from a 248 nm krypton fluoride laser. A single-mode poly (methyl methacrylate) optical fiber with a core doped with benzyl dimethyl ketal...... for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly during the grating inscription process by placing a narrow blocking aperture in the center of the UV beam. The produced high...
Spectroscopy of neutron-rich nuclei populated in the spontaneous fission of 252Cf and 248Cm
International Nuclear Information System (INIS)
Smith, A. G.; Simpson, G. S.; Billowes, J.; Durell, J. L.; Phillips, W. R.; Dagnall, P. J.; Freeman, S. J.; Leddy, M.; Roach, A. A.; Smith, J. F.
1999-01-01
In this paper we present research that has been carried out using the Euroball and Eurogam arrays to detect γ rays emitted from spontaneously fissioning 248 Cm and 252 Cf. The paper focuses on three sub-areas of current activity, namely, the measurement of yields of secondary fragment pairs, the measurement of state lifetimes at around spin 10, and recent measurements of g-factors of excited states in fission fragments. (c) 1999 American Institute of Physics
Freeze drying method for preparing radiation source material
International Nuclear Information System (INIS)
Mosley, W.C.; Smith, P.K.
1976-01-01
Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)
Laser-damage thresholds of thin-film optical coatings at 248 nm
International Nuclear Information System (INIS)
Milam, D.; Rainer, F.; Lowdermilk, W.H.
1981-01-01
We have measured the laser-induced damage thresholds for 248 nm wavelength light of over 100 optical coatings from commercial vendors and research institutions. All samples were irradiated once per damage site with temporally multi-lobed, 20-ns pulses generated by a KrF laser. The survey included high, partial, and dichroic reflectors, anti-reflective coatings, and single layer films. The samples were supplied by ten vendors. The majority of samples tested were high reflectors and antireflective coatings. The highest damage thresholds were 8.5 to 9.4 J/cm 2 , respectively. Although these represent extremes of what has been tested so far, several vendors have produced coatings of both types with thresholds which consistently exceed 6 J/cm 2 . Repeated irradiations of some sites were made on a few samples. These yielded no degradation in threshold, but in fact some improvement in damage resistance. These same samples also exhibited no change in threshold after being retested seven months later
Peláez, R. J.; Afonso, C. N.; Bator, M.; Lippert, T.
2013-06-01
The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al2O3 in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to ≈2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al+ ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.
Operational tests of the BNL 24.8 kW, 3.80K helium refrigerator
International Nuclear Information System (INIS)
Brown, D.P.; Farah, Y.; Gibbs, R.J.; Schlafke, A.P.; Sondericker, J.H.
1986-01-01
The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is also given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985
Trends in radioisotope development and utilization in the United States
Energy Technology Data Exchange (ETDEWEB)
Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)
1976-06-01
The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.
International Nuclear Information System (INIS)
Marscher, A.P.; Broderick, J.J.
1983-01-01
We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray
Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa
2014-06-07
Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν(248nm) → CH3CHO*, CH3CHO* → CH3 + HCO ϕ(1a) = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ(1e) = 0.205 ± 0.04, CH3CHO*[Formula: see text]CH3CO + HO2 ϕ(1f) = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as ϕ(CH₃) = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ(1b) = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ(1c) = 0.
Operational tests of the BNL 24.8 kW, 3.8 K helium refrigerator
International Nuclear Information System (INIS)
Brown, D.P.; Farah, Y.; Gibbs, R.J.
1985-01-01
The BNL 24.8 kW refrigeration system is completely installed and major portions of the acceptance tests have been completed. So far, the equipment tested has performed at or above design levels. The room temperature helium compressor station has been completely tested and accepted. The two-stage oil injected screw compressor system exhibited an isothermal efficiency of 57% while delivering a helium flow in excess of 4400 g/s. Data on the performance of the make-up gas cryogenic purifier is given. The refrigerator turbomachinery, 13 expanders and three cold compressors, has been tested at room temperature for mechanical integrity and control stability. The first cooldown to operating temperature will be attempted in late August, 1985. 2 refs., 5 figs
A systematic study of actinide production from the interactions of heavy ions with sup 248 Cm
Energy Technology Data Exchange (ETDEWEB)
Leyba, J.D.
1990-09-07
Production cross sections for heavy actinides produced from the interactions of {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca ions with {sup 248}Cm were measured at energies ranging from 0.98 to 1.35 X Coulomb barrier. The recoiling reaction products were collected in copper or gold catcher foils located near the {sup 248}Cm target. Separate fractions of Bk, Cf, Es, Fm, and Md were obtained from a radiochemical separation procedure. For the {sup 12}C system, a He/KCl jet was used to transport the recoiling No activities of interest to a rotating wheel system. The isotopic distributions of the actinide products were found to be essentially symmetric about the maximum with full-widths-at-half-maximum of approximately 2.5 mass units. Isotopic distributions of the {sup 12}C, {sup 31}P, {sup 40}Ar, and {sup 44}Ca systems were found to be very similar to the {sup 40,48}Ca systems studied previously. The maxima of the isotopic distributions generally occurred for those reaction channels which involved the exchange of the fewest number of nucleons between the target and projectile for which the calculated excitation energy was a positive quantity. Additionally, the maxima of the excitation functions occurred at those projectile energies which were consistent with the calculated reaction barriers based upon a binary reaction mechanism. The experimental data from the four systems investigated were compared to several models of heavy ion interactions including a damped reaction mechanism, compound nucleus formation and subsequent particle evaporation, and classical partial wave calculations for binary systems.
Energy Technology Data Exchange (ETDEWEB)
Nelson, T. R.; Borisov, A. B.; Boyer, K.; Schroeder, W. A.; Santoro, J.; Van Tassle, A. J.; Rhodes, C. K.; Luk, T. S.; Cameron, S.; Longworth, J. W.; McPherson, A.
1999-11-22
Efficient (1.2% yield) multikilovolt x-ray emission from Ba(L) (2.4--2.8{angstrom}) and Gd(L) (1.7--2.1{angstrom}) is produced by ultraviolet (248nm) laser-excited BaF{sub 2} and Gd solids. The high efficiency is attributed to an inner shell-selective collisional electron ejection.
Morajkar, Pranay; Bossolasco, Adriana; Schoemaecker, Coralie; Fittschen, Christa
2014-06-01
Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH3CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO2 radicals by reaction with O2. The CH3 radical yield has been determined using the same technique following their conversion into CH3O2. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO2 profiles, obtained under various O2 concentrations, to a complex model, while the CH3 yield has been determined relative to the CH3 yield from 248 nm photolysis of CH3I. Time resolved HO2 profiles under very low O2 concentrations suggest that another unknown HO2 forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O2. HO2 profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH3CHO + hν248nm → CH3CHO*, CH3CHO* → CH3 + HCO ϕ1a = 0.125 ± 0.03, CH3CHO* → CH3 + H + CO ϕ1e = 0.205 ± 0.04, CH3CHO*{to 2pc{rArrfill}}limits^{o2}CH3CO + HO2 ϕ1f = 0.07 ± 0.01. The CH3O2 quantum yield has been determined in separate experiments as φ_{CH3} = 0.33 ± 0.03 and is in excellent agreement with the CH3 yields derived from the HO2 measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH3CHO. From arithmetic considerations taking into account the HO2 and CH3 measurements we deduce a remaining quantum yield for the molecular pathway: CH3CHO* → CH4 + CO ϕ1b = 0.6. All experiments can be consistently explained with absence of the formerly considered pathway: CH3CHO* → CH3CO + H ϕ1c = 0.
National Research Council Canada - National Science Library
Vaghjiani, Ghanshyam L
2005-01-01
4TH Positive and Cameron band emissions from electronically excited CO have been observed for the first time in 248-nm pulsed laser photolysis of a trace amount of CHBr3 vapor in an excess of O-atoms...
Energy Technology Data Exchange (ETDEWEB)
Pelaez, R. J.; Afonso, C. N. [Laser Processing Group, Instituto de Optica, CSIC, Serrano 121, Madrid 28006 (Spain); Bator, M.; Lippert, T. [General Energy Research Department, Paul Scherrer Institut, CH-5232 Villigen PSI (Switzerland)
2013-06-14
The aim of this work is to demonstrate that single-photon photoionization processes make a significant difference in the expansion and temperature of the plasma produced by laser ablation of ceramic Al{sub 2}O{sub 3} in vacuum as well as to show their consequences in the kinetic energy distribution of the species that eventually will impact on the film properties produced by pulsed laser deposition. This work compares results obtained by mass spectrometry and optical spectroscopy on the composition and features of the plasma produced by laser ablation at 193 nm and 248 nm, i.e., photon energies that are, respectively, above and below the ionization potential of Al, and for fluences between threshold for visible plasma and up to Almost-Equal-To 2 times higher. The results show that the ionic composition and excitation of the plasma as well as the ion kinetic energies are much higher at 193 nm than at 248 nm and, in the latter case, the population of excited ions is even negligible. The comparison of Maxwell-Boltzmann temperature, electron temperatures, and densities of the plasmas produced with the two laser wavelengths suggests that the expansion of the plasma produced at 248 nm is dominated by a single population. Instead, the one produced at 193 nm is consistent with the existence of two populations of cold and hot species, the latter associated to Al{sup +} ions that travel at the forefront and produced by single photon ionization as well as Al neutrals and double ionized ions produced by electron-ion impact. The results also show that the most energetic Al neutrals in the plasma produced at the two studied wavelengths are in the ground state.
International Nuclear Information System (INIS)
Kratz, J.V.
1980-03-01
In the present talk aspects of the reaction mechanism related to the survival probability of the heaviest fragments in 238 U + 238 U collisions are discussed first. This is followed by a description of the experiments that have been performed to search for surviving superheavy fragments in the 238 U + 238 U reaction and by a presentation of the results obtained so far. In a third section our recent first attempts with the 238 U + 248 Cm reaction are described and preliminary results are discussed. (orig.)
A bright-rimmed cloud sculpted by the H ii region Sh2-48
Ortega, M. E.; Paron, S.; Giacani, E.; Rubio, M.; Dubner, G.
2013-08-01
Aims: We characterize a bright-rimmed cloud embedded in the H ii region Sh2-48 while searching for evidence of triggered star formation. Methods: We carried out observations towards a region of 2' × 2' centered at RA = 18h22m11.39s, Dec = -14°35'24.81''(J2000) using the Atacama Submillimeter Telescope Experiment (ASTE; Chile) in the 12CO J = 3-2, 13CO J = 3-2, HCO+J = 4-3, and CS J = 7-6 lines with an angular resolution of about 22''. We also present radio continuum observations at 5 GHz carried out with the Jansky Very Large Array (JVLA; EEUU) interferometer with a synthetized beam of 7'' × 5''. The molecular transitions were used to study the distribution and kinematics of the molecular gas of the bright-rimmed cloud. The radio continuum data was used to characterize the ionized gas located on the illuminated border of this molecular condensation. Combining these observations with infrared public data allowed us to build up a comprehensive picture of the current state of star formation within this cloud. Results: The analysis of our molecular observations reveals a relatively dense clump with n(H2) ~ 3 × 103cm-3, located in projection onto the interior of the H ii region Sh2-48. The emission distribution of the four observed molecular transitions has, at VLSR ~ 38 km s-1, morphological anticorrelation with the bright-rimmed cloud as seen in the optical emission. From the new radio continuum observations, we identify a thin layer of ionized gas located on the border of the clump that is facing the ionizing star. The ionized gas has an electron density of about 73 cm-3, which is a factor three higher than the typical critical density (nc ~ 25 cm-3), above which an ionized boundary layer can be formed and maintained. This supports the hypothesis that the clump is being photoionized by the nearby O9.5V star, BD-14 5014. From the evaluation of the pressure balance between the ionized and molecular gas, we conclude that the clump would be in a prepressure balance
Cold valleys in the radioactive decay of 248-254Cf isotopes
International Nuclear Information System (INIS)
Biju, R.K.; Sahadevan, Sabina; Santhosh, K.P.; Joseph, Antony
2008-01-01
Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254 Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46 Ar, 48,50 Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132 Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts. (author)
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Antonio
1976-07-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Antonio
1976-07-01
Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)
Source storage and transfer cask: Users Guide
International Nuclear Information System (INIS)
Eccleston, G.W.; Speir, L.G.; Garcia, D.C.
1985-04-01
The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs
International Nuclear Information System (INIS)
Taylor, G.N.
1985-01-01
Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline
Kaur, Gurjit; Sandhu, Kirandeep; Kaur, Amandeep; Sharma, Manoj K.
2018-05-01
The dynamical cluster decay model is employed to investigate the decay of *265Db and *267Db nuclei, formed in the 27Al+238U , 18O+249Bk , and 19F+248Cm hot fusion reactions at energies around the Coulomb barrier. First, the fission dynamics of the 27Al+238U reaction is explored by investigating the fragmentation and preformation yield of the reaction. The symmetric mass distribution of the fission fragments is observed for *265Db nucleus, when static β2 i deformations are used within hot optimum orientation approach. However, the mass split gets broaden for the use of β2 i-dynamical hot configuration of the fragments and becomes clearly asymmetric for the cold-static-deformed approach. Within the application of cold orientations of fragments, a new fission channel is observed at mass asymmetry η =0.29 . In addition to 238U-induced reaction, the work is carried out to address the fission and neutron evaporation cross sections of *267Db nucleus formed via 19F+248Cm and 18O+249Bk reactions, besides a comprehensive analysis of fusion and capture processes. Higher fusion cross sections and compound nucleus formation probabilities (PCN) are obtained for the 18O+249Bk reaction, as larger mass asymmetry in the entrance channel leads to reduced Coulomb factor. Finally, the role of sticking (IS) and nonsticking (INS) moments of inertia is analyzed for the 4 n and 5 n channels of *267Db nuclear system.
Quantum-chemical consideration of extermal valent forms of actinides
International Nuclear Information System (INIS)
Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.
1982-01-01
Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution
Directory of Open Access Journals (Sweden)
Jing Gao
2009-01-01
Full Text Available Two pre-FFT adaptive array (AA antenna combiners and a post-FFT carrier diversity (CD combiner are integrated with a Japan Terrestrial digital TV (ISDB-T OFDM receiver using 90 nm 7M1P CMOS process. A 2/4/8-antenna diversity receiver can be configured and a low-cost 4 antenna diversity reception system can be realized in one LSI by making use of the AA-CD two-stage diversity combining method. Mobile reception performance is increased by 1.63 times using a denoise filter circuit and SPLINE interpolator under urban 6-path Rayleigh fading (TU6 model with 2-antenna post-FFT carrier diversity (2CD combing mode. The die area is 49 mm2 and the power consumption is 310 mW.
Directory of Open Access Journals (Sweden)
Manuel Ávila
2014-12-01
Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja
Energy Technology Data Exchange (ETDEWEB)
Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)
2015-10-15
Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)
Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets
International Nuclear Information System (INIS)
Patin, Joshua B.
2002-01-01
The study of the reactions between heavy ions and 208 Pb, 209 Bi, 238 U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238 U( 18 O,xn) 256-x Fm, 238 U( 22 Ne,xn) 260-x No, and 248 Cm( 15 N,xn) 263-x Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208 Pb( 48 Ca,xn) 256-x No, 208 Pb( 50 Ti,xn) 258-x Rf, 208 Pb( 51 V,xn) 259-x Db, 209 Bi( 50 Ti,xn) 259-x Db, and 209 Bi( 51 V,xn) 260-x Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics
A COMPACT GROUP OF GALAXIES AT Z = 2.48 HOSTING AN AGN-DRIVEN OUTFLOW
Energy Technology Data Exchange (ETDEWEB)
Shih, Hsin-Yi [Gemini Observatory, 670 N Aohoku Place, Hilo, HI 96720 (United States); Stockton, Alan, E-mail: jshih@gemini.edu, E-mail: stockton@ifa.hawaii.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)
2015-12-10
We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 10{sup 11}M{sub ⊙} and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass–metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow.
(n,d) elastic differential cross section at 2.48 and 3.28 MeV and related phase shift analyses
International Nuclear Information System (INIS)
Chatelain, P.; Onel, Y.; Viennet, R.; Weber, J.
1978-01-01
In the case of (n,d) scattering, at energies of a few MeV, the elastic differential scattering cross sections are not well determined, especially beyond costhetasub(CM) = -0.8 and the number of data points is rather scarce. This lack of experimental data causes great difficulty to perform a phase shift analysis even in the simple case when partial waves up to lsub(max) = 2 are included as free parameters in the parametrization of the scattering amplitude. We have therefore, in the framework of our study of the (n,d) scattering, measured this cross section at 2.48 and 3.28 MeV with special emphasize on large scattering angles. (orig./WL) [de
Lee, Shir-Ying; Goh, Jia-Hui; Tan, Karen M L; Liu, Te-Chih
2017-05-01
Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] is a high oxygen affinity hemoglobin (Hb) causing polycythemia, whereas Hb H (β4) disease causes mild to severe chronic hemolytic anemia. The clinical characteristics, gel electrophoresis, capillary electrophoresis (CE) and molecular genotyping of a case of Hb Helsinki coinherited with Hb H disease in an ethnic Malay is described, illustrating the interaction between the β-globin variant and coinheritance of three α gene deletions. The proband was asymptomatic, exhibited microcytosis and a normal with Hb value.
Advances on Polymer Optical Fiber Gratings Using a KrF Pulsed Laser System Operating at 248 nm
Directory of Open Access Journals (Sweden)
Carlos A. F. Marques
2018-03-01
Full Text Available This paper presents the achievements and progress made on the polymer optical fiber (POF gratings inscription in different types of Fiber Bragg Gratings (FBGs and long period gratings (LPGs. Since the first demonstration of POFBGs in 1999, significant progress has been made where the inscription times that were higher than 1 h have been reduced to 15 ns with the application of the krypton fluoride (KrF pulsed laser operating at 248 nm and thermal treatments such as the pre-annealing of fibers. In addition, the application of dopants such as benzyl dimethyl ketal (BDK has provided a significant decrease of the fiber inscription time. Furthermore, such improvements lead to the possibility of inscribing POF gratings in 850 nm and 600 nm, instead of only the 1550 nm region. The progress on the inscription of different types of polymer optical fiber Bragg gratings (POFBGs such as chirped POFBGs and phase-shifted POFBGs are also reported in this review.
Photodissociation dynamics of the simplest alkyl peroxy radicals, CH3OO and C2H5OO, at 248 nm
Sullivan, Erin N.; Nichols, Bethan; Neumark, Daniel M.
2018-01-01
The photodissociation dynamics of the simplest alkyl peroxy radicals, methyl peroxy (CH3OO) and ethyl peroxy (C2H5OO), are investigated using fast beam photofragment translational spectroscopy. A fast beam of CH3OO- or C2H5OO- anions is photodetached to generate neutral radicals that are subsequently dissociated using 248 nm photons. The coincident detection of the photofragment positions and arrival times allows for the determination of mass, translational energy, and angular distributions for both two-body and three-body dissociation events. CH3OO exhibits repulsive O loss resulting in the formation of O(1D) + CH3O with high translational energy release. Minor two-body channels leading to OH + CH2O and CH3O + O(3P) formation are also detected. In addition, small amounts of H + O(3P) + CH2O are observed and attributed to O loss followed by CH3O dissociation. C2H5OO exhibits more complex dissociation dynamics, in which O loss and OH loss occur in roughly equivalent amounts with O(1D) formed as the dominant O atom electronic state via dissociation on a repulsive surface. Minor two-body channels leading to the formation of O2 + C2H5 and HO2 + C2H4 are also observed and attributed to a ground state dissociation pathway following internal conversion. Additionally, C2H5OO dissociation yields a three-body product channel, CH3 + O(3P) + CH2O, for which the proposed mechanism is repulsive O loss followed by the dissociation of C2H5O over a barrier. These results are compared to a recent study of tert-butyl peroxy (t-BuOO) in which 248 nm excitation results in three-body dissociation and ground state two-body dissociation but no O(1D) production.
Human endothelial precursor cells express tumor endothelial marker 1/endosialin/CD248.
Bagley, Rebecca G; Rouleau, Cecile; St Martin, Thia; Boutin, Paula; Weber, William; Ruzek, Melanie; Honma, Nakayuki; Nacht, Mariana; Shankara, Srinivas; Kataoka, Shiro; Ishida, Isao; Roberts, Bruce L; Teicher, Beverly A
2008-08-01
Angiogenesis occurs during normal physiologic processes as well as under pathologic conditions such as tumor growth. Serial analysis of gene expression profiling revealed genes [tumor endothelial markers (TEM)] that are overexpressed in tumor endothelial cells compared with normal adult endothelial cells. Because blood vessel development of malignant tumors under certain conditions may include endothelial precursor cells (EPC) recruited from bone marrow, we investigated TEM expression in EPC. The expression of TEM1 or endosialin (CD248) and other TEM has been discovered in a population of vascular endothelial growth factor receptor 2+/CD31+/CD45-/VE-cadherin+ EPC derived from human CD133+/CD34+ cells. EPC share some properties with fully differentiated endothelial cells from normal tissue, yet reverse transcription-PCR and flow cytometry reveal that EPC express higher levels of endosialin at the molecular and protein levels. The elevated expression of endosialin in EPC versus mature endothelial cells suggests that endosialin is involved in the earlier stages of tumor angiogenesis. Anti-endosialin antibodies inhibited EPC migration and tube formation in vitro. In vivo, immunohistochemistry indicated that human EPC continued to express endosialin protein in a Matrigel plug angiogenesis assay established in nude mice. Anti-endosialin antibodies delivered systemically at 25 mg/kg were also able to inhibit circulating murine EPC in nude mice bearing s.c. SKNAS tumors. EPC and bone marrow-derived cells have been shown previously to incorporate into malignant blood vessels in some instances, yet they remain controversial in the field. The data presented here on endothelial genes that are up-regulated in tumor vasculature and in EPC support the hypothesis that the angiogenesis process in cancer can involve EPC.
First calorimetric determination of heat of extraction of 248Cm in a bi-phasic system
International Nuclear Information System (INIS)
Martin, Leigh R.; Zalupski, Peter R.
2011-01-01
This report presents a summary of the work performed to meet FCR and D level 2 milestone M21SW050201, 'Complete the first calorimetric determination of heat of extraction of 248Cm in a bi-phasic system'. This work was carried out under the auspices of the Thermodynamics and Kinetics FCR and D work package. To complement previous work undertaken under this work package we have extended out heat of extraction studies by di-2-ethyl-hexyl-phosphoric acid to curium. This report also details the heat of extraction of samarium in the same system. This work was performed to not only test the methodology but also to check for consistency with the heats of extraction obtained with those in the prior literature. The heat of extraction for samarium that was obtained in this study was -9.6 kJ mol-1, which is in reasonable agreement with the previously obtained value of -10.9 kJ mol-1. The curium heat of extraction was performed under two sets of conditions and the obtained heats of extraction were in reasonable agreement with each other at -16.0 ± 1.1 and -16.8 ± 1.5 kJ mol-1.
Photodissociation of dibromoethanes at 248 nm: an ignored channel of Br2 elimination.
Lee, Hsin-Lung; Lee, Ping-Chen; Tsai, Po-Yu; Lin, King-Chuen; Kuo, H H; Chen, P H; Chang, A H H
2009-05-14
Br(2) molecular elimination is probed in the photodissociation of 1,1- and 1,2-C(2)H(4)Br(2) isomeric forms at 248 nm by using cavity ring-down absorption spectroscopy. Their photodissociation processes differ markedly from each other. The quantum yield of the Br(2) fragment in 1,2-dibromoethane is 0.36+/-0.18, in contrast to a value of 0.05+/-0.03 in 1,1-dibromoethane. The vibrational population ratios of Br(2)(v=1)/Br(2)(v=0) are 0.8+/-0.1 and 0.5+/-0.2 for 1,2- and 1,1-dibromoethanes, respectively. The Br(2) yield densities are found to increase by a factor of 35% and 190% for 1,2- and 1,1-dibromoethanes within the same temperature increment. In the ab initio potential energy calculations, the transition state (TS) along the adiabatic ground state surface may correlate to the Br(2) products. The TS energy for 1,2-dibromoethane is well below the excitation energy at 483 kJ/mol, whereas that for 1,1-dibromoethane is slightly above. Such a small TS energy barrier impedes the photodissociation of the ground state 1,1-dibromoethane such that the production yield of Br(2) may become relatively low, but rise rapidly with the temperature. The TS structure shows a larger bond distance of Br-Br in 1,2-dibromoethane than that in 1,1-dibromoethane. That explains why the former isomer may result in hotter vibrational population of the Br(2) fragments.
Directory of Open Access Journals (Sweden)
Khaled Barakat
Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.
Hsu, Ching-Yi; Huang, Hong-Yi; Lin, King-Chuen
2005-10-01
By using cavity ring-down absorption spectroscopy technique, we have observed the channel of Br2 molecular elimination following photodissociation of CF2Br2 at 248 nm. A tunable laser beam, which is crossed perpendicular to the photolyzing laser beam in a ring-down cell, is used to probe the Br2 fragment in the B 3Piou+-X1Sigmag+ transition. The vibrational population is obtained in a nascent state, despite ring-down time as long as 500-1000 ns. The population ratio of Br2(v=1)/Br2(v=0) is determined to be 0.4+/-0.2, slightly larger than the value of 0.22 evaluated by Boltzmann distribution at room temperature. The quantum yield of the Br2 elimination reaction is also measured to be 0.04+/-0.01. This work provides direct evidence to support molecular elimination occurring in the CF2Br2 photodissociation and proposes a plausible pathway with the aid of ab initio potential-energy calculations. CF2Br2 is excited probably to the 1B1 and 3B2 states at 248 nm. As the C-Br bond is elongated upon excitation, the coupling of the 1A'(1B1) state to the high vibrational levels of the ground state X 1A'(1A1) may be enhanced to facilitate the process of internal conversion. After transition, the highly vibrationally excited CF2Br2 feasibly surpasses a transition barrier prior to decomposition. According to the ab initio calculations, the transition state structure tends to correlate with the intermediate state CF2Br+Br(CF2Br...Br) and the products CF2+Br2. A sequential photodissociation pathway is thus favored. That is, a single C-Br bond breaks, and then the free-Br atom moves to form a Br-Br bond, followed by the Br2 elimination. The formed Br-Br bond distance in the transition state tends to approach equilibrium such that the Br2 fragment may be populated in cold vibrational distribution. Observation of a small vibrational population ratio of Br2(v=1)Br2(v=0) agrees with the proposed mechanism.
Cannata, David J; Finkelstein, David I; Gantois, Ilse; Teper, Yaroslav; Drago, John; West, Jan M
2009-01-01
We generated a mouse line with a missense mutation (S248F) in the gene (CHRNA4) encoding the alpha4 subunit of neuronal nicotinic acetylcholine receptor (nAChR). Mutant mice demonstrate brief nicotine induced dystonia that resembles the clinical events seen in patients with the same mutation. Drug-induced dystonia is more pronounced in female mice, thus our aim was to determine if the S248F mutation changed the properties of fast- and slow-twitch muscle fibres from female mutant mice. Reverse transcriptase-PCR confirmed CHRNA4 gene expression in the brain but not skeletal muscles in normal and mutant mice. Ca(2+) and Sr(2+) force activation curves were obtained using skinned muscle fibres prepared from slow-twitch (soleus) and fast-twitch (EDL) muscles. Two significant results were found: (1) the (pCa(50) - pSr(50)) value from EDL fibres was smaller in mutant mice than in wild type (1.01 vs. 1.30), (2) the percentage force produced at pSr 5.5 was larger in mutants than in wild type (5.76 vs. 0.24%). Both results indicate a shift to slow-twitch characteristics in the mutant. This conclusion is supported by the identification of the myosin heavy chain (MHC) isoforms. Mutant EDL fibres expressed MHC I (usually only found in slow-twitch fibres) as well as MHC IIa. Despite the lack of spontaneous dystonic events, our findings suggest that mutant mice may be having subclinical events or the mutation results in a chronic alteration to muscle neural input.
Definitive Brachytherapy for Kaposi's Sarcoma
International Nuclear Information System (INIS)
Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.
1996-01-01
Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness
Californium Recovery from Palladium Wire
Energy Technology Data Exchange (ETDEWEB)
Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-08-01
The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.
Californium-252 Program Equipment Evaluation
Energy Technology Data Exchange (ETDEWEB)
Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2017-12-01
To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.
Hung, Kai-Chan; Tsai, Po-Yu; Li, Hou-Kuan; Lin, King-Chuen
2014-02-01
By using time-resolved Fourier-transform infrared emission spectroscopy, the HCO fragment dissociated from acetaldehyde (CH3CHO) at 248 nm is found to partially decompose to H and CO. The fragment yields are enhanced by the Ar addition that facilitates the collision-induced internal conversion. The channels to CH2CO + H2 and CH3CO + H are not detected significantly. The rotational population distribution of CO, after removing the Ar collision effect, shows a bimodal feature comprising both low- and high-rotational (J) components, sharing a fraction of 19% and 81%, respectively, for the vibrational state v = 1. The low-J component is ascribed to both roaming pathway and triple fragmentation. They are determined to have a branching ratio of 0.06, respectively, relative to the whole v = 1 population. The CO roaming is accompanied by a highly vibrational population of CH4 that yields a vibrational bimodality.
Energy Technology Data Exchange (ETDEWEB)
Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)
2015-01-15
To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)
A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow
Shih, Hsin-Yi; Stockton, Alan
2015-12-01
We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).
Californium Cf-252 for pelvic radiotherapy
Energy Technology Data Exchange (ETDEWEB)
Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J
1978-01-01
Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.
Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets
Energy Technology Data Exchange (ETDEWEB)
Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)
2002-01-01
The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.
Neutron spectra from radionuclide sources for cardiac pacemakers
International Nuclear Information System (INIS)
Kluge, H.
1975-01-01
Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries
Chang, Yuan-Pin; Lee, Ping-Chen; Lin, King-Chuen; Huang, C H; Sun, B J; Chang, A H H
2008-06-02
The Br2 elimination channel is probed for 1,2-C2H2Br2 in the B(3)Pi(+)ou-X(1)Sigma(+)g transition upon irradiation at 248 nm by using cavity ring-down absorption spectroscopy (CRDS). The nascent vibrational population ratio of Br2(v=1)/Br2(v=0) is obtained to be 0.7+/-0.2, thus indicating that the Br2 fragment is produced in hot vibrational states. The obtained Br2 products are anticipated to result primarily from photodissociation of the ground-state cis isomer via four-center elimination or from cis/trans isomers via three-center elimination, each mechanism involving a transition state that has a Br-Br distance much larger than that of ground state Br2. According to ab initio potential energy calculations, the pathways that lead to Br2 elimination may proceed either through the electronic ground state by internal conversion or through the triplet state by intersystem crossing. Temperature-dependence measurements are examined, thereby supporting the pathway that involves internal conversion--which was excluded previously by using product translational spectroscopy (PTS). The quantum yield for the Br2 elimination reaction is determined to be 0.120.1, being substantially contributed by the ground-state Br2 product. The discrepancy of this value from that (of 0.2) obtained by PTS may rise from the lack of measurements in probing the triplet-state Br2 product.
Single-event burnout of power MOSFET devices for satellite application
International Nuclear Information System (INIS)
Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang
2008-01-01
Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)
The reaction {sup 48}Ca+{sup 248}Cm{yields}{sup 296}116{sup *} studied at the GSI-SHIP
Energy Technology Data Exchange (ETDEWEB)
Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Goethe-Universitaet Frankfurt, Institut fuer Physik, Frankfurt (Germany); Heinz, S.; Mann, R.; Khuyagbaatar, J.; Ackermann, D.; Barth, W.; Block, M.; Burkhard, H.G.; Comas, V.F.; Dahl, L.; Heredia, J.A.; Kindler, B.; Kojouharov, I.; Lang, R.; Lommel, B.; Muenzenberg, G.; Tinschert, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Maurer, J.; Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Eberhardt, K.; Kratz, J.V.; Runke, J.; Thoerle-Pospiech, P.; Trautmann, N. [Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Gostic, J.; Henderson, R.A.; Kenneally, J.M.; Moody, K.J.; Nelson, S.L.; Shaughnessy, D.A.; Stoyer, M.A.; Wilk, P.A. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Leino, M.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Nishio, K. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan); Popeko, A.G.; Yeremin, A.V. [Joint Institute for Nuclear Research, Dubna (Russian Federation)
2012-05-15
The synthesis of element 116 in fusion-evaporation reactions of a {sup 48}Ca beam with radioactive {sup 248}Cm targets was studied at the velocity filter SHIP of GSI in Darmstadt. At excitation energies of the compound nuclei of 40.9MeV, four decay chains were measured, which were assigned to the isotope {sup 292}116, and one chain, which was assigned to {sup 293}116. Measured cross-sections of (3.4{sub -1.6}{sup +2.7})pb and (0.9{sub -0.7}{sup +2.1}), respectively, and decay data of the chains agree with data measured previously at the Flerov Laboratory of Nuclear Reactions in Dubna. As a new result, one {alpha}-decay chain was measured, which terminates after four {alpha} decays by spontaneous fission. The {alpha} energies of the second-to-fourth decay are considerably higher than those measured for the {alpha} decays of {sup 289}114, {sup 285}Cn, and {sup 281}Ds and the spontaneous fission half-life is significantly longer than that of {sup 277}Hs measured in previous experiments. A possible assignment is discussed in the frame of excited quasiparticle states of nuclei populated in the decay chain from {sup 293}116. Also other possible assignments were considered and are discussed. At an excitation energy of 45.0MeV no events were observed resulting in a one-event cross-section limit of 1.6 pb. The technical aspects related with the use of radioactive target material at SHIP are described in detail. The experience gained in this experiment will serve as a basis for future experiments aiming to study still heavier elements at the velocity filter SHIP. (orig.)
Radioactive materials production
International Nuclear Information System (INIS)
Anon.
1985-01-01
The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant
International Nuclear Information System (INIS)
Nichols, T.D.
1991-04-01
Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 x 10 12 W/cm 2 to 2 x 10 14 W/cm 2 . The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 x 10 13 W/cm 2 , the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory
Wei, Pei-Ying; Chang, Yuan-Ping; Lee, Wei-Bin; Hu, Zhengfa; Huang, Hong-Yi; Lin, King-Chuen; Chen, K T; Chang, A H H
2006-10-07
Following photodissociation of CH2Br2 at 248 nm, Br2 molecular elimination is detected by using a tunable laser beam, as crossed perpendicular to the photolyzing laser beam in a ring-down cell, probing the Br2 fragment in the B 3Piou+ -X 1Sigmag+ transition. The nascent vibrational population is obtained, yielding a population ratio of Br2(v = 1)Br2(v = 0) to be 0.7 +/- 0.2. The quantum yield for the Br2 elimination reaction is determined to be 0.2 +/- 0.1. Nevertheless, when CH2Br2 is prepared in a supersonic molecular beam under cold temperature, photofragmentation gives no Br2 detectable in a time-of-flight mass spectrometer. With the aid of ab initio potential energy calculations, a plausible pathway is proposed. Upon excitation to the 1B1 or 3B1 state, C-Br bond elongation may change the molecular symmetry of Cs and enhance the resultant 1 1,3A'-X 1A' (or 1 1,3B1-X 1A1 as C2v is used) coupling to facilitate the process of internal conversion, followed by asynchronous concerted photodissociation. Temperature dependence measurements lend support to the proposed pathway.
Somnitz, H; Fida, M; Ufer, T; Zellner, R
2005-09-21
The quantum yield of CO in the laser pulse photolysis of acetone at 248 nm and at 298 K in the pressure range 20-900 mbar (N2) has been measured directly using quantitative infrared diode laser absorption of CO. It is found that the quantum yield of CO shows a significant dependence on total pressure with Phi(CO) decreasing with pressure from around 0.45 at 20 mbar to approximately 0.25 at 900 mbar. From a combination of ab initio quantum chemical calculations on the molecular properties of the acetyl (CH3CO) radical and its unimolecular fragmentation as well as the application of statistical (RRKM) and dynamical calculations we show that CO production results from prompt secondary fragmentation (via(2a)) of the internally excited primary CH3CO* photolysis product with an excess energy of approximately 62.8 kJ mol(-1). Hence, our findings are consistent with a consecutive photochemically induced decomposition model, viz. step (1): CH3COCH3+hv--> CH3CO*+ CH3, step (2a): CH3CO*--> CH3+ CO or step (2b) CH3CO*-(+M)--> CH3CO. Formation of CO via a direct and/or concerted channel CH3COCH3+hv--> 2CH(3)+ CO (1') is considered to be unimportant.
International Nuclear Information System (INIS)
Valentine, T.E.; Mihalczo, J.T.
1995-01-01
This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code
International Nuclear Information System (INIS)
Huray, P.G.; Nave, S.E.
1984-01-01
Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported
Preparation and study of elemental californium-249
International Nuclear Information System (INIS)
Noe, M.; Peterson, J.R.
1975-01-01
Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)
International Nuclear Information System (INIS)
Venkataraman, B.; Hou, H.; Zhang, Z.; Chen, S.; Bandukwalla, G.; Vernon, M.
1990-01-01
Photodissociation of the group VIB (Cr,Mo,W) hexacarbonyls has been studied at 248 nm using molecular beam photofragment spectroscopy. One, two and three photon processes have been observed. Analysis of the product velocity distributions shows that the photodissociation mechanism consists of sequential CO eliminations with the nth photon channel best described as the single photon photodissociation of the stable products of the n-1st photon channel. The product translational energy distribution for the first CO elimination step is quantitatively similar for all three hexacarbonyls and characteristic of a repulsive translational energy release. The product translational energy distributions of all subsequent CO elimination steps are accurately described by a simple, microcanonical model. Qualitative molecular orbital considerations suggest that the large product translational energy observed in the first CO elimination step results from a repulsive σ interaction between the closed shell CO ligand and an excited molecular orbital which has a significant admixture of metal (n+1)p z , (n+1)s and nd z 2 orbitals. This repulsive interaction is absent in the remaining CO elimination steps because there are vacancies in the coordination shell along the z axis
Energy Technology Data Exchange (ETDEWEB)
Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-08-09
This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.
Citric complexes of trivalent cerium and berkelium
International Nuclear Information System (INIS)
Boulhassa, S.
1977-01-01
The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr
Lee, Ping-Chen; Tsai, Po-Yu; Hsiao, Ming-Kai; Lin, King-Chuen; Huang, C H; Chang, A H H
2009-03-09
In the photodissociation of 1,1-C(2)H(2)Br(2) at 248 nm, the Br(2) elimination channel is probed by using cavity ring-down absorption spectroscopy (CRDS). In terms of spectral simulation, the vibrational population ratio of Br(2)(v = 1)/Br(2)(v = 0) is found to be 0.55+/-0.05, which indicates that the Br(2) fragment is vibrationally hot. The rotational population is thermally equilibrated with a Boltzmann temperature of 349+/-38 K. According to ab initio potential energy calculations, the obtained fragments are anticipated to result primarily from photodissociation of the ground electronic state that undergoes 1) H migration followed by three-center elimination, and 2) isomerization forming either trans- or cis-1,2-C(2)H(2)Br(2) from which Br(2) is eliminated. RRKM calculations predict that the Br(2) dissociation rates through the ground singlet state prevail over those through the triplet state. Measurements of temperature and Ar pressure dependence are examined to support the proposed pathway via internal conversion. The quantum yield for the Br(2) elimination reaction is determined to be 0.07+/-0.04. This result is smaller than that obtained in 1,2-C(2)H(2)Br(2), probably because the dissociation rates are slowed in the isomerization stage.
Directed evolution of the periodic table: probing the electronic structure of late actinides.
Marsh, M L; Albrecht-Schmitt, T E
2017-07-25
Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.
International Nuclear Information System (INIS)
1987-03-01
The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers
International Nuclear Information System (INIS)
Hu, En-Lan; Tsai, Po-Yu; Fan, He; Lin, King-Chuen
2013-01-01
Upon one-photon excitation at 248 nm, gaseous CH 3 C(O)SH is dissociated following three pathways with the products of (1) OCS + CH 4 , (2) CH 3 SH + CO, and (3) CH 2 CO + H 2 S that are detected using time-resolved Fourier-transform infrared emission spectroscopy. The excited state 1 (n O , π * CO ) has a radiative lifetime of 249 ± 11 ns long enough to allow for Ar collisions that induce internal conversion and enhance the fragment yields. The rate constant of collision-induced internal conversion is estimated to be 1.1 × 10 −10 cm 3 molecule −1 s −1 . Among the primary dissociation products, a fraction of the CH 2 CO moiety may undergo further decomposition to CH 2 + CO, of which CH 2 is confirmed by reaction with O 2 producing CO 2 , CO, OH, and H 2 CO. Such a secondary decomposition was not observed previously in the Ar matrix-isolated experiments. The high-resolution spectra of CO are analyzed to determine the ro-vibrational energy deposition of 8.7 ± 0.7 kcal/mol, while the remaining primary products with smaller rotational constants are recognized but cannot be spectrally resolved. The CO fragment detected is mainly ascribed to the primary production. A prior distribution method is applied to predict the vibrational distribution of CO that is consistent with the experimental findings.
Energy Technology Data Exchange (ETDEWEB)
Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)
2011-08-05
Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.
International Nuclear Information System (INIS)
Zelinka, L.; McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R.; Walker, G.R.
2011-01-01
Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.
International Nuclear Information System (INIS)
Wu, Chia-Ching; Lin, Hsiang-Chin; Chang, Yuan-Bin; Tsai, Po-Yu; Yeh, Yu-Ying; Fan, He; Lin, King-Chuen; Francisco, J. S.
2011-01-01
A primary dissociation channel of Br 2 elimination is detected following a single-photon absorption of (COBr) 2 at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br 2 fragment in the B 3 Π ou + -X 1 Σ g + transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br 2 contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br 2 elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr) 2 via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br 2 + 2CO. The resulting Br 2 is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.
Wu, Chia-Ching; Lin, Hsiang-Chin; Chang, Yuan-Bin; Tsai, Po-Yu; Yeh, Yu-Ying; Fan, He; Lin, King-Chuen; Francisco, J S
2011-12-21
A primary dissociation channel of Br(2) elimination is detected following a single-photon absorption of (COBr)(2) at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br(2) fragment in the B(3)Π(ou)(+)-X(1)Σ(g)(+) transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br(2) contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr)(2) via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br(2) + 2CO. The resulting Br(2) is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.
Computer-assisted nuclear fuel manufacture
International Nuclear Information System (INIS)
Maloney, J.P.; Schaumann, S.M.; Stone, E.
1976-01-01
At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step
Automated absolute activation analysis with californium-252 sources
International Nuclear Information System (INIS)
MacMurdo, K.W.; Bowman, W.W.
1978-09-01
A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level
Savannah River Plant californium-252 Shuffler electronics manual
International Nuclear Information System (INIS)
Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.
1980-03-01
Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included
Savannah River Plant Californium-252 Shuffler software manual
International Nuclear Information System (INIS)
Johnson, S.S.; Crane, T.W.; Eccleston, G.W.
1979-03-01
A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined
Fan, He; Tsai, Po-Yu; Lin, King-Chuen; Lin, Cheng-Wei; Yan, Chi-Yu; Yang, Shu-Wei; Chang, A H H
2012-12-07
The primary elimination channel of bromine molecule in one-photon dissociation of CH(2)BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 ± 0.1):(0.2 ± 0.1), corresponding to a Boltzmann vibrational temperature of 581 ± 45 K. The quantum yield of the ground state Br(2) elimination reaction is determined to be 0.24 ± 0.08. With the aid of ab initio potential energy calculations, the obtained Br(2) fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br(2) products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br(2) yields are obtained analogously from CH(3)CHBrC(O)Br and (CH(3))(2)CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br(2) yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br(2) production, and its contribution might account for the underestimate of the branching ratio calculations.
African Journals Online (AJOL)
Administrator
Department of Paediatrics and Child Health Makerere University, Kampala, Uganda. 2. Department of ... several times each day, often during meals, and in ..... Figure 2: The smaller patient has Nodding syndrome and is the same age as the taller adolescent who is of the ... Onchocerca volvulus in the CSF confirms our lack.
Computer-assisted nuclear fuel manufacture
International Nuclear Information System (INIS)
Maloney, J.P.; Schaumann, C.M.; Stone, E.
1976-06-01
At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig
Energy Technology Data Exchange (ETDEWEB)
Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires
1967-07-01
The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)
Heavy ion tests on programmable VLSI
International Nuclear Information System (INIS)
Provost-Grellier, A.
1989-11-01
The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr
Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source
Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.
2018-05-01
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.
Safety analysis report for packaging: neutron shipping cask, model 0.5T
International Nuclear Information System (INIS)
Peterson, R.T.
1976-01-01
The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual
NWIS casting measurements taken during demonstrations to Russian visitors
International Nuclear Information System (INIS)
Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.
1998-01-01
This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)
Health physics aspects of 252Cf
International Nuclear Information System (INIS)
Bhagwat, A.M.
1974-01-01
After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)
Survey of potential markets for devices using Californium-252
International Nuclear Information System (INIS)
Permar, P.H.
1975-01-01
Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US
Californium-252 interstitial implants in carcinoma of the tongue
International Nuclear Information System (INIS)
Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.
1985-01-01
A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy
Undergraduate experiments using the neutron radiation from californium-252
International Nuclear Information System (INIS)
Rossel, J.; Golecki, I.
1976-01-01
Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)
Protein (Viridiplantae): 128879 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 5:248 3803:248 ... 3814:248 ... 163722:3689 ... 3826:3689 ... 3827:3689 ... PREDICTED: uncharacterized protein LOC101515541 Cicer arietinum MNSSTI...CSLFLGLILISQSANAKGHGGGLVVTICKGATDRAACENILGSNSEISHAKSFSQL
Safety analysis report for packaging: neutron shipping cask, model 4T
International Nuclear Information System (INIS)
Peterson, R.T.
1977-01-01
This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials
2010-04-01
... 1940 (15 U.S.C. 80a-2(a)(9)). (j) Customer means a consumer who has a customer relationship with you. (k)(1) Customer relationship means a continuing relationship between a consumer and you under which... provide brokerage services to the individual or establish a continuing relationship with the individual...
2010-01-01
..., training, monitoring, auditing, the development of and accountability for coupon and market management... who assemble at a defined location for the purpose of selling their produce directly to consumers... relationships between nutrition and health, all in keeping with the individual's personal, cultural, and...
2010-04-01
... long-range planning by the board of directors to ensure the physical, financial and social viability of... remaining after deducting from the surplus cash, as defined by the regulatory agreement, the amount of all...
2010-04-01
... officials; (6) Has standards of financial accountability that conform to Attachment F of OMB Circular No. A... neighborhood organizations. For urban areas, “community” may be a neighborhood or neighborhoods, city, county...
7 CFR 248.7 - Nondiscrimination.
2010-01-01
... participation data (as required by title VI of the Civil Rights Act of 1964) are collected at the time women... through the Department's required nondiscrimination statement on brochures and publications; (2) Review... and Independence Avenue, SW., Washington, DC 20250-9410 (or call (800) 795-3272 (voice) or (202) 720...
Directory of Open Access Journals (Sweden)
Gerson Faustino Rosa
2015-12-01
Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.
Method for measuring multiple scattering corrections between liquid scintillators
Energy Technology Data Exchange (ETDEWEB)
Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov
2016-07-21
A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.
International Nuclear Information System (INIS)
Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.
1979-01-01
Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
The protective cell petrus for the production of californium 252
International Nuclear Information System (INIS)
Sontag, R.; Berger, R.
1967-01-01
The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr
[Molecular pathogenesis of Waardenburg syndrome type II resulting from SOX10 gene mutation].
Zhang, Hua; Chen, Hongsheng; Feng, Yong; Qian, Minfei; Li, Jiping; Liu, Jun; Zhang, Chun
2016-08-01
To explore the molecular mechanism of Waardenburg syndrome type II (WS2) resulting from SOX10 gene mutation E248fs through in vitro experiment. 293T cells were transiently transfected with wild type (WT) SOX10 and mutant type (MT) E248fs plasmids. The regulatory effect of WT/MT SOX10 on the transcriptional activity of MITF gene and influence of E248fs on WT SOX10 function were determined with a luciferase activity assay. The DNA binding capacity of the WT/MT SOX10 with the promoter of the MITF gene was determined with a biotinylated double-stranded oligonucleotide probe containing the SOX10 binding sequence cattgtc to precipitate MITF and E248fs, respectively. The stability of SOX10 and E248fs were also analyzed. As a loss-of-function mutation, the E248fs mutant failed to transactivate the MITF promoter as compared with the WT SOX10 (P<0.01), which also showed a dominant-negative effect on WT SOX10. The WT SOX10 and E248fs mutant were also able to bind specifically to the cattgtc motif in the MITF promoter, whereas E248fs had degraded faster than WT SOX10. Despite the fact that the E248fs has a dominant-negative effect on SOX10, its reduced stability may down-regulate the transcription of MITF and decrease the synthesis of melanin, which may result in haploinsufficiency of SOX10 protein and cause the milder WS2 phenotype.
Dicty_cDB: Contig-U15463-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 40 |pid:none) Bazzania tayloriana voucher NSW712... 248 3e-64 DQ406895_1( DQ406895 |pid:none) Sabia sp. Qiu ...248 3e-64 CP000439_1615( CP000439 |pid:none) Francisella tularensis subsp. n... 248 3e-64 EF101040_1( EF1010
International Nuclear Information System (INIS)
Anon.
1999-01-01
These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)
International Nuclear Information System (INIS)
Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.
2012-01-01
A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.
21 CFR 558.248 - Erythromycin thiocyanate.
2010-04-01
... (9.25) Starter ration for animals up to 35 lb body weight 061623 (iv) 18.5 Laying chickens; aids in... disease during periods of stress Feed for 2 d before stress and 3 to 6 d after stress; withdraw 24 h... during periods of stress Feed for 2 d before stress and 3 to 6 d after stress (vi) 185 1. Chickens; as an...
2010-01-01
... programs. (19) For States making expansion requests, documentation which demonstrates: (i) The need for an increase in funding; (ii) That the use of the increased funding will be consistent with serving WIC... funding to increase the value of the Federal share of the benefits received by a recipient, the funding...
Publications | Page 248 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact ... This paper presents a summary of the progress in financial inclusion in ... the supply of financial services in CCTPS, and assessments of the process of ...
2010-01-01
... must obtain prior approval in accordance with 7 CFR 3016.22 before charging to the FMNP any capital... the FMNP. (10) The cost of preparing contracts for farmers/farmers' markets and local WIC providers...
Publications | Page 248 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Bureaucratic resistance to regulatory reforms : the contrasting experiences in electricity and telecommunications in Brazil (restricted access). The process of regulatory diffusion has been extensively explored in developed countries, but much less so in developing countries. In an attempt to open the black box of the diffusion ...
7 CFR 248.25 - FMNP information.
2010-01-01
..., Massachusetts 02222-1066. (b) Delaware, District of Columbia, Maryland, New Jersey, Pennsylvania, Puerto Rico..., Kentucky, Mississippi, North Carolina, South Carolina, Tennessee: U.S. Department of Agriculture, FNS...
Directory of Open Access Journals (Sweden)
Zhao WC
2015-10-01
Full Text Available Wan-Cheng Zhao,1 Fang-Fang Bi,1 Da Li,2 Qing Yang11Department of Obstetrics and Gynecology, 2Center of Reproductive Medicine, Shengjing Hospital of China Medical University, Shenyang, People’s Republic of ChinaBackground: Uterine fibroids often require a hysterectomy or myomectomy via laparotomy or laparoscopy. Morcellation is often necessary to perform a laparoscopic surgery. The objective of this study is to determine the incidence of unexpected uterine sarcomas (UUSs after hysterectomy and myomectomy for uterine fibroids and to reduce the occurrence and avoid the morcellation of UUSs by analyzing their characteristics.Methods: Women who had a hysterectomy or myomectomy for uterine fibroids in Shengjing Hospital of China Medical University between November 2008 and November 2014 were selected for the study, and their clinical characteristics were analyzed.Results: During the period, 48 UUSs were found in 10,248 cases, and the overall incidence was 0.47%. There was no statistical difference (P=0.449 regarding the incidence (0.50% vs 0.33% between 42 UUSs in 8,456 cases undergoing laparotomy and six UUSs in 1,792 cases undergoing laparoscopy. Most of the UUSs were stage I (89.58%, which occurred more commonly (56.25% in women aged 40–49. Abnormal uterine bleeding (39.58% was the main clinical manifestation. Rapidly growing pelvic masses (12.5%, rich blood flow signals (18.75%, and degeneration of uterine fibroids (18.75% prompted by ultrasonography may suggest the possibility of UUSs. The margins of most UUSs (93.75% were regular, which may cause UUSs to be misdiagnosed as uterine fibroids. Fifteen cases underwent magnetic resonance imaging examinations. Approximately 73.33% showed heterogeneous and hypointense signal intensity on T1-weighted images, and 80% showed intermediate-to-high signal intensity on T2-weighted images, with necrosis and hemorrhage in 40% of cases. After contrast administration, 80% presented early heterogeneous
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...
International Nuclear Information System (INIS)
Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.
1988-01-01
Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given
Use of californium-252 sources in Hungary for teaching and research
International Nuclear Information System (INIS)
Csikai, J.
1976-01-01
An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)
International Nuclear Information System (INIS)
Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.
1976-01-01
This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field
Development of a transportable neutron radiography system for non-destructive tests application
International Nuclear Information System (INIS)
Silva, Ademir X. da; Crispim, Verginia R.
1999-01-01
This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)
Neutron crosstalk between liquid scintillators
Energy Technology Data Exchange (ETDEWEB)
Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov
2015-09-11
A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.
Neutron crosstalk between liquid scintillators
International Nuclear Information System (INIS)
Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.
2015-01-01
A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction
International Nuclear Information System (INIS)
Haynes, C.E.
1976-01-01
The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research
International Nuclear Information System (INIS)
Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.
1990-01-01
The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)
Beam test of a grid-less multi-harmonic buncher
International Nuclear Information System (INIS)
Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.
2008-01-01
The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.
Composition containing transuranic elements for use in the homeopathic treatment of aids
International Nuclear Information System (INIS)
Lustig, D.
1996-01-01
A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)
Energy Technology Data Exchange (ETDEWEB)
Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert
1976-07-01
This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.
Energy Technology Data Exchange (ETDEWEB)
Albrecht-Schmitt, Thomas
2012-03-01
This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.
Triton and alpha-particle contribution from LiF converter for neutron dosimeter
Camacho, M E; Balcazar, M
1999-01-01
A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.
Study of reproducibility of measurements with the spectrometer of Bonner multispheres
International Nuclear Information System (INIS)
Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.
2013-01-01
This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement
7 CFR 248.14 - Distribution of funds.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions... spend back funds under this paragraph as FNS may require. (j) Recovery of unused funds. State agencies...
24 CFR 248.103 - General prepayment limitation.
2010-04-01
...) Effect of unauthorized prepayment. A mortgagee's acceptance of a prepayment in violation of paragraph (a... acceptance of a prepayment in violation of paragraph (a) of this section, or attempt to obtain voluntary... administrative action under parts 24 and 25 of this title, in addition to any other remedies available by law...
28 CFR 2.48 - Revocation: Preliminary interview.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Revocation: Preliminary interview. 2.48....48 Revocation: Preliminary interview. (a) Interviewing officer. A parolee who is retaken on a warrant issued by a Commissioner shall be given a preliminary interview by an official designated by the Regional...
17 CFR 248.1 - Purpose and scope.
2010-04-01
...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... subpart: (1) Requires a financial institution to provide notice to customers about its privacy policies...
17 CFR 248.8 - Revised privacy notices.
2010-04-01
...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... customer to a nonaffiliated third party, if that former customer has not had the opportunity to exercise an...
Energy Technology Data Exchange (ETDEWEB)
Jones, C.G.
1990-08-01
This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.
Alternative irradiation system for efficiency manganese bath determination
Energy Technology Data Exchange (ETDEWEB)
Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)
2010-12-15
An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.
Experimental survey of the potential energy surfaces associated with fission
International Nuclear Information System (INIS)
Britt, H.C.
1980-01-01
Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)
International Nuclear Information System (INIS)
Jones, C.G.
1990-08-01
This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs
International Nuclear Information System (INIS)
Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.
1976-10-01
The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field
Changing composition of human capital: the Czech Republic, Hungary, and Poland
Czech Academy of Sciences Publication Activity Database
Jeong, Byeongju; Kejak, Michal; Vinogradov, Viatcheslav
-, č. 248 (2005), s. 1-27 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : human capital * composition * occupation Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp248.pdf
Californium-252 neutron activation analysis of high-level processed nuclear tank waste
International Nuclear Information System (INIS)
Troyer, G.L.; Purcell, M.A.
2000-01-01
The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments
Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas
International Nuclear Information System (INIS)
Maruyama, J.; Beach, J.L.; Nagell, J.R. van
1984-01-01
Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de
Level structures of neutron-rich Xe isotopes
Energy Technology Data Exchange (ETDEWEB)
Ahmad, I.; Lister, C.J.; Morss, L.R. [and others
1995-08-01
The level structures of neutron-rich Xe isotopes were determined by observing prompt gamma-ray coincidences in {sup 248}Cm fission fragments. A 5-mg {sup 248}Cm, in the form of {sup 248}Cm-KCl pellet, was placed inside Eurogam array which consisted of 45 Compton-suppressed Ge detectors and 5 Low-Energy Photon Spectrometers. Transitions in Xe isotopes were identified by the appearance of new peaks in the {gamma}-ray spectra obtained by gating on the gamma peaks of the complementary Mo fragments.
Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea
Wu, H.-x.
2011-08-05
A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).
Directory of Open Access Journals (Sweden)
Vicent Martines
2016-12-01
Full Text Available Review to Grifoll, Isabel, Julián Acebrón, Flocel Sabaté (eds. (2014: Cartografies de l’ànima. Identitat, memòria i escriptura, Lleida, Pagès Editors, 2014, 248 pàgs. ISBN:978-84-9975-517-5; and Acebrón, Julián, Isabel Grifoll, Flocel Sabaté (eds. (2015: La Construcció d’identitats imaginades. Literatura medieval i ideologia, Lleida, Pagès Editors, 2015, 320 pàgs. ISBN:978-84-9975-704-9
1983-01-01
BURLINGTON MASS 85 85 85 85 N L AVIATION LTD UN KINGDOM 2,558 273 2,285 2,556 273 2,285 M L ENERGIA INC PRINCETON NEW JERSEY 28 28 28 28 M M L...155 155 PIPE INC PORTSMOUTH VIRGINIA 588 588 743 743 PIPE INSTALLATION CORP ATCO ILw jE6EY 42 42 42 42 PIPELINE RENOVATION SERVICE INC FORT BRAGG NCAR...107 107 PIPELINE RENOVATION SERVICE INC LANGLEY AFB VIRGINIA 205 161 44 PIPELINE RENOVATION SERVICE INC NORFOLK VIRGINIA 248 248 560 268 248 44
17 CFR Appendix B to Subpart A of... - Sample Clauses
2010-04-01
... Information Pt. 248, Subpt. A, App. B Appendix B to Subpart A of Part 248—Sample Clauses Link to an amendment..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and Security (All...
A new type-B cask design for transporting 252Cf
International Nuclear Information System (INIS)
Simmons, C.M.
2000-01-01
A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask
Energy Technology Data Exchange (ETDEWEB)
Wibmer, Constantinos Kurt; Gorman, Jason; Ozorowski, Gabriel; Bhiman, Jinal N.; Sheward, Daniel J.; Elliott, Debra H.; Rouelle, Julie; Smira, Ashley; Joyce, M. Gordon; Ndabambi, Nonkululeko; Druz, Aliaksandr; Asokan, Mangai; Burton, Dennis R.; Connors, Mark; Abdool Karim, Salim S.; Mascola, John R.; Robinson, James E.; Ward, Andrew B.; Williamson, Carolyn; Kwong, Peter D.; Morris, Lynn; Moore, Penny L.; Desrosiers, Ronald C.
2017-01-11
A comprehensive understanding of the regions on HIV-1 envelope trimers targeted by broadly neutralizing antibodies may contribute to rational design of an HIV-1 vaccine. We previously identified a participant in the CAPRISA cohort, CAP248, who developed trimer-specific antibodies capable of neutralizing 60% of heterologous viruses at three years post-infection. Here, we report the isolation by B cell culture of monoclonal antibody CAP248-2B, which targets a novel membrane proximal epitope including elements of gp120 and gp41. Despite low maximum inhibition plateaus, often below 50% inhibitory concentrations, the breadth of CAP248-2B significantly correlated with donor plasma. Site-directed mutagenesis, X-ray crystallography, and negative-stain electron microscopy 3D reconstructions revealed how CAP248-2B recognizes a cleavage-dependent epitope that includes the gp120 C terminus. While this epitope is distinct, it overlapped in parts of gp41 with the epitopes of broadly neutralizing antibodies PGT151, VRC34, 35O22, 3BC315, and 10E8. CAP248-2B has a conformationally variable paratope with an unusually long 19 amino acid light chain third complementarity determining region. Two phenylalanines at the loop apex were predicted by docking and mutagenesis data to interact with the viral membrane. Neutralization by CAP248-2B is not dependent on any single glycan proximal to its epitope, and low neutralization plateaus could not be completely explained by N- or O-linked glycosylation pathway inhibitors, furin co-transfection, or pre-incubation with soluble CD4. Viral escape from CAP248-2B involved a cluster of rare mutations in the gp120-gp41 cleavage sites. Simultaneous introduction of these mutations into heterologous viruses abrogated neutralization by CAP248-2B, but enhanced neutralization sensitivity to 35O22, 4E10, and 10E8 by 10-100-fold. Altogether, this study expands the region of the HIV-1 gp120-gp41 quaternary interface that is a target for broadly neutralizing
Indian Academy of Sciences (India)
Srimath
236 The Central Dogma of Molecular Biology. A Retrospective after Fifty Years. Michel Morange. 248 Chemistry is Evergreen... 2008 Nobel Prize in Chemistry. Swagata Dasgupta. 248. 226. Page 2. 215. RESONANCE | March 2009. DEPARTMENTS. Editorial. Biman Nath. Hubble Space Telescope, launched in 1991.
International Nuclear Information System (INIS)
Peterson, J.R.
1987-01-01
New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides
International Nuclear Information System (INIS)
Galle, P.
1982-01-01
The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr
International Nuclear Information System (INIS)
Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.
1987-01-01
The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing
Two-quasineutron states in 98248Cf and 98250Cf and the neutron-neutron residual interactions
International Nuclear Information System (INIS)
Katori, K.; Ahmad, I.; Friedman, A. M.
2008-01-01
Two-quasineutron states in 248 Cf and 250 Cf were investigated by single-neutron transfer reactions, 249 Cf(d,t) 248 Cf and 249 Cf(d,p) 250 Cf. The majority of levels observed were assigned to 12 bands in 248 Cf and six bands in 250 Cf, constructed from the single-particle states in neighboring Cf nuclei. The effective two-body interactions between two odd neutrons coupled outside a deformed core were deduced from the differences in the energies of the bandheads formed by the parallel and antiparallel coupling of the intrinsic spins of the two single-particle states
7 CFR 248.10 - Coupon and market management.
2010-01-01
... instruction emphasizing: (1) Eligible food choices; (2) Proper FMNP coupon redemption procedures, including...' markets. The State agency shall ensure that farmers/ farmers' markets are promptly paid for food costs. (h... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF...
31 CFR 248.7 - Claims requiring settlement action.
2010-07-01
...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ISSUE OF SUBSTITUTES OF LOST... claimant and transmit such data to the Claims Division, General Accounting Office, for settlement action. ...
Lifescience Database Archive (English)
Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanx...cknlxw*xxpxgsxrfxxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanx...cknlxw*xxpxgsxrfxxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx
Lifescience Database Archive (English)
Full Text Available rfkl*sfhrtnldfhtllwwli rcntsifk*hvwf*kcwshswfnfigmgiswcwwwycfliyl**fn**swlwssfslslf g*llldswfhlcglgfslvhknnc...vfl*chiwsgcnwkik*yvpkhvw*k*scwfyggis*wciqf ir*invwfc***iw*kemlysnayhsmffswflnksne
7 CFR 248.17 - Management evaluations and reviews.
2010-01-01
... deficiencies and prevent their future recurrence. (iii) If the corrective action plan is acceptable, FNS will... plan, and whether the deficiency is resolved or further corrective action is needed. Compliance buys...
48 CFR 52.248-3 - Value Engineering-Construction.
2010-10-01
.... Collateral costs, as used in this clause, means agency costs of operation, maintenance, logistic support, or... increases in the cost of testing, operations, maintenance, and logistic support. The term does not include... reductions resulting from a VECP in the agency's overall projected collateral costs, exlcusive of acquisition...
Lifescience Database Archive (English)
Full Text Available TTGTTGCAGTTAAAAAGCTCGTAGTTGAAGTTTAAGGTTXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence *lvdpasshmlvskikpcms...qqpavipapiaytkvvavkklvvev*g--- Translated Amino Acid sequence (All Frames) Frame A: *lvdpasshmlvskikpcmskykf
Lifescience Database Archive (English)
Full Text Available vrdnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtkiicsikvkymanm*kiviknsnikkkkkixwxkxxlxkx*k...kkfxgxxpfx*xfkkkxf*xffxxkk- -- ---dnanq*m*s*rsnprrlclwm*kkleclpsmfrsccqira*rksklfrsifrtcsmy **mcwtk Frame C:
248 A CRITICAL REVIEW OF ALEXIS KAGAME'S FOUR ...
African Journals Online (AJOL)
Ike Odimegwu
going to be the task of this paper as it appreciates the four categories of African philosophy ..... extracts from Tutuola's Palm Wine Drunkard. There, beauty ... the impression is that to penetrate an understanding of African philosophy, we need to.
Ultraviolet-laser ablation of skin
Energy Technology Data Exchange (ETDEWEB)
Lane, R.J.; Linsker, R.; Wynne, J.J.; Torres, A.; Geronemus, R.G.
1985-05-01
The authors report on the use of pulsed ultraviolet-laser irradiation at 193 nm from an argon-fluoride laser and at 248 nm from a krypton-fluoride laser to ablate skin. In vitro, both wavelengths performed comparably, removing tissue precisely and cleanly, and leaving minimal thermal damage to the surrounding tissue. In vivo, the 193-nm laser radiation failed to remove tissue after bleeding began. The 248-nm radiation, however, continued to remove tissue despite bleeding and left a clean incision with only minimal thermal damage. The krypton-fluoride excimer laser beam at 248 nm, which should be deliverable through a quartz optical fiber, has great potential as a surgical instrument.
Determination of the average number of neutrons per fission event for californium-252
International Nuclear Information System (INIS)
Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.
1982-01-01
By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)
Energy Technology Data Exchange (ETDEWEB)
Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.
1980-01-01
Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.
Citral derived amides as potent bacterial NorA efflux pump inhibitors
DEFF Research Database (Denmark)
Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V
2008-01-01
Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and NorA...
Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation
Energy Technology Data Exchange (ETDEWEB)
Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)
1971-04-15
Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps
Neutron radiography for nondestructive testing
International Nuclear Information System (INIS)
John, J.
1979-01-01
Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion
The CARIBU EBIS control and synchronization system
Dickerson, Clayton; Peters, Christopher
2015-01-01
The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.
Directory of Open Access Journals (Sweden)
Stanković Koviljka
2009-01-01
Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.
Designing on-line analyzer for coal on belt conveyor using neutron activation technique
International Nuclear Information System (INIS)
Rony Djokorayono; Agus Cahyono
2014-01-01
Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)
Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report
International Nuclear Information System (INIS)
Lagarias, J.; Irminger, P.; Dodson, W.
1979-01-01
Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station
Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix
International Nuclear Information System (INIS)
Zaborowski, Henrick.
1981-11-01
From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr
The CARIBU EBIS control and synchronization system
Energy Technology Data Exchange (ETDEWEB)
Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)
2015-01-09
The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.
International Nuclear Information System (INIS)
Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.
1980-01-01
Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures
Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology
International Nuclear Information System (INIS)
Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry
2012-01-01
This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)
Nuclear fission and the transuranium elements
International Nuclear Information System (INIS)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs
Nuclear fission and the transuranium elements
Energy Technology Data Exchange (ETDEWEB)
Seaborg, G.T.
1989-02-01
Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.
Feature Selection and Classifier Development for Radio Frequency Device Identification
2015-12-01
248 Table C-5: p-values vs Test Statistic for Wine Quality. ................................................. 248 Table C-6...p-values vs Test Statistic for Wisconsin Breast Cancer. .............................. 249 Table C-7: p-values vs Test Statistic for Wine ...electronic devices, such as RF-DNA. A brief review of the various approaches is considered to illustrate the benefits of the RF-DNA approach. 40
Settlement induction of Acropora palmata planulae by a GLW-amide neuropeptide
Erwin, P. M.; Szmant, A. M.
2010-12-01
Complex environmental cues dictate the settlement of coral planulae in situ; however, simple artificial cues may be all that is required to induce settlement of ex situ larval cultures for reef re-seeding and restoration projects. Neuropeptides that transmit settlement signals and initiate the metamorphic cascade have been isolated from hydrozoan taxa and shown to induce metamorphosis of reef-building Acropora spp. in the Indo-Pacific, providing a reliable and efficient settlement cue. Here, the metamorphic activity of six GLW-amide cnidarian neuropeptides was tested on larvae of the Caribbean corals Acropora palmata, Montastraea faveolata and Favia fragum. A. palmata planulae were induced to settle by the exogenous application of the neuropeptide Hym-248 (concentrations ≥1 × 10-6 M), achieving 40-80% attachment and 100% metamorphosis of competent planulae (≥6 days post-fertilization) during two spawning seasons; the remaining neuropeptides exhibited no activity. Hym-248 exposure rapidly altered larval swimming behavior (96% metamorphosis after 6 h. In contrast , M. faveolata and F. fragum planulae did not respond to any GLW-amides tested, suggesting a high specificity of neuropeptide activators on lower taxonomic scales in corals. Subsequent experiments for A. palmata revealed that (1) the presence of a biofilm did not enhance attachment efficiency when coupled with Hym-248 treatment, (2) neuropeptide-induced settlement had no negative effects on early life-history developmental processes: zooxanthellae acquisition and skeletal secretion occurred within 12 days, colonial growth occurred within 36 days, and (3) Hym-248 solutions maintained metamorphic activity following storage at room temperature (10 days), indicating its utility in remote field settings. These results corroborate previous studies on Indo-Pacific Acropora spp. and extend the known metamorphic activity of Hym-248 to Caribbean acroporids. Hym-248 allows for directed and reliable settlement of
Dose selenomethionine have radio-protective effect on cell lines with wild type p53?
International Nuclear Information System (INIS)
Tsuji, K.; Hagihira, T.; Ohnishi, K.; Ohnishi, T.; Matsumoto, H.
2003-01-01
Full text: Selenium compounds are known to have cancer preventive effects. It is reported recently that selenium in the form of selenomethionine (SeMet) can protect cells with wild type p53 from UV-induced cell killing by activating the DNA repair mechanism of p53 tumor suppressor protein via redox factor Ref1 by reducing p53 cysteine residue 275 and 277. In contrast, SeMet has no protective effect on UV-induced cell killing in p53-null cells. If SeMet also has protective effect in cells with wild type p53 on cell killing by photon irradiation, SeMet can be used as normal tissue radio-protector. We examined the effect of SeMet on cell killing by X-ray irradiation in several cell lines with different p53 status at exponentially growing phase. Cell lines used in this experiment were as follows: H1299/neo; human lung cancer cell line of p53 null type tranfected with control vector with no p53, H1299/wp53; wild type p53 transfected counterpart. A172/neo; human glioblastoma cell line with wild type p53, A172/mp53-248; mp53-248 (248-mutant, ARG >TRP) transfected counterpart. SAS/neo; human tongue cancer cell line with wild type p53, and SAS/mp53-248; mp53-248 transfected counterpart. Cells were subcultured at monolayer in D-MEM containing 10% FBS. Survivals of the cells were determined by colony forming ability. Ten-MV linac X-ray was used to irradiate the cells. Exponentially growing cells were incubated with 20μM of SeMet for 15 hours before irradiation. After 24 hours exposure of SeMet, cells were incubated up to two weeks in growth medium for colony formation. Twenty-four hours exposure of 20μM of SeMet had no cytotoxicity on these cell lines. SeMet had no modification effect on cell killing by photon irradiation in H1299/neo, H1299/wp53, SAS/neo, SAS/mp53-248, and A172/mp53-248. On the other hand, SeMet sensitized A172/neo in radiation cell killing. The effects of p53 on interaction of SeMet and photon irradiation differ according to cell lines
Utilization of radiation facilities at TNRC for shielding researches and related topics
Energy Technology Data Exchange (ETDEWEB)
Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)
1997-12-31
This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.
Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures
International Nuclear Information System (INIS)
Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.
2002-01-01
Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character
Transuranic biokinetic parameters for marine invertebrates--a review.
Ryan, T P
2002-04-01
A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.
Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU
Energy Technology Data Exchange (ETDEWEB)
Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)
2016-02-15
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.
Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU
Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.
2016-02-01
An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.
Robotics and remote systems applications
International Nuclear Information System (INIS)
Rabold, D.E.
1996-01-01
This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling
International Nuclear Information System (INIS)
Bringer, O.
2007-10-01
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)
CSIR Research Space (South Africa)
Mwakikunga, BW
2010-01-01
Full Text Available -Structured Materials, P. O. Box 395, Pretoria, South Africa 123 Nanoscale Res Lett (2010) 5:389–397 DOI 10.1007/s11671-009-9494-4 coherent, intense and almost monochromatic laser light allows it to be tuned to selectively dissociate specific bonds in a precursor... in the current set of experiments. 390 Nanoscale Res Lett (2010) 5:389–397 123 2WðO � C2H5Þ6��! 248nm CxWO3�y þ . . . 2VðO � C2H5Þ4��! 248nm CxVO2þy þ . . . ð3Þ When the same precursors are irradiated with the 248-nm beam from the KrF excimer laser, the W(OR)6...
Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field
International Nuclear Information System (INIS)
Mannhart, W.
1979-01-01
The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables
Total neutron cross sections of berkelium-249 and californium-249 below 100 eV
International Nuclear Information System (INIS)
Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.
1979-01-01
The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data
7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.
2010-01-01
... organizations throughout the world on subjects related to the development and operation of agricultural... Product Market Development Grant program (note to 7 U.S.C. 1621). (29) Administer the Agriculture... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Rural Business-Cooperative Service. 2...
47 CFR 90.248 - Wildlife and ocean buoy tracking.
2010-10-01
...) Classes of emission are limited to N0N, A1A, A2A, A2B, F1B, J2B, F2A, F2B, and/or F8E. (d) The authorized... temperature range of −30° to +50° centigrade at normal supply voltage and for a variation in the primary supply voltage from 85% to 115% of the rated supply voltage at a temperature of +20 °C. For battery...
All projects related to | Page 248 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Researchers are examining the tax policies (exemptions, value-added, property) constraining small and off-farm enterprises, especially those operated by ... Improving access to primary health care and the quality of services in Latin American countries is urgently needed to address high health inequities in the region.
17 CFR 248.124 - Reasonable opportunity to opt out.
2010-04-01
...” to indicate their opt out preference or that requires the consumer to check one of two blank check... affiliate to make marketing solicitations to a consumer about your products or services unless the consumer... a reasonable opportunity to opt out. The consumer is given a reasonable opportunity to opt out if...
International Nuclear Information System (INIS)
Liu, G.K.; Huang, J.; Beitz, J.V.
1993-01-01
Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system
Chelation and stabilization of berkelium in oxidation state +IV
Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.
2017-09-01
Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.
Operation manual for the INEL on-line mass-separator facility
International Nuclear Information System (INIS)
Anderl, R.A.
1984-06-01
This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables
Energy Technology Data Exchange (ETDEWEB)
Bringer, O
2007-10-15
This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)
Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses
International Nuclear Information System (INIS)
Hayet, Lucien; Petit, Pierre; Conche, Roger.
1976-01-01
Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr
Basic Hydrodynamics of Richtmyer-Meshkov-type Growth and Oscillations in the ICF-Relevant Conditions
2010-01-01
Washington, DC 20375 3ARTEP Inc ., Ellicott City, Maryland 21042 4Department of Mechanical Engineering, Ben Gurion University, Beer Sheva, Israel...the 56-beam Nike KrF laser facility at the Naval Research Laboratory (3 kJ in 0.248 μm, see Obenschain et al. 1996). Basic hydrodynamics of Richtmyer...2000 Nike (NRL) 0.248 8-13 4 400 40 30, 45 1.85 Si monochrom. Ablative RMI, feedout, classical RMI, impulsive loading, re- shock
DEFF Research Database (Denmark)
Stavrum, Ruth; PrayGod, George; Range, Nyagosya
2014-01-01
a distinct genetic ancestry. This study describes the genetic biodiversity of M. tuberculosis genotypes in Mwanza city, Tanzania and the clinical presentation of the disease caused by isolates of different lineages. METHODS: Two-hundred-fifty-two isolates from pulmonary TB patients in Mwanza, Tanzania were......BACKGROUND: There is increasing evidence to suggest that different Mycobacterium tuberculosis lineages cause variations in the clinical presentation of tuberculosis (TB). Certain M. tuberculosis genotypes/lineages have been shown to be more likely to cause active TB in human populations from....... tuberculosis lineage of the infectious agent for each patient. RESULTS: The most frequent genotype was ST59 (48 out of 248 [19.4%]), belonging to the Euro-American lineage LAM11_ZWE, followed by ST21 (CAS_KILI lineage [44 out of 248 [17.7%]). A low degree of diversity (15.7% [39 different ST's out of 248...
Zhang, Hua; Chen, Hongsheng; Luo, Hunjin; An, Jing; Sun, Lin; Mei, Lingyun; He, Chufeng; Jiang, Lu; Jiang, Wen; Xia, Kun; Li, Jia-Da; Feng, Yong
2012-03-01
Waardenburg syndrome (WS) is an auditory-pigmentary disorder resulting from melanocyte defects, with varying combinations of sensorineural hearing loss and abnormal pigmentation of the hair, skin, and inner ear. WS is classified into four subtypes (WS1-WS4) based on additional symptoms. PAX3 and SOX10 are two transcription factors that can activate the expression of microphthalmia-associated transcription factor (MITF), a critical transcription factor for melanocyte development. Mutations of PAX3 are associated with WS1 and WS3, while mutations of SOX10 cause WS2 and WS4. Recently, we identified some novel WS-associated mutations in PAX3 and SOX10 in a cohort of Chinese WS patients. Here, we further identified an E248fsX30 SOX10 mutation in a family of WS2. We analyzed the subcellular distribution, expression and in vitro activity of two PAX3 mutations (p.H80D, p.H186fsX5) and four SOX10 mutations (p.E248fsX30, p.G37fsX58, p.G38fsX69 and p.R43X). Except H80D PAX3, which retained partial activity, the other mutants were unable to activate MITF promoter. The H80D PAX3 and E248fsX30 SOX10 were localized in the nucleus as wild type (WT) proteins, whereas the other mutant proteins were distributed in both cytoplasm and nucleus. Furthermore, E248fsX30 SOX10 protein retained the DNA-binding activity and showed dominant-negative effect on WT SOX10. However, E248fsX30 SOX10 protein seems to decay faster than the WT one, which may underlie the mild WS2 phenotype caused by this mutation.
Huang, Kai-Fa; Wang, Yu-Ruei; Chang, En-Cheng; Chou, Tsung-Lin; Wang, Andrew H-J
2008-04-01
QCs (glutaminyl cyclases; glutaminyl-peptide cyclotransferases, EC 2.3.2.5) catalyse N-terminal pyroglutamate formation in numerous bioactive peptides and proteins. The enzymes were reported to be involved in several pathological conditions such as amyloidotic disease, osteoporosis, rheumatoid arthritis and melanoma. The crystal structure of human QC revealed an unusual H-bond (hydrogen-bond) network in the active site, formed by several highly conserved residues (Ser(160), Glu(201), Asp(248), Asp(305) and His(319)), within which Glu(201) and Asp(248) were found to bind to substrate. In the present study we combined steady-state enzyme kinetic and X-ray structural analyses of 11 single-mutation human QCs to investigate the roles of the H-bond network in catalysis. Our results showed that disrupting one or both of the central H-bonds, i.e., Glu(201)...Asp(305) and Asp(248)...Asp(305), reduced the steady-state catalysis dramatically. The roles of these two COOH...COOH bonds on catalysis could be partly replaced by COOH...water bonds, but not by COOH...CONH(2) bonds, reminiscent of the low-barrier Asp...Asp H-bond in the active site of pepsin-like aspartic peptidases. Mutations on Asp(305), a residue located at the centre of the H-bond network, raised the K(m) value of the enzyme by 4.4-19-fold, but decreased the k(cat) value by 79-2842-fold, indicating that Asp(305) primarily plays a catalytic role. In addition, results from mutational studies on Ser(160) and His(319) suggest that these two residues might help to stabilize the conformations of Asp(248) and Asp(305) respectively. These data allow us to propose an essential proton transfer between Glu(201), Asp(305) and Asp(248) during the catalysis by animal QCs.
Energy Technology Data Exchange (ETDEWEB)
Nour-Eldin, Nour-Eldin A.; Naguib, Nagy N.N.; Mack, Martin; Abskharon, John E.; Vogl, Thomas J. [Johann Wolfgang Goethe-University Hospital, Institute for Diagnostic and Interventional Radiology, Frankfurt am Main (Germany)
2011-01-15
To assess risk factors and the extent of pulmonary hemorrhage complicating radiofrequency ablation (RFA) of pulmonary neoplasms. This retrospective study involved 248 ablation sessions for lung tumors (20 primary lesions and 228 metastatic lesions) in 164 patients (mean age 59.7 years, SD: 10.2). Both unipolar and bipolar radiofrequency systems were used under CT fluoroscopic guidance. Extent and underlying factors associated with development of pulmonary hemorrhage were analyzed. Incidence of intra-parenchymal pulmonary hemorrhage, pleural effusion, and hemoptysis were 17.7% (44/248 sessions), 4% (8/248 sessions), and 16.1% (40/248 sessions), respectively. Death because of massive bleeding occurred in one session (0.4%). Significant risk factors associated with intra-parenchymal hemorrhage included: lesions of <1.5 cm diameter (P = 0.007); basal and middle lung zone lesions (P = 0.026); increased needle track distance traversing the lung parenchyma >2.5 cm (P = 0.0017); traversing pulmonary vessels in the track of ablation (P < 0.001); and the use of multi-tined electrodes (P = 0.004). Concomitant incidence of pulmonary hemorrhage and pneumothorax was 29.2% (14/48 sessions). While typically safe, RFA of pulmonary neoplasms can result in pulmonary hemorrhage ranging from mild to life-threatening. Management of this complication is mainly preventive through adequate patient selection for ablation therapy and exclusion of technically avoidable risk factors. (orig.)
International Nuclear Information System (INIS)
Brunson, G.S. Jr.
1982-06-01
An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented
Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K
2017-12-06
Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
2017-06-01
study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin
Photodissociation of ethylbenzene and n-propylbenzene in a molecular beam
Huang, Cheng-Liang; Jiang, Jyh-Chiang; Lee, Yuan T.; Ni, Chi-Kung
2002-10-01
The photodissociation of jet-cooled ethylbenzene and n-propylbenzene at both 193 and 248 nm was studied using vacuum ultraviolet photoionization/multimass ion imaging techniques. The photofragment translational energy distributions from both the molecules obtained at 193 nm show that the probability of portioning energy to product translational energy decreases monotonically with increasing translational energy. They indicate that the dissociation occurs from the ground electronic state. However, the photofragment translational energy distributions from both molecules obtained at 248 nm contain a fast and a slow component. 75% of ethylbenzene and 80% of n-propylbenzene following the 248 nm photoexcitation dissociate from electronic excited state, resulting in the fast component. The remaining 25% of ethylbenzene and 20% of n-propylbenzene dissociate through the ground electronic state, giving rise to the slow component. A comparison with an ab initio calculation suggests that the dissociation from the first triplet state corresponds to the fast component in translational energy distribution.
Erythrocytic ferroportin reduces intracellular iron accumulation, hemolysis, and malaria risk.
Zhang, De-Liang; Wu, Jian; Shah, Binal N; Greutélaers, Katja C; Ghosh, Manik C; Ollivierre, Hayden; Su, Xin-Zhuan; Thuma, Philip E; Bedu-Addo, George; Mockenhaupt, Frank P; Gordeuk, Victor R; Rouault, Tracey A
2018-03-30
Malaria parasites invade red blood cells (RBCs), consume copious amounts of hemoglobin, and severely disrupt iron regulation in humans. Anemia often accompanies malaria disease; however, iron supplementation therapy inexplicably exacerbates malarial infections. Here we found that the iron exporter ferroportin (FPN) was highly abundant in RBCs, and iron supplementation suppressed its activity. Conditional deletion of the Fpn gene in erythroid cells resulted in accumulation of excess intracellular iron, cellular damage, hemolysis, and increased fatality in malaria-infected mice. In humans, a prevalent FPN mutation, Q248H (glutamine to histidine at position 248), prevented hepcidin-induced degradation of FPN and protected against severe malaria disease. FPN Q248H appears to have been positively selected in African populations in response to the impact of malaria disease. Thus, FPN protects RBCs against oxidative stress and malaria infection. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
Directory of Open Access Journals (Sweden)
Dominique J. Monlezun
2018-01-01
Full Text Available Background. Cardiovascular disease (CVD annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world’s first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. Methods. This analysis provides a novel integration of artificial intelligence-based machine learning (ML with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. Results. 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00–2.28, p<0.001 and MedDiet adherence (OR 1.40, 95% CI 1.07–1.84, p=0.015, while reducing trainees’ soft drink consumption (OR 0.56, 95% CI 0.37–0.85, p=0.007. Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally (p<0.001. Discussion. This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students’ own diets. This
Dart, Lyn; Vanbeber, Anne; Smith-Barbaro, Peggy; Costilla, Vanessa; Samuel, Charlotte; Terregino, Carol A.; Abali, Emine Ercikan; Dollinger, Beth; Baumgartner, Nicole; Kramer, Nicholas; Seelochan, Alex; Taher, Sabira; Deutchman, Mark; Evans, Meredith; Ellis, Robert B.; Oyola, Sonia; Maker-Clark, Geeta; Budnick, Isadore; Tran, David; DeValle, Nicole; Shepard, Rachel; Chow, Erika; Petrin, Christine; Razavi, Alexander; McGowan, Casey; Grant, Austin; Bird, Mackenzie; Carry, Connor; McGowan, Glynis; McCullough, Colleen; Berman, Casey M.; Dotson, Kerri; Sarris, Leah; Harlan, Timothy S.; Co-investigators, on behalf of the CHOP
2018-01-01
Background Cardiovascular disease (CVD) annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world's first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. Methods This analysis provides a novel integration of artificial intelligence-based machine learning (ML) with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. Results 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00–2.28, p < 0.001) and MedDiet adherence (OR 1.40, 95% CI 1.07–1.84, p = 0.015), while reducing trainees' soft drink consumption (OR 0.56, 95% CI 0.37–0.85, p = 0.007). Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally (p < 0.001). Discussion This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students' own diets. This study suggests that
Monlezun, Dominique J; Dart, Lyn; Vanbeber, Anne; Smith-Barbaro, Peggy; Costilla, Vanessa; Samuel, Charlotte; Terregino, Carol A; Abali, Emine Ercikan; Dollinger, Beth; Baumgartner, Nicole; Kramer, Nicholas; Seelochan, Alex; Taher, Sabira; Deutchman, Mark; Evans, Meredith; Ellis, Robert B; Oyola, Sonia; Maker-Clark, Geeta; Dreibelbis, Tomi; Budnick, Isadore; Tran, David; DeValle, Nicole; Shepard, Rachel; Chow, Erika; Petrin, Christine; Razavi, Alexander; McGowan, Casey; Grant, Austin; Bird, Mackenzie; Carry, Connor; McGowan, Glynis; McCullough, Colleen; Berman, Casey M; Dotson, Kerri; Niu, Tianhua; Sarris, Leah; Harlan, Timothy S; Co-Investigators, On Behalf Of The Chop
2018-01-01
Cardiovascular disease (CVD) annually claims more lives and costs more dollars than any other disease globally amid widening health disparities, despite the known significant reductions in this burden by low cost dietary changes. The world's first medical school-based teaching kitchen therefore launched CHOP-Medical Students as the largest known multisite cohort study of hands-on cooking and nutrition education versus traditional curriculum for medical students. This analysis provides a novel integration of artificial intelligence-based machine learning (ML) with causal inference statistics. 43 ML automated algorithms were tested, with the top performer compared to triply robust propensity score-adjusted multilevel mixed effects regression panel analysis of longitudinal data. Inverse-variance weighted fixed effects meta-analysis pooled the individual estimates for competencies. 3,248 unique medical trainees met study criteria from 20 medical schools nationally from August 1, 2012, to June 26, 2017, generating 4,026 completed validated surveys. ML analysis produced similar results to the causal inference statistics based on root mean squared error and accuracy. Hands-on cooking and nutrition education compared to traditional medical school curriculum significantly improved student competencies (OR 2.14, 95% CI 2.00-2.28, p < 0.001) and MedDiet adherence (OR 1.40, 95% CI 1.07-1.84, p = 0.015), while reducing trainees' soft drink consumption (OR 0.56, 95% CI 0.37-0.85, p = 0.007). Overall improved competencies were demonstrated from the initial study site through the scale-up of the intervention to 10 sites nationally ( p < 0.001). This study provides the first machine learning-augmented causal inference analysis of a multisite cohort showing hands-on cooking and nutrition education for medical trainees improves their competencies counseling patients on nutrition, while improving students' own diets. This study suggests that the public health and medical sectors can
People and things. CERN Courier, Oct 1984, v. 24(8)
Energy Technology Data Exchange (ETDEWEB)
Anon.
1984-10-15
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved.
17 CFR 248.9 - Delivering privacy and opt out notices.
2010-04-01
... regarding the customer relationship, and your current privacy notice remains available to the customer upon... reasonably expect that a customer will receive actual notice of your annual privacy notice if: (i) The customer uses your web site to access financial products and services electronically and agrees to receive...
26 CFR 1.248-1 - Election to amortize organizational expenditures.
2010-04-01
... as drafting the corporate charter, by-laws, minutes of organizational meetings, terms of original stock certificates, and the like; necessary accounting services; expenses of temporary directors and of...
49 CFR 24.8 - Compliance with other laws and regulations.
2010-10-01
...—Equal Employment Opportunity, as amended. (j) Executive Order 11625—Minority Business Enterprise. (k) Executive Orders 11988—Floodplain Management, and 11990—Protection of Wetlands. (l) Executive Order 12250...
People and things. CERN Courier, Oct 1984, v. 24(8)
International Nuclear Information System (INIS)
Anon.
1984-01-01
The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved
ORF Alignment: NC_004369 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available YLESAHKIIIEVNSWQSLELEGMADIYRVPH 180 ... Query: 248 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM... 307 ... LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAGLLDSKFENIKAYTEVVQDGMLDLIDAGKM Sbjct: 241 LEGEVRAGRLTYDGYIMQSGVGNVPNAVMAG
Molecular beam studies of stratospheric photochemistry
Moore, Teresa Anne
1998-12-01
Photochemistry of chlorine oxide containing species plays a major role in stratospheric ozone depletion. This thesis discusses two photodissociation studies of the key molecules ClONO2 and ClOOCl which were previously thought to only produce Cl-atom (ozone depleting) products at wavelengths relevant to the stratosphere. The development of a molecular beam source of ClOOCl and the photodissociation dynamics of the model system Cl2O are also discussed. In the first chapter, the photochemistry of ClONO2 is examined at 308 nm using the technique of photofragment translational spectroscopy. Two primary decomposition pathways, leading to Cl + NO3 and ClO + NO2, were observed, with a lower limit of 0.33 for the relative yield of ClO. The angular distributions for both channels were anisotropic, indicating that the dissociation occurs within a rotational period. Chapter two revisits the photodissociation dynamics of Cl2O at 248 and 308 nm, on which we had previously reported preliminary findings. At 248 nm, three distinct dissociation pathways leading to Cl + ClO products were resolved. At 308 nm, the angular distribution was slightly more isotropic that previously reported, leaving open the possibility that Cl2O excited at 308 nm lives longer than a rotational period. Chapter three describes the development and optimization of a molecular beam source of ClOOCl. We utilized pulsed laser photolysis of ClA2O to generate ClO radicals, and cooled the cell to promote three body recombination to form ClOOCl. The principal components in the beam were Cl2, Cl2O, and ClOOCl. In the fourth chapter, the photodissociation dynamics of ClOOCl are investigated at 248 and 308 nm. We observed multiple dissociation pathways which produced ClO + ClO and 2Cl + O2 products. The relative Cl:ClO product yields are 1.0:0.13 and 1.0:0.20 for ClOOCl photolysis at 248 and 308 nm, respectively. The upper limit for the relative yield of the ClO + ClO channel was 0.19 at 248 nm and 0.31 at 308 nm
Matsuda, Makoto; Takeshita, Kohei; Kurokawa, Tatsuki; Sakata, Souhei; Suzuki, Mamoru; Yamashita, Eiki; Okamura, Yasushi; Nakagawa, Atsushi
2011-07-01
Ciona intestinalis voltage-sensing phosphatase (Ci-VSP) has a transmembrane voltage sensor domain and a cytoplasmic region sharing similarity to the phosphatase and tensin homolog (PTEN). It dephosphorylates phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol 3,4,5-trisphosphate upon membrane depolarization. The cytoplasmic region is composed of a phosphatase domain and a putative membrane interaction domain, C2. Here we determined the crystal structures of the Ci-VSP cytoplasmic region in three distinct constructs, wild-type (248-576), wild-type (236-576), and G365A mutant (248-576). The crystal structure of WT-236 and G365A-248 had the disulfide bond between the catalytic residue Cys-363 and the adjacent residue Cys-310. On the other hand, the disulfide bond was not present in the crystal structure of WT-248. These suggest the possibility that Ci-VSP is regulated by reactive oxygen species as found in PTEN. These structures also revealed that the conformation of the TI loop in the active site of the Ci-VSP cytoplasmic region was distinct from the corresponding region of PTEN; Ci-VSP has glutamic acid (Glu-411) in the TI loop, orienting toward the center of active site pocket. Mutation of Glu-411 led to acquirement of increased activity toward phosphatidylinositol 3,5-bisphosphate, suggesting that this site is required for determining substrate specificity. Our results provide the basic information of the enzymatic mechanism of Ci-VSP.
The significance of chromosome deletions in atomic-bomb survivors
International Nuclear Information System (INIS)
Tanaka, Kimio; Shigeta, Chiharu; Oguma, Nobuo; Kamada, Nanao; Deng, Z.; Niimi, Masanobu; Aisaka, Tadaichi.
1986-01-01
In 39 A-bomb survivors 40 years after exposure at ≤ 1,000 m from ground zero, the frequency and features of chromosome deletions in peripheral lymphocytes were examined using a differential staining technique. Simultaneously, in vitro irradiation experiment with Cf-252 was made to infer chromosome aberrations occuring immediately after exposure. Californium-252 with 100 rad induced dicentric and ring chromosomes in 40 % of the cells and acentric fragments in 44 %. Among the A-bomb survivors, chromosome aberrations were observed in 651 (21 %) of the total 3,136 cells. There were 146 cells with deletions (22 % of abnormal cells; 5 % of the total cells), and 10 cells with acentric fragment (0.3 % of the total cells). The figure for deletions was far higher than that reported in the literature. A large number of deletions were seen in chromosomes no.4, no.21, and no.22, and a few deletions in chromosomes no.7 and no.20. Significance of chromosome deletions is discussed. (Namekawa, K.)
International Nuclear Information System (INIS)
Bigelow, J.E.; Collins, E.D.; King, L.J.
1979-01-01
At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter
Dynamic vortex dust structures in a nuclear-track plasma
International Nuclear Information System (INIS)
Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E
2003-01-01
Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure
International Nuclear Information System (INIS)
Woodbury, F.B.W.
1980-12-01
The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed
A survey of uses and users of 252Cf
International Nuclear Information System (INIS)
Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.
1989-01-01
Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL
Reactor production of 252Cf and transcurium isotopes
International Nuclear Information System (INIS)
Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.
1990-01-01
Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Nuclear Chemistry Institute, Mainz University. Annual Report 1995
International Nuclear Information System (INIS)
Denschlag, H.O.
1996-03-01
The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de
Test and evaluation results of the 252Cf shuffler at the Savannah River Plant
International Nuclear Information System (INIS)
Crane, T.W.
1981-03-01
The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant
General purpose nuclear irradiation chamber
International Nuclear Information System (INIS)
Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah
2013-01-01
Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)
ORF Alignment: NC_003911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available RAVNFPTPVPDSAGIPPGVADQVLVAPFNDLEAVA 180 ... Query: 248 HYGVTPDIVTLGKVIGGGFPLAALGASARIMAHFDKGAVGGEGWLMQLGTLSGNPV...AAAA 307 ... HYGVTPDIVTLGKVIGGGFPLAALGASARIMAHFDKGAVGGEGWLMQLGTLSGNPVAAAA Sbjct: 241 HYGVTPDIVTLGKVIGGGFPLAALGASARIMA
ORF Alignment: NC_004369 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NAAEKIIIEVNSWQSADLEGMHDIWSMPK 180 ... Query: 248 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM 3...07 ... LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAGLLDSKFENIQAYTEVIQDGMVDLIDAGKM Sbjct: 241 LEGEVRAGRLSYDGYVMQSGVGNVPNAVMAG
Experiments on the interaction of intense femtosecond radiation with dense plasmas. Final report
International Nuclear Information System (INIS)
Rhodes, C.K.
1996-01-01
An upgraded KrF * (248 nm) system producing a pulse energy of ∼ 400 mJ, a pulse width of ∼ 220 fs, and focal intensities above 10 19 W/cm 2 , has been constructed, tested, operated, and used in experimental studies. The spatial morphology of channeled radiation in plasmas has been measured with a spatial resolution of ∼ 30 μm and damage studies of fused silica indicate that femtosecond (200 - 300 fs) 248 nm radiation has a damage limit not exceeding ∼ 50 GW/cm 2 , an unfavorably low level. 2 figs
ORF Alignment: NC_004757 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 212 ... Query: 189 LSGKRVLVTAGPTFEALDAVRGLTNLSSGKTXXXXXXXXXXXXXXVTLVCGPVCPPFPAV 248 ... LSGKRVLVTAGPTFE...ALDAVRGLTNLSSGKT ... VTLVCGPVCPPFPAV Sbjct: 1 ... LSGKRVLVTAGPTFE
ORF Alignment: NC_002940 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NIIGVKEATGDLTRLPLIKTLAGEDFI 180 ... Query: 248 LFIEANPIPVKWAAYKLGLISEPSLRLPLTPLSETAQPTILKALQKAGL 296 ... LFIEANPIPVKWAAYKLGLISEPS...LRLPLTPLSETAQPTILKALQKAGL Sbjct: 241 LFIEANPIPVKWAAYKLGLISEPSLRLPLTPLSETAQPTILKALQKAGL 289
ORF Alignment: NC_006350 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DKALAQLFPEFSRSRLQQWIESDRVRVSGAPAKIRQPVPLGATIELLPELLPEQLAFT 60 ... Query: 189 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERT...R 248 ... DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR... Sbjct: 121 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR 180 ... Query: 30
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available VPATRSNISFVDGKAGVLEYRGIPIDQLAESSTFLETAFLLIFDHLPTKDELLSFE 60 ... Query: 128 AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFD...VCLMLHAEHT 187 ... AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFDVCLMLHAEHT Sbjct: ...121 AKMPTMVATFHQMRLGNDPIPPRDDLGHAANFLYMLTGKEPDPRAARIFDVCLMLHAEHT 180 ... Query: 248
ORF Alignment: NC_006348 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available DKALAQLFPEFSRSRLQQWIESDRVRVSGAPAKIRQPVPLGATIELLPELLPEQLAFT 60 ... Query: 189 DKETSGLMVVARTLAAQTDLVRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERT...R 248 ... DKETSGLMVVARTLAAQTDL+RQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR... Sbjct: 121 DKETSGLMVVARTLAAQTDLIRQLQARTVKRRYFALAWGRMPDEGTIDAPIGRDPRERTR 180 ... Query: 30
Magnetic susceptibility of curium pnictides
International Nuclear Information System (INIS)
Nave, S.E.; Huray, P.G.; Peterson, J.R.; Damien, D.A.; Haire, R.G.
1981-09-01
The magnetic susceptibility of microgram quantities of 248 CmP and 248 CmSb has been determined with the use of a SQUID micromagnetic susceptometer over the temperature range 4.2 to 340 K and in the applied magnetic field range of 0.45 to 1600 G. The fcc (NaCl-type) samples yield magnetic transitions at 73K and 162 K for the phosphide and antimonide, respectively. Together with published magnetic data for CmN and CmAs, these results indicate spatially extended exchange interactions between the relatively localized 5f electrons of the metallic actinide atoms
Bragg Grating Inscription With Low Pulse Energy in Doped Microstructured Polymer Optical Fibers
DEFF Research Database (Denmark)
Min, Rui; Ortega, Beatriz; Nielsen, Kristian
2018-01-01
in the POFs without high pulse energy (mJ level) at 248-nm wavelength, which reduces maintenance costs. Furthermore, we can consider it as a solution to increase the lifetime of the laser system without high energy still allowing fast and efficient production of the FBGs for sensing applications.......We demonstrate that fiber Bragg gratings (FBGs) can be written in a doped polymer optical fiber (POF) in a low ultraviolet (UV) pulse energy regime (60Jpulse) using a 248-nm krypton fluoride excimer laser system. The total energy density per inscription necessary to obtain Bragg gratings is between...
International Nuclear Information System (INIS)
Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.
1981-01-01
Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less
International Nuclear Information System (INIS)
Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.
1981-01-01
Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less
ORF Alignment: NC_003450 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available EITRITEEGYIIPSSSVGNNVEWLNAAEKVILEVNSWQSEDLEGMHDIWSVPA 180 ... Query: 248 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFE...NIQAYTEVIQDGMVDLIDAGKM 307 ... LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAY...TEVIQDGMVDLIDAGKM Sbjct: 241 LESEVAAGRLSYDGYIMQSGVGNVPNAVMAGLLESKFENIQAYTEVIQDGMVDLIDAGKM 300 ... Query: 368 GN
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 248 ... [Chromobacterium violaceum ATCC 12472] ... Length = 120 ... Query: 1146 LRVLLVEDDAINREVA...QALLQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD 1205 ... LRVLLVEDDAINREVAQAL...LQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD Sbjct: 1 ... LRVLLVEDDAINREVAQALLQDVGLEADMAENGKIAVERVQAAPARYALILMDVQMPEMD 60 ...
ORF Alignment: NC_002939 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available FliM ... [Geobacter sulfurreducens PCA] ... Length = 79 ... Query: 248 RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP 307 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLT...VKVGGVPKFTGMP Sbjct: 1 ... RLSKELLEAPLDVSVEVGGAVISLNDLLSLVPGDTIMLDTPCTSDLTVKVGGVPKFTGMP 60 ...
ORF Alignment: NC_006177 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available beta ... subunit [Symbiobacterium thermophilum IAM 14863] ... Length = 248 ... Query: 3 ... RAATWETWRPDPANTRQHVAMLVDTSECI...GCKGCEVACKQWNQNEARINQDPGTYQSHPA 62 ... RAATWETWRPDPANTRQHVAMLVDTSECI...GCKGCEVACKQWNQNEARINQDPGTYQSHPA Sbjct: 1 ... RAATWETWRPDPANTRQHVAMLVDTSECIGCKGCEVACKQWNQNEARI
Photochemical and Spectroscopic Effects Resulting from Excimer Laser Excitation.
Wang, Xuan Xiao
I. Photochemical production of ozone from pure oxygen using excimer lasers. Production of ozone was observed from experiments when oxygen was under a broadband pulsed KrF laser radiation. The production process was found to be autocatalytic. Mechanisms for the ozone formation were proposed. Experimental results over a range of oxygen pressure and laser pulse energy (irradiance) provided evidences in favor of the proposed mechanisms. Experiments were also numerically modeled. Good agreement between the experimental and the numerical results were observed, which provided further evidence to support the proposed mechanisms. Cross sections for some photochemical processes in the mechanisms were estimated. Production of ozone from pure oxygen under a ArF excimer laser radiation (193 nm) was also studied and numerically modeled. Effects of ambient water vapor on ozone production were investigated. Experimental results showed a fast ozone destruction when water vapor was present in the cell. However, numerical results obtained from the well-known OH and HO _2 chain ozone destruction mechanism predicted a slower ozone destruction. Possible reasons for the discrepancy are discussed. II. Resonance-enhanced multiphoton ionization of N_2 at 193 and 248 nm detected by N_sp{2}{+} fluorescence. Using a broadband excimer laser operating at 193 and 248 nm multiphoton ionization at high pressures in air and pure nitrogen has been detected by fluorescence from N_sp{2}{+} in the B-X firstnegative system. Measurements of the fluorescence intensity as a function of beam irradiance indicate resonance in N_2 at the energy of two 193 nm photons (2 + 1 REMPI) and three 248 nm photons (3 + 1 REMPI). Possible intermediate states are discussed. III. Excimer laser-induced fluorescence from some organic solvents. Fluorescence was observed from vapor phase benzene, toluene, p-xylene, benzyl chloride, methyl benzoate, acetic anhydride, ether, methanol, ethyl acetone, acetone, and 2-butanone using
Directory of Open Access Journals (Sweden)
Claudia Farb
2010-10-01
Full Text Available Norepinephrine (NE is thought to play a key role in fear and anxiety, but its role in amygdala-dependent Pavlovian fear conditioning, a major model for understanding the neural basis of fear, is poorly understood. The lateral nucleus of the amygdala (LA is a critical brain region for fear learning and regulating the effects of stress on memory. To understand better the cellular mechanisms of NE and its adrenergic receptors in the LA, we used antibodies directed against dopamine beta-hydroxylase (DβH, the synthetic enzyme for NE, or against two different isoforms of the beta-adrenergic receptors (βARs, one that predominately recognizes neurons (βAR 248 and the other astrocytes (βAR 404, to characterize the microenvironments of DβH and βAR. By electron microscopy, most DβH terminals did not make synapses, but when they did, they formed both asymmetric and symmetric synapses. By light microscopy, βARs were present in both neurons and astrocytes. Confocal microscopy revealed that both excitatory and inhibitory neurons express βAR248. By electron microscopy, βAR 248 was present in neuronal cell bodies, dendritic shafts and spines, and some axon terminals and astrocytes. When in dendrites and spines, βAR 248 was frequently concentrated along plasma membranes and at post-synaptic densities of asymmetric (excitatory synapses. βAR 404 was expressed predominately in astrocytic cell bodies and processes. These astrocytic processes were frequently interposed between unlabeled terminals or ensheathed asymmetric synapses. Our findings provide a morphological basis for understanding ways in which NE may modulate transmission by acting via synaptic or non-synaptic mechanisms in the LA.
24 CFR 248.121 - Annual authorized return and aggregate preservation rents.
2010-04-01
... for the project, assuming a market rate of interest and customary terms; (3) Debt service on the... rehabilitation loan for the project, assuming a market rate of interest and customary terms; (3) Debt service on... local governments and assuming market rate interest rates. ...
19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.
2010-04-01
... production. The inventory records must reflect the production of the finished article which must be... HOMELAND SECURITY; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Apparel and Other Textile Articles Under the Andean Trade...
17 CFR 248.6 - Information to be included in privacy notices.
2010-04-01
... examples to illustrate the types of third parties in each category: (i) Financial service providers; (ii) Non-financial companies; and (iii) Others. (4) Disclosures under exception for service providers and... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and...
S248. RELATION BETWEEN CHILDHOOD TRAUMA AND PSYCHOTIC SYMPTOMS IN SCHIZOPHRENIA
Larnaout, Amine; Nefzi, Rahma; Aissa, Amina; Trabelsi, Rouaa; Hechmi, Zouhaier El
2018-01-01
Abstract Background There is renewed interest in the relationship between early childhood trauma and risk of psychosis in adulthood. Trauma and stressful events in childhood and adolescence are known to be more prevalent among individuals with schizophrenia and other psychotic disorders than in the general population. Furthermore, other findings support the role of childhood trauma as a socio-environmental risk factor for psychotic symptoms, and research on the potential etiological relationship between trauma/stressful events in childhood/adolescence and psychotic disorders is evolving. The aim of the current study was to examine relations among all items and domains of childhood trauma and schizophrenic symptoms in patients with schizophrenia. The relationship between types of trauma and their association with psychotic symptoms was analysed. Methods In this study, we collected data from 50 schizophrenic patients (39 males and 11 females). All patients met the DSM 5 criteria for schizophrenia. Psychotic symptoms were measured by the Positive and Negative Syndrome Scale (PANSS). Trauma and stressful events in childhood and adolescence were assessed using the Childhood Trauma Questionnaire (CTQ). Results We found significant correlations between emotional and sexual abuse, emotional neglect and denial scale in CTQ with positive symptoms of the PANSS (pagressive behaviours was also described in litterature. These results went along with the stress sensitization model where the HPA axis is over-active and excessively reactive to the subsequent environemental stressors causing positive symptoms of the disease.
DNA damage in cultured human skin fibroblasts exposed to excimer laser radiation
Energy Technology Data Exchange (ETDEWEB)
Rimoldi, D.; Miller, A.C.; Freeman, S.E.; Samid, D. (Department of Pathology, Uniformed Services University of the Health Sciences, Bethesda, MD (USA))
1991-06-01
Ultraviolet excimer lasers are being considered for use in a variety of refractive and therapeutic procedures, the long-term biologic consequences of which are unknown. The effect of sublethal doses of 193-nm laser radiation on cellular DNA was examined in cultured human skin fibroblasts. In contrast to 248 nm, treatments with the 193-nm laser radiation below 70 J/m2 did not cause significant pyrimidine dimer formation in the skin cells. This was indicated by the lack of excision repair activities (unscheduled DNA synthesis assay), and further demonstrated by direct analysis of pyrimidine dimers in DNA from irradiated cells. However, a low level of unscheduled DNA synthesis could be detected following irradiation at 193 nm with 70 J/m2. Both the 193-nm and 248-nm radiation were able to induce chromosomal aberrations, as indicated by a micronucleus assay. A dose-dependent increase in micronuclei frequency was observed 48 and 72 h after laser irradiation. These results indicate that exposure of actively replicating human skin fibroblasts to sublethal doses of either 193- or 248-nm laser radiation can result in genotoxicity.
Choice of the laser wavelength for a herpetic keratitis treatment
Razhev, Alexander M.; Bagayev, Sergei N.; Chernikh, Valery V.; Kargapoltsev, Evgeny S.; Trunov, Alexander; Zhupikov, Andrey A.
2002-06-01
For the first time the effect of the UV laser radiation to human eye cornea with herpetic keratitis was experimentally investigated. In experiments the UV radiation of ArF (193 nm), KrCl (223 nm), KrF (248 nm) excimer lasers were used. Optimal laser radiation parameters for the treatment of the herpetic keratitis were determined. The immuno-biochemical investigations were carried out and the results of clinical trials are presented. The maximum ablation rate was obtained for the 248 nm radiation wavelength. The process of healing was successful but in some cases the haze on the surface of the cornea was observed. When used the 193 nm radiation wavelength the corneal surface was clear without any hazes but the epithelization process was slower than for 248 nm wavelength and in some cases the relapse was occurred. The best results for herpetic keratitis treatment have been achieved by utilizing the 223 nm radiation wavelength of the KrCl excimer laser. The use of the 223 nm radiation wavelength allows treating the herpetic keratitis with low traumatic process of ablation and provides high quality of corneal surface.
Sheng, Xueru; Li, Ning; Li, Guangyi; Wang, Wentao; Wang, Aiqin; Cong, Yu; Wang, Xiaodong; Zhang, Tao
2017-03-09
For the first time, we demonstrated two integrated processes for the direct synthesis of dodecanol or 2,4,8-trimethylnonane (a jet fuel range C 12 -branched alkane) using methyl isobutyl ketone (MIBK) that can be derived from lignocellulose. The reactions were carried out in dual-bed continuous flow reactors. In the first bed, MIBK was selectively converted to a mixture of C 12 alcohol and ketone. Over the Pd-modified magnesium- aluminium hydrotalcite (Pd-MgAl-HT) catalyst, a high total carbon yield (73.0 %) of C 12 oxygenates can be achieved under mild conditions. In the second bed, the C 12 oxygenates generated in the first bed were hydrogenated to dodecanol over a Ru/C catalyst or hydrodeoxygenated to 2,4,8-trimethylnonane over a Cu/SiO 2 catalyst. The as-obtained dodecanol can be used as feedstock in the production of sodium dodecylsulfate (SDS) and sodium dodecyl benzene sulfonate (SDBS), which are widely used as surfactants or detergents. The asobtained 2,4,8-trimethylnonane can be blended into conventional jet fuel without hydroisomerization. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Tracing Method with Intra and Inter Protocols Correlation
Directory of Open Access Journals (Sweden)
Marin Mangri
2009-05-01
Full Text Available MEGACO or H.248 is a protocol enabling acentralized Softswitch (or MGC to control MGsbetween Voice over Packet (VoP networks andtraditional ones. To analyze much deeper the realimplementations it is useful to use a tracing systemwith intra and inter protocols correlation. For thisreason in the case of MEGACO-H.248 it is necessaryto find the appropriate method of correlation with allprotocols involved. Starting from Rel4 a separation ofCP (Control Plane and UP (User Plane managementwithin the networks appears. MEGACO protocol playsan important role in the migration to the new releasesor from monolithic platform to a network withdistributed components.
Energy Technology Data Exchange (ETDEWEB)
Morelli, J.; Kibbi, A.G.; Farinelli, W.; Boll, J.; Tan, O.T.
1987-06-01
Multiple dermatologic conditions that are currently treated with traditional cold-knife surgery are amenable to laser therapy. The ideal surgical treatment would be precise and total removal of abnormal tissue with maximal sparing of remaining structures. The ultraviolet (UV) excimer laser is capable of such precise tissue removal due to the penetration depth of 193 nm and 248 nm irradiation of 1 micron per pulse. This type of ablative tissue removal requires a high repetition rate for efficient lesional destruction. Excimer laser radiation at 193 nm is capable of high repetition rates, which are necessary while 248 nm radiation causes increasing nonspecific thermal injury as the laser repetition rate is increased.
DEFF Research Database (Denmark)
Karlshøj, Stefanie; Amarandi, Roxana Maria; Larsen, Olav
2016-01-01
The small molecule metal ion chelators bipyridine and terpyridine complexed with Zn(2+) (ZnBip and ZnTerp) act as CCR5 agonists and strong positive allosteric modulators of CCL3 binding to CCR5, weak modulators of CCL4 binding, and competitors for CCL5 binding. Here we describe their binding site......Terp binds deeply in the major binding pocket and, in contrast to ZnBip, interacts directly with the Trp-248(VI:13/6.48) microswitch, contributing to its 8-fold higher potency. The impact of Trp-248 was further confirmed by ZnClTerp, a chloro-substituted version of ZnTerp that showed no inherent agonism...
UV, visible and IR laser interaction with gelatine
International Nuclear Information System (INIS)
Oujja, M; Rebollar, E; Abrusci, C; Amo, A Del; Catalina, F; Castillejo, M
2007-01-01
In this work we investigate the effects on gelatine films of nanosecond pulsed laser irradiation at different laser wavelengths from the UV to the IR at 248, 266, 355, 532 and 1064 nm. We compared gelatines differing in gel strength values (Bloom 75 and 225) and in crosslinking degree. Formation of bubbles at the wavelengths in the UV (248 and 266 nm), melting and resolidification at 355 nm, and formation of craters by ablation in the VIS and IR (532 and 1064 nm) are the observed morphological changes. On the other hand, changes of the fluorescence behaviour of the films upon UV irradiation reveal chemical modifications of photolabile chromophores
Aparcana Díaz, José Alfredo
2013-01-01
El objetivo se centró en determinar si se asocia el conocimiento que poseen los padres sobre hábitos bucales deformantes y traumas dentales con las alteraciones bucales en niños de 4 a 10 años de edad de la I.E. Nuestros Héroes de la Guerra del Pacífico del distrito de Tacna en el periodo 2012. El diseño fue no experimental, descriptivo transversal y de asociación. La población de estudio, fueron 248 padres y 248 hijos/as escolares de 4 a 10 años. Se utilizó un test de conocimientos de ...
ORF Alignment: NC_003902 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available PEQAIRDAGYGVIWQGQRSW 60 ... Query: 128 KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 187 ... ... ... KWFQRLLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA Sbjct: 121 KWFQR...LLRHAATLVALPHPVALIGDFNVVPTDAHIYDPKGWRKDALLQPESRAAYAQLLA 180 ... Query: 248 EKASDHAPTWI 258 ... EKASDHAPTWI Sbjct: 241 EKASDHAPTWI 251
In-situ elemental analysis of coal by neutron activation
International Nuclear Information System (INIS)
Mikesell, J.L.; Senftle, F.E.; Tanner, A.B.
1986-01-01
The U.S. Geological Survey (USGS) has worked to develop neutron techniques for the borehole measurement of the elemental composition of ores since 1969, and first demonstrated a borehole ultimate analysis of coal in 1977. Borehole measurements such as these permit real-time evaluation of coal quality without the expense of coring or the delays associated with laboratory analyses. Two technological innovations make such measurements possible: the availability, from Savannah River Operations Office, DOE, of small californium-252 (/sup 252/Cf) fission neutron sources, and the development, by USGS and Princeton Gamma-Techn, of the melting-cryogen-cooled high-purity germanium borehole gamma-ray detector. A technique of relating mass fractions to measured gamma-ray intensities, which eliminates the need for detailed knowledge of the geometry of the neutron distribution, is used to calculate elemental compositions without resorting to the test pits or computer borehole modeling. In coal, all of the major constituents (C, H, N, S, Si, Al, Fe, Ti) except oxygen can be determined quantitatively by thermal neutron capture gamma-ray spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)
2011-10-06
A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.
International Nuclear Information System (INIS)
Brunelle, A.
1990-09-01
A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets [fr
International Nuclear Information System (INIS)
Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.
1987-01-01
Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated
Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors
Energy Technology Data Exchange (ETDEWEB)
Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)
2016-10-21
A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.
[Fast neutron cross section measurements]: Progress report
International Nuclear Information System (INIS)
1988-01-01
As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs
International Nuclear Information System (INIS)
Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.
2012-01-01
The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)
Measurement of neutron dose and spectra at light-water reactors
International Nuclear Information System (INIS)
Soldat, K.L.; Endres, G.W.R.; Cummings, F.M.
1982-08-01
In choosing one dosimeter over another, both sensitivity and precision must be addressed. It has been determined that dosimeters employing NTA film lack adequate sensitivity for use inside containment of nuclear plants. From this study, it is apparent that CR-39 and polycarbonate track etch films used without radiators are also inadequate. The rest of the dosimeters tested displayed adequate sensitivity. The two general types of dosimeters which comprise that group are: (1) TLDs and (2) the polycarbonate track etch which was used in conjunction with (n, α) radiators. The precision of the TLD dosimeter depends on the calibration technique and response correction technique. TLD dosimeters calibrated to D 2 O-moderated californium-252 or corrected based on 9- to 3-in. sphere response rates seemed to function best inside reactor containment. Polycarbonate track etch film with (n, α) radiators was found to be sensitive enough for use inside reactor containment; however, the standard deviation for the results was roughly twice the value of the most precise TLD albedo dosimeters. Also, several of the polycarbonate dosimeters saturated, rendering any evaluation impossible
Development of an analytical theory to describe the PNAR and CIPN nondestructive assay techniques
International Nuclear Information System (INIS)
Bolind, Alan Michael
2014-01-01
Highlights: • Neutron albedo is modeled by a discrete and iterative reflection process. • The theory enables the PNAR and CIPN NDA techniques to be compared quantitatively. • Improvements to the data analysis and to the CIPN instrument design are suggested. • A correction to translate real no-reflection PNAR data into ideal data is provided. - Abstract: This paper develops an analytical theory to describe how neutron albedo (reflection) increases the multiplication of neutrons by a used fuel assembly. With this theory, the two nondestructive assay (NDA) techniques of Passive Neutron Albedo Reactivity (PNAR) and Californium-252 Interrogation with Prompt Neutron Detection (CIPN) can be compared directly. Specifically, the theory derives expressions for the PNAR and CIPN metrics in terms of the physical properties of the used fuel assembly, such as the neutron multiplications and fate probabilities. The theory thus clarifies the interpretation of these two NDA techniques and suggests ways to improve both the design of the NDA instruments and the algorithms for analyzing the measurement results
Robotics at Savannah River site: activity report
International Nuclear Information System (INIS)
Byrd, J.S.
1984-09-01
The objectives of the Robotics Technology Group at the Savannah River Laboratory are to employ modern industrial robots and to develop unique automation and robotic systems to enhance process operations at the Savannah River site (SRP and SRL). The incentives are to improve safety, reduce personnel radiation exposure, improve product quality and productivity, and to reduce operating costs. During the past year robotic systems have been installed to fill chemical dilution vials in a SRP laboratory at 772-F and remove radioactive waste materials in the SRL Californium Production Facility at 773-A. A robotic system to lubricate an extrusion press has been developed and demonstrated in the SRL robotics laboratory and is scheduled for installation at the 321-M fuel fabrication area. A mobile robot was employed by SRP for a radiation monitoring task at a waste tank top in H-Area. Several other robots are installed in the SRL robotics laboratories and application development programs are underway. The status of these applications is presented in this report
Efficiency of interaction between various radiation and chemicals
International Nuclear Information System (INIS)
Kim, Jin Kyu; Song, H. S.; Kim, J. S.; Chun, K. J.; Lee, Y. K.; Lee, B. H.; Shin, H. S.; Lee, K. H.; Petin, Vladislav G.
2002-01-01
KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland
Separation of Am-Cm from Al(NO3)3 waste solutions by in-canyon-tank precipitation as oxalates
International Nuclear Information System (INIS)
Gray, L.W.; Burney, G.A.; Wilson, T.W.; McKibben, J.M.; Bibler, N.E.; Holtzscheiter, E.W.; Campbell, T.G.
1982-04-01
A process for recovery of Am-Cm residues from high-activity waste concentrates has been developed specifically for application in Savannah River Plant (SRP) canyon tanks. The Am-Cm residues were collected from a campaign to produce plutonium containing high isotopic concentrations of 242 Pu. The separation of Am-Cm from the high-activity waste stream, containing about 2M Al(NO 3 ) 3 , is necessary to produce an acceptable feed solution for a later pressurized cation exchange chromatography separation and purification step. The new process includes formic acid denitration, adjustment of contaminating cations by evaporation and water dilution, and oxalate precipitation of the actinides and lanthanides. After washing, the precipitate was dissolved in 8M nitric acid and the oxalate was destroyed by nitric acid oxidation that was catalyzed by manganous ions. This new process generates about one-fourth the waste of the californium solvent extraction process, which it replaced. The new process also produces a cleaner feed solution for the pressurized cation exchange chromatography separation and purification step
Fabrication of intense neutron sources for medical applications
International Nuclear Information System (INIS)
Boulogne, A.R.; Walker, V.W.
1975-01-01
Simulated sources containing 252 Cf equivalents of 0.1 to 1.0 milligrams were prepared. Samarium was used as the simulant in a modified chemical plating technique similar to that used to prepare palladium-californium oxide cermet for industrial applications. The length of the platinum-10 percent iridium doubly encapsulated source with its protective sheath is 0.545 in. (14.1 mm). Outside dia of the source, including its sheath, is 0.109 in. (2.8 mm). Existing ''Brachytrons'' can accommodate this source form. This capsule system will withstand internal gas pressures from helium due to alpha decay and fission gases from a 1 mg 252 Cf source after ten years if the source is subjected to a maximum temperature of 800 0 C, the theoretical temperature of an accidental fire. Under these conditions the safety factor is 3. The capsule system is being tested with tracer amounts of 252 Cf to ensure that it will withstand adverse service conditions as well as tests specified for Special Form Materials. (auth)
International Nuclear Information System (INIS)
Vasil'ev, Yu.A.; Barashkov, Yu.A.; Golovanov, O.A.; Sidorov, L.V.
1977-01-01
A method for determining the average number of secondary neutrons anti ν produced in nuclear fission by the neutrons of the 252 Cf fission spectra by means of a 4π time-of-flight spectrometer is described. Layers of 252 Cf and an isotope studied are placed close to each other; if the isotope layer density is 1 mg/cm 2 probability of its fission is about 10 -5 per one spontaneous fission of californium. Fission fragments of 252 Cf and the isotope investigated have been detected by two surface-barrier counters with an efficiency close to 100%. The layers and the counters are situated in a measuring chamber placed in the center of the 4π time-of-flight spectrometer. The latter is utilized as a neutron counter because of its fast response. The method has been verified by carrying out measurements for 235 U and 239 Pu. A comparison of the experimental and calculated results shows that the method suggested can apply to determine the number of secondary neutrons in fission of isotopes that have not been investigated yet
B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model
International Nuclear Information System (INIS)
Nayak, R.C.; Pattnaik, S.
2015-01-01
We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2 + state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)
Reprocessing of nuclear fuels at the Savannah River Plant
International Nuclear Information System (INIS)
Gray, L.W.
1986-01-01
For more than 30 years, the Savannah River Plant (SRP) has been a major supplier of nuclear materials such as plutonium-239 and tritium-3 for nuclear and thermonuclear weapons, plutonium-238 for space exploration, and isotopes of americium, curium, and californium for use in the nuclear research community. SRP is a complete nuclear park, providing most of the processes in the nuclear fuel cycle. Key processes involve fabrication and cladding of the nuclear fuel, target, and control assemblies; rework of heavy water for use as reactor moderator; reactor loading, operation, and unloading; chemical recovery of the reactor transmutation products and spent fuels; and management of the gaseous, liquid, and solid nuclear and chemical wastes; plus a host of support operations. The site's history and the key processes from fabrication of reactor fuels and targets to finishing of virgin plutonium for use in the nuclear weapons complex are reviewed. Emphasis has been given to the chemistry of the recovery and purification of weapons grade plutonium from irradiated reactor targets
Hoke, Forney M.
Papers on the testing and evaluation of IR detectors and arrays are presented, covering topics such as a short wavelength IR test system, pulse height analysis, the use of an expert system for IR detector testing, low-background IR focal plane testing, electron beam testing, high performance silicide Schottky photodiodes, the SDI organization focal plane test program, the absorption cross section of arsenic in silicon, and long wavelength IR hybrids. Other topics include low background radiometric detector measurements, an ultralow background dewar for IR detector characterization studies, a computer assisted mosaic array test station, a configurable detector array test station, automated detector material characterization capabilities, and a test system for mercury cadmium telluride photoconductor arrays. Additional topics include ionization dosimetry measurements inside a dewar for linac electron and californium-252 neutron environments, a radiation test facility using a variable-flux electron beam source, automated visual inspection of IR focal plane arrays, a titanium cryostat for low temperature radiation effects studies, a low dose rate gamma test facility, and the test and evaluation of stability in IR staring focal plane arrays after nonuniformity correction.
Dust vortices, clouds, and jets in nuclear-induced plasmas
International Nuclear Information System (INIS)
Vladimirov, V.I.; Deputatova, L.V.; Nefedov, A.P.; Fortov, V.E.; Rykov, V.A.; Khudyakov, A.V.
2001-01-01
The collective movement of dust particles in a plasma formed during deceleration of decay products of californium nuclei in neon is investigated experimentally. For the first time, compact vortex structures containing a large number of coagulating dust particles and dense dust clouds evolving in time are observed. Dust formations have clearly defined boundaries and particles in them form ordered liquid-type structures. Under steady-state conditions, dust structures exist from several minutes to hours. An increase in the voltage applied to the high-voltage electrode leads to the formation of dust particle jets. A change in the electric field configuration transforms the structures from one type to another. A strong recombination of electrons and ions at dust particles is observed. The momentum transfer from ions drifting in an external field to gas molecules is studied using the Monte Carlo method. It is shown that the transferred momentum is so large that it may cause a gas flow. The characteristic features of vortex flow in neon and in air are explained
Glasses impregnated with lead for radiation shielding
International Nuclear Information System (INIS)
Abd El Monem, A.M.; Kansouh, W.A.; Megahid, R.M.; Ismail, A.L.; Awad, E.M.
2005-01-01
The attenuation properties of glasses with different concentration of lead have been investigated for the attenuation of gamma-rays from cesium-137 and for total gamma rays using a beam of neutrons and gamma rays emitted from californium-252 source. Measurements have been performed using a gamma-ray spectrometer with Nal(T1) detector for gamma-rays emitted from 137 Cs and a neutron/gamma spectrometer with stilbene scintillator for measurement of total gamma-rays from 252 Cf neutron source. The latter applied the pulse shape discrimination technique to distinguish between recoil proton and recoil electron pulses. The obtained results given the form displayed pulse height spectra and attenuation relations which were used to derive the linear attenuation coefficient (μ), and the mass attenuation coefficient (mu/p) of the investigated glasses. In addition, calculations were performed to determine the attenuation properties of glass shields under investigation using XCOM code given by the others. A comparison of the shielding properties of these glasses with some standard shielding materials indicated that, the investigated glasses process the shielding advantages required for different nuclear technology applications
Calibration techniques and results for the Portsmouth Cf shuffler
International Nuclear Information System (INIS)
Gross, J.C.; Wines, K.M.
1993-01-01
As environmental concerns over radioactive waste disposal continue to rise, the importance of Californium shufflers as a versatile waste monitoring and segregation instrument also continue to increase. The extent to which different amounts and types of materials can be measured by the shuffler is directly related to the extent of its calibration. As shufflers become more common place and their waste management uses also rise, the importance of a wide ranging and thorough calibration becomes critical. This paper presents the techniques used at the Portsmouth Gaseous Diffusion Plant for calibrating the shuffler to detect levels of U-235 in radioactive waste. While the calibration techniques are similar to those used by Los Alamos, the standards that were used were constructed somewhat differently so that geometric effects are maximized. Also presented are shuffler transmission measurements that are used to determine the matrix type and the corresponding calibration. A discussion of the calibration data is given. This discussion includes specific aspects of the calibration such as overall range, high end limits, and poly shielding range and usefulness
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
Kibbey, Megan M; Jameson, Mark J; Eaton, Erin M; Rosenzweig, Steven A
2006-03-01
Signaling by the insulin-like growth factor (IGF)-1 receptor (IGF-1R) has been implicated in the promotion and aggressiveness of breast, prostate, colorectal, and lung cancers. The IGF binding proteins (IGFBPs) represent a class of natural IGF antagonists that bind to and sequester IGF-1/2 from the IGF-1R, making them attractive candidates as therapeutics for cancer prevention and control. Recombinant human IGFBP-2 significantly attenuated IGF-1-stimulated MCF-7 cell proliferation with coaddition of 20 or 100 nM IGFBP-2 (50 or 80% inhibition, respectively). We previously identified IGF-1 contact sites both upstream and downstream of the CWCV motif (residues 247-250) in human IGFBP-2 (J Biol Chem 276:2880-2889, 2001). To further test their contributions to IGFBP-2 function, the single tryptophan in human IGFBP-2, Trp-248, was selectively cleaved with 2-(2'nitrophenylsulfenyl)-3-methyl-3 bromoindolenine (BNPS-skatole) and the BNPS-skatole products IGFBP-2(1-248) and IGFBP-2(249-289) as well as IGFBP-2(1-190) were expressed as glutathione S-transferase-fusion proteins and purified. Based on competition binding analysis, deletion of residues 249 to 289 caused an approximately 20-fold decrease in IGF-1 binding affinity (IGFBP-2 EC50 = 0.35 nM and IGFBP-2(1-248) = 7 nM). Removal of the remainder of the C-terminal domain had no further effect on affinity (IGFBP-2(1-190) EC50 = 9.2 nM). In kinetic assays, IGFBP-2(1-248) and IGFBP-2(1-190) exhibited more rapid association and dissociation rates than full-length IGFBP-2. These results confirm that regions upstream and downstream of the CWCV motif participate in IGF-1 binding. They further support the development of full-length IGFBP-2 as a cancer therapeutic.
International Nuclear Information System (INIS)
Wogman, N.A.
1976-12-01
Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables
A new laboratory source of ozone and its potential atmospheric implications
Slanger, T. G.; Jusinski, L. E.; Black, G.; Gadd, G. E.
1988-08-01
Although 248-nm radiation falls 0.12 eV short of the energy needed to dissociate O2, large densities of ozone (O3) can be produced from unfocused 248-nm KrF excimer laser irradiation of pure O2. As soon as any O3 is present, it strongly absorbs the 248-nanometer radiation and dissociates to vibrationally excited ground state O2 (among other products), with a quantum yield of 0.1 to 0.15. During the laser pulse, a portion of these molecules absorb a photon and dissociate, which results in the production of three oxygen atoms for one O3 molecule destroyed. Recombination then converts these atoms to O3, and thus O3 production in the system is autocatalytic. A deficiency exists in current models of O3 photochemistry in the upper stratosphere and mesosphere, in that more O3 is found than can be explained. A detailed analysis of the system as it applies to the upper atmosphere is not yet possible, but with reasonable assumptions about O2 vibrational distributions resulting from O3 photodissociation and about relaxation rates of vibrationally excited O2, a case can be made for the importance of including this mechanism in the models.
Rumor, Karl, pseud., 1886-1971
2008-01-01
Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248
Indian Academy of Sciences (India)
objective Evolutionary Algorithm and Experimental Online Optimal Control Address: Distinguished Professor, Department of Chemical Engineering, University of Petroleum & Energy Studies, Energy Acres, PO Bidholi, Dehra Dun 248 007, ...
Band-gap narrowing of TiO2 films induced by N-doping
International Nuclear Information System (INIS)
Nakano, Y.; Morikawa, T.; Ohwaki, T.; Taga, Y.
2006-01-01
N-doped TiO 2 films were deposited on n + -GaN/Al 2 O 3 substrates by reactive magnetron sputtering and subsequently crystallized by annealing at 550 o C in flowing N 2 gas. The N-doping concentration was ∼8.8%, as determined from X-ray photoelectron spectroscopy measurements. Deep-level optical spectroscopy measurements revealed two characteristic deep levels located at 1.18 and 2.48 eV below the conduction band. The 1.18 eV level is probably attributable to the O vacancy state and can be active as an efficient generation-recombination center. Additionally, the 2.48 eV band is newly introduced by the N-doping and contributes to band-gap narrowing by mixing with the O 2p valence band
Unscheduled DNA synthesis in human skin after in vitro ultraviolet-excimer laser ablation
International Nuclear Information System (INIS)
Green, H.A.; Margolis, R.; Boll, J.; Kochevar, I.E.; Parrish, J.A.; Oseroff, A.R.
1987-01-01
DNA damage repaired by the excision repair system and measured as unscheduled DNA synthesis (UDS) was assessed in freshly excised human skin after 193 and 248 nm ultraviolet (UV)-excimer laser ablative incisions. Laser irradiation at 248 nm induced DNA damage throughout a zone of cells surrounding the ablated and heat-damaged area. In contrast, with 193 nm irradiation UDS was not detected in cells adjacent to the ablated area, even though DNA strongly absorbs this wavelength. Our results suggest that the lack of UDS after 193 nm irradiation is due to: ''shielding'' of DNA by the cellular interstitium, membrane, and cytoplasm, DNA damage that is not repaired by excision repair, or thermal effects that either temporarily or permanently inhibit the excision repair processes
Measurements of barium photocathode quantum yields at four excimer laser wavelengths
International Nuclear Information System (INIS)
Van Loy, M.D.; Young, A.T.; Leung, K.N.
1992-06-01
The electron quantum yields from barium cathodes excited by excimer laser radiation at 193, 248, 308, and 351 nm have been determined. Experiments with different cathode surface preparation techniques reveal that deposition of barium film a few microns thick on a clean copper surface under moderate vacuum conditions achieves relatively high quantum efficiencies. Quantum yields measured from surfaces prepared in this manner are 2.3 x 10 -3 at 193 nm, 7.6 x 10 - 4 at 248 nm, 6.1 x 10 -4 at 308 nm, and 4.0 x 10 -4 at 351 nm. Other preparation techniques, such as laser cleaning of a solid barium surface, produced quantum yields that were at least an order of magnitude lower than these values
26 CFR 1.248-1T - Election to amortize organizational expenditures (temporary).
2010-04-01
... accounting to which sections 446 and 481(a) apply if the corporation treated the item consistently for two or... business also is treated as a change in method of accounting if the corporation amortized organizational... obtaining of the corporate charter, are not alone sufficient to show the beginning of business. If the...
17 CFR 248.15 - Other exceptions to notice and opt out requirements.
2010-04-01
... providers and joint marketing do not apply when you disclose nonpublic personal information: (1) With the... related to public safety; (5)(i) To a consumer reporting agency in accordance with the Fair Credit....7(f). Relation to Other Laws; Effective Date ...
Directory of Open Access Journals (Sweden)
Kerstin Nolte
2013-01-01
Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages
Zoning Districts - Volusia County HUB Zones
NSGIC Local Govt | GIS Inventory — Historically Underutilized Business (HUB) Zones in Volusia County. Go to http://www.sba.gov/hubzone or contact the Department of Economic Development (386) 248-8048...
Immunomodulatory Activity of Alcohol Extract of Terminalia chebula ...
African Journals Online (AJOL)
Erah
2011-01-02
Jan 2, 2011 ... Purpose: To investigate the immunomodulatory activity of the alcohol extract of Terminalia chebula Retz. (Combretaceae) ..... indicates a higher secretion of melatonin. (Mol. Wt. 248 ... especially the immune, nervous, and.
Czech Academy of Sciences Publication Activity Database
Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.
2013-01-01
Roč. 10, č. 3 (2013), s. 248-255 ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders
The Molecular Epidemiology of Malaria in Western Kenya
National Research Council Canada - National Science Library
Amon, Joseph
2002-01-01
...) Plasmodium falciparum growth dynamics. The first two research topics were examined in a cohort of 248 males recruited from three highly endemic villages in western Kenya where severe malaria anemia is common...
Induction of lambda prophage near the site of focused UV laser radiation
Energy Technology Data Exchange (ETDEWEB)
Matchette, L.S.; Waynant, R.W.; Royston, D.D.; Hitchins, V.M.; Elespuru, R.K.
1989-02-01
DNA damage from photon scatter or beam spread during UV excimer laser irradiation was investigated using the induction of bacteriophage lambda in E. coli BR339. Prophage induction in these cells leads to the production of ..beta..-galactosidase which can be detected colorimetrically by the application of appropriate substates. An agar surface overlayed with BR339 cells was placed at various distances from the focal point of a converging lens and exposed to either 193 or 248 nm laser radiation. Energy densities ranging from approximately 5 mJ/cm/sup 2/ to 30 J/cm/sup 2/ were used. Ablation with 193 nm laser radiation produced an 800 ..mu..m wide clear 'trench' surrounded by a 500 ..mu..m zone of cells in which lambda had been induced. Following ablation with 248 nm laser radiation, the zone of induction was several millimeters wide. Exposures to 193 nm radiation at 170 mJ/cm/sup 2//pulse produced visible ablation of the agar surface at 1.7 J/cm/sup 2/. Lambda induction was observed surrounding cleared ablation areas. The presence of induction in this system suggests that both 248 and 193 nm excimer laser radiation delivered at high energy densities has sufficient spread or scatter to damage DNA in cells surrounding areas of ablation.
South African Medical Journal - Vol 83, No 4 (1993)
African Journals Online (AJOL)
Indications for colonoscopy An analysis based on indications and diagnostic yield · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. I. Berkowitz, M. Kaplan, 245-248 ...
Czech Academy of Sciences Publication Activity Database
Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.
2013-01-01
Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013
Directory of Open Access Journals (Sweden)
Rodrigo Puentes
Full Text Available Bovine herpesviruses (BoHVs types 1 (BoHV-1 and 5 (BoHV-5 are alphaherpesviruses of major importance to the bovine production chain. Such viruses are capable of establishing latent infections in neuronal tissues. Infected animals tend to develop a serological response to infection; however, such response-usually investigated by antibody assays in serum-may eventually not be detected in laboratory assays. Nevertheless, serological tests such as virus neutralization (VN and various enzyme-linked immunosorbent assays (ELISAs are widely employed to check individual or herd status of BoHV infections. The correlation between detection of antibodies and the presence of viral nucleic acids as indicatives of infection in infected cattle has not been deeply examined. In order to investigate such correlation, 248 bovine serum samples were tested by VN to BoHV-1 and BoHV-5, as well as in a widely employed (though not type-differential gB ELISA (IDEXX IBR gB X2 Ab Test in search for antibodies to BoHVs. Immediately after blood withdrawal, cattle were slaughtered and trigeminal ganglia (TG excised for DNA extraction and viral nucleic acid detection (NAD by nested PCR. Neutralizing antibodies to BoHV-1 and/or BoHV-5 were detected in 44.8% (111/248 of sera, whereas the gB ELISA detected antibodies in 51.2% (127/248 of the samples. However, genomes of either BoHV-1, BoHV-5, or both, were detected in TGs of 85.9% (213/248 of the animals. These findings reveal that the assays designed to detect antibodies to BoHV-1 and/or BoHV-5 employed here may fail to detect a significant number of latently infected animals (in this study, 35.7%. From such data, it is clear that antibody assays are poorly correlated with detection of viral genomes in BoHV-1 and BoHV-5-infected animals.
Karlshøj, Stefanie; Amarandi, Roxana Maria; Larsen, Olav; Daugvilaite, Viktorija; Steen, Anne; Brvar, Matjaž; Pui, Aurel; Frimurer, Thomas Michael; Ulven, Trond; Rosenkilde, Mette Marie
2016-12-23
The small molecule metal ion chelators bipyridine and terpyridine complexed with Zn 2+ (ZnBip and ZnTerp) act as CCR5 agonists and strong positive allosteric modulators of CCL3 binding to CCR5, weak modulators of CCL4 binding, and competitors for CCL5 binding. Here we describe their binding site using computational modeling, binding, and functional studies on WT and mutated CCR5. The metal ion Zn 2+ is anchored to the chemokine receptor-conserved Glu-283 VII:06/7.39 Both chelators interact with aromatic residues in the transmembrane receptor domain. The additional pyridine ring of ZnTerp binds deeply in the major binding pocket and, in contrast to ZnBip, interacts directly with the Trp-248 VI:13/6.48 microswitch, contributing to its 8-fold higher potency. The impact of Trp-248 was further confirmed by ZnClTerp, a chloro-substituted version of ZnTerp that showed no inherent agonism but maintained positive allosteric modulation of CCL3 binding. Despite a similar overall binding mode of all three metal ion chelator complexes, the pyridine ring of ZnClTerp blocks the conformational switch of Trp-248 required for receptor activation, thereby explaining its lack of activity. Importantly, ZnClTerp becomes agonist to the same extent as ZnTerp upon Ala mutation of Ile-116 III:16/3.40 , a residue that constrains the Trp-248 microswitch in its inactive conformation. Binding studies with 125 I-CCL3 revealed an allosteric interface between the chemokine and the small molecule binding site, including residues Tyr-37 I:07/1.39 , Trp-86 II:20/2.60 , and Phe-109 III:09/3.33 The small molecules and CCL3 approach this interface from opposite directions, with some residues being mutually exploited. This study provides new insight into the molecular mechanism of CCR5 activation and paves the way for future allosteric drugs for chemokine receptors. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage
Czech Academy of Sciences Publication Activity Database
Kocánová, Barbora
-, č. 71 (2013), s. 237-248 ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.
2015-01-01
Roč. 742, č. 1 (2015), s. 233-248 ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.051, year: 2015
Global patterns of interaction specialization in bird-flower networks
Czech Academy of Sciences Publication Activity Database
Zanata, T. B.; Dalsgaard, B.; Passos, F. C.; Cotton, P. A.; Roper, J. J.; Maruyama, P.K.; Fischer, E.; Schleuning, M.; Gonzalez, A. M. M.; Vizentin-Bugoni, J.; Franklin, D. C.; Abrahamczyk, S.; Alarcon, R.; Araujo, A. C.; Araujo, F. P.; de Azevedo-Junior, S. M.; Baquero, A. C.; Boehning-Gaese, K.; Carstensen, D. W.; Chupil, H.; Coelho, A. G.; Faria, R. R.; Hořák, D.; Ingversen, Tanja T.; Janeček, Štěpán; Kohler, G.; Lara, C.; Las-Casas, F. M. G.; Lopes, A. V.; Machado, A. O.; Machado, C. G.; Machado, Isabel C.; Maglianesi, M. A.; Malucelli, T. S.; Mohd-Azlan, J.; Moura, A. C.; Oliveira, G. M.; Oliveira, P. E.; Ornelas, J. F.; Riegert, J.; Rodrigues, L. C.; Rosero-Lasprilla, L.; Rui, A. M.; Sazima, M.; Schmid, B.; Sedláček, O.; Timmermann, A.; Vollstädt, M. G. R.; Wang, Z.; Watts, S.; Rahbek, C.; Varassin, I. G.
2017-01-01
Roč. 44, č. 8 (2017), s. 1891-1910 ISSN 0305-0270 Institutional support: RVO:67985939 Keywords : honeyeaters * hummingbirds * modularity Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.248, year: 2016
Cao, Hujun; Richter, Theresia M M; Pistidda, Claudio; Chaudhary, Anna-Lisa; Santoru, Antonio; Gizer, Gökhan; Niewa, Rainer; Chen, Ping; Klassen, Thomas; Dornheim, Martin
2015-11-01
The alkali metal amidozincates Li4 [Zn(NH2)4](NH2)2 and K2[Zn(NH2)4] were, to the best of our knowledge, studied for the first time as hydrogen storage media. Compared with the LiNH2-2 LiH system, both Li4 [Zn(NH2)4](NH2)2-12 LiH and K2[Zn(NH2)4]-8 LiH systems showed improved rehydrogenation performance, especially K2[Zn(NH2)4]-8 LiH, which can be fully hydrogenated within 30 s at approximately 230 °C. The absorption properties are stable upon cycling. This work shows that ternary amides containing transition metals have great potential as hydrogen storage materials. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Motor competence and physical fitness in adolescents.
Gísladóttir, Ordís; Haga, Monika; Sigmundsson, Hermundur
2014-01-01
In this study we examined the relationship between physical fitness and motor competence in adolescents aged 15 to 16 years. A sample of 94 adolescents participated in the study. To test motor competence, the Movement Assessment Battery for Children-2 was used. Physical fitness was assessed using the following test items: standing broad jump, 20-m dash, reduced Cooper test, and sit-and-reach test. The results revealed a significant but weak relationship (0.248) between motor competence and physical fitness for the whole sample. More specifically, the correlation between the 2 variables was significant for girls (0.353) but not for boys (0.248). The relatively weak relationship between motor competence and physical fitness suggests that motor competence might not be critical in adolescents to maintain their physical fitness.
Unscheduled DNA synthesis in human skin after in vitro ultraviolet-excimer laser ablation
Energy Technology Data Exchange (ETDEWEB)
Green, H.A.; Margolis, R.; Boll, J.; Kochevar, I.E.; Parrish, J.A.; Oseroff, A.R.
1987-08-01
DNA damage repaired by the excision repair system and measured as unscheduled DNA synthesis (UDS) was assessed in freshly excised human skin after 193 and 248 nm ultraviolet (UV)-excimer laser ablative incisions. Laser irradiation at 248 nm induced DNA damage throughout a zone of cells surrounding the ablated and heat-damaged area. In contrast, with 193 nm irradiation UDS was not detected in cells adjacent to the ablated area, even though DNA strongly absorbs this wavelength. Our results suggest that the lack of UDS after 193 nm irradiation is due to: ''shielding'' of DNA by the cellular interstitium, membrane, and cytoplasm, DNA damage that is not repaired by excision repair, or thermal effects that either temporarily or permanently inhibit the excision repair processes.
A 4D spacetime embedded in a 5D pseudo-Euclidean space describing interior of compact stars
Energy Technology Data Exchange (ETDEWEB)
Singh, K.N. [National Defence Academy, Department of Physics, Khadakwasla (India); Murad, Mohammad Hassan [BRAC University, Department of Mathematics and Natural Sciences, Dhaka (Bangladesh); Pant, Neeraj [National Defence Academy, Department of Mathematics, Khadakwasla (India)
2017-02-15
The present paper provides a new model of compact stars satisfying the Karmarkar condition. The model is obtained by assuming a new type of metric potential for g{sub rr} from the condition of embedding class I. The model parameters are obtained accordingly by employing the metric potentials to Einstein's field equations. Our model is free from geometric singularity and satisfies all the physical conditions. The obtained mass and radius of the compact stars Cen X-3, EXO 1785-248 and SAX 1808.4-3658 obtained from the model are consistent with the observational data of T. Gangopadhyay et al. Detailed analyses of these neutron stars (Cen X-3, EXO 1785-248 and SAX 1808.4-3658) are also given with the help of graphical representations. (orig.)
Deep-level optical spectroscopy investigation of N-doped TiO2 films
International Nuclear Information System (INIS)
Nakano, Yoshitaka; Morikawa, Takeshi; Ohwaki, Takeshi; Taga, Yasunori
2005-01-01
N-doped TiO 2 films were deposited on n + -GaN/Al 2 O 3 substrates by reactive magnetron sputtering and subsequently crystallized by annealing at 550 deg. C in flowing N 2 gas. The N-doping concentration was ∼8.8%, as determined from x-ray photoelectron spectroscopy measurements. Deep-level optical spectroscopy measurements revealed two characteristic deep levels located at ∼1.18 and ∼2.48 eV below the conduction band. The 1.18 eV level is probably attributable to the O vacancy state and can be active as an efficient generation-recombination center. Additionally, the 2.48 eV band is newly introduced by the N doping and contributes to band-gap narrowing by mixing with the O 2p valence band
Energy Technology Data Exchange (ETDEWEB)
Talamo, Alberto; Gohar, Yousry, E-mail: alby@anl.gov [Argonne National Laboratory, Lemont, IL (United States); Dulla, Sandra; Ravetto, Piero [Politecnico di Torino (Italy)
2011-07-01
The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)
International Nuclear Information System (INIS)
Talamo, Alberto; Gohar, Yousry; Dulla, Sandra; Ravetto, Piero
2011-01-01
The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)
Directory of Open Access Journals (Sweden)
Yudakov Aleksandr A.
2015-01-01
Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.
A technique for combining neutron and gamma-ray data into a single assay value
International Nuclear Information System (INIS)
Pickrell, M.M.; Mercer, D.; Sharpe, T.J.
1998-01-01
The authors explored the potentials of using both neutron and gamma-ray measurements on a single item and combining these data into a single assay value. The purpose was to improve assay capability for sample matrices that are difficult to measure. They chose an empirical approach because they wanted to address difficult-to-measure items for which the assay problem is complex. They used the tomographic gamma scanner; a passive, high-efficiency neutron counter with add-a-source and multiplicity; and an active neutron, californium shuffler to obtain measurements. Twenty-four 200-L drums were measured with various matrices using all three machines. The matrices were chosen specifically to spain the difficult-to-measure assay problems for some or all of the instruments. For example, the authors measured a drum filled with concrete and another filled with metal. The data from these measurements were analyzed using the alternating conditional expectation algorithm, which is one of a class of generalized additive models. Other data fusion algorithms are also possible and are being explored. The intent was to find ways to combine the data that would reduce the matrix-induced measurement error
Activation analysis of stainless steel flux monitors using 252Cf neutron sources
International Nuclear Information System (INIS)
Williams, J.G.; Newton, T.H. Jr.; Cogburn, C.O.
1984-01-01
Activation analysis was performed on stainless steel beads from a chain which is used in reactor pressure vessel surveillance experiments at the Arkansas Power and Light Company reactors. The beads allow monitoring of two fast and three thermal neutron induced reactions: 58 Ni(n,p) 58 Co, 54 Fe(n,p) 54 Mn, 58 Fe(n,γ) 59 Fe, 59 Co(n,γ) 60 Co and 50 Cr(n,γ) 51 Cr. The analysis was performed using 12 beads from various positions along 5 different batches of chain and standard materials in an H 2 O moderator tank using two intense californium sources which had a total neutron emission rate of 3.97 x 10 10 /s. Semiconductor gamma spectrometers were used to count the products of the above reactions in the specimens. The percentage by weight of the iron, chromium and cobalt in the beads were found to be 62.1%, 20.2% and 0.120%, respectively. The excellent uniformity found in the bead compositions demonstrates the reproducibility of the experimental techniques and enhances considerably the value of the beads as neutron flux montitors
Interface detection by neutron scattering
International Nuclear Information System (INIS)
De Monchy, A.R.; Kok, C.A.; Dorrepaal, J.
1979-01-01
A method and apparatus for detecting an interface of materials having different hydrogen content present in a metal vessel or pipe eg. made of steel, are described. Steel walls of columns, reactors, pipelines etc can be monitored. It is very suitable for detection of liquid water or hydrocarbons present in gas pipelines and also for the detection of a liquid hydrocarbon in a vessel or column. A series of measurements of the hydrogen density of the contents of a vessel or pipe are made using at least one californium-252 neutron source located near the outer side of the pipe. Neutrons are emitted and are scattered by the contents of the pipe. At least one neutron detector is located near the outer side of the metal wall. The detectors have a higher sensitivity for scattered neutrons (from the light hydrogen nuclei present in water or hydrocarbons). A source of 0.1 - 1 micrograms produces enough neutrons for most technical applications so the handling is relatively safe although shielding is advocated. The detectors contain helium-3 at a pressure of about 10 bar. Current pulses from the detector are counted. (U.K.)
MinT: Middleware for Cooperative Interaction of Things.
Jeon, Soobin; Jung, Inbum
2017-06-20
This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.
Design of active-neutron fuel rod scanner
International Nuclear Information System (INIS)
Griffith, G.W.; Menlove, H.O.
1996-01-01
An active-neutron fuel rod scanner has been designed for the assay of fissile materials in mixed oxide fuel rods. A 252 Cf source is located at the center of the scanner very near the through hole for the fuel rods. Spontaneous fission neutrons from the californium are moderated and induce fissions within the passing fuel rod. The rod continues past a combined gamma-ray and neutron shield where delayed gamma rays above 1 MeV are detected. We used the Monte Carlo code MCNP to design the scanner and review optimum materials and geometries. An inhomogeneous beryllium, graphite, and polyethylene moderator has been designed that uses source neutrons much more efficiently than assay systems using polyethylene moderators. Layers of borated polyethylene and tungsten are used to shield the detectors. Large NaI(Tl) detectors were selected to measure the delayed gamma rays. The enrichment zones of a thermal reactor fuel pin could be measured to within 1% counting statistics for practical rod speeds. Applications of the rod scanner include accountability of fissile material for safeguards applications, quality control of the fissile content in a fuel rod, and the verification of reactivity potential for mixed oxide fuels. (orig.)
Sources of Radioactive Isotopes for Dirty Bombs
Lubenau, Joel
2004-05-01
From the security perspective, radioisotopes and radioactive sources are not created equal. Of the many radioisotopes used in industrial applications, medical treatments, and scientific research, only eight, when present in relatively large amounts in radioactive sources, pose high security risks primarily because of their prevalence and physical properties. These isotopes are americium-241, californium-252, cesium-137, cobalt-60, iridium-192, radium-226, plutonium-238, and strontium-90. Except for the naturally occurring radium-226, nuclear reactors produce the other seven in bulk commercial quantities. Half of these isotopes emit alpha radiation and would, thus, primarily pose internal threats to health; the others are mainly high-energy gamma emitters and would present both external and internal health hazards. Therefore, the response to a "dirty bomb" event depends on what type of radioisotope is chosen and how it is employed. While only a handful of major corporations produce the reactor-generated radioisotopes, they market these materials to thousands of smaller companies and users throughout the world. Improving the security of the high-risk radioactive sources will require, among other efforts, cooperation among source suppliers and regulatory agencies.
Antagonistic effects of three species of Trichoderma sp. on ...
African Journals Online (AJOL)
Francis
This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.
Přijetí Úmluvy OSN proti nadnárodnímu organizovanému zločinu
Czech Academy of Sciences Publication Activity Database
Šturma, Pavel
2001-01-01
Roč. 9, č. 5 (2001), s. 241-248 ISSN 1210-6410 Institutional research plan: CEZ:AV0Z7068917 Keywords : organized crime * scientific conference * Convention against supranational organized crime Subject RIV: AG - Legal Sciences
Czech Academy of Sciences Publication Activity Database
Breiter, Karel; Škoda, R.; Uher, P.
2007-01-01
Roč. 91, 3-4 (2007), s. 225-248 ISSN 0930-0708 Institutional research plan: CEZ:AV0Z30130516 Keywords : minerals * granitic system Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.907, year: 2007
76 FR 56724 - Proposed Flood Elevation Determinations
2011-09-14
... Town of Clarkstown. Hackensack River confluence. At the upstream side of +248 +247 Little Tor Road... Emergency Management Agency. [FR Doc. 2011-23413 Filed 9-13-11; 8:45 am] BILLING CODE 9110-12-P ...
Nanoantenna using mechanical resonance
Chang Hwa Lee,; Seok Woo Lee,; Lee, Seung S
2010-01-01
nanorod array. The modulated signals are received successfully with the transmission carrier wave frequency (248MHz) and the proposed nanoantenna is expected to be used in communication system for ultra small scale sensor. ©2010 IEEE.
Czech Academy of Sciences Publication Activity Database
Costantino, U.; Vivani, R.; Zima, Vítězslav; Beneš, Ludvík; Melánová, Klára
xx, č. 18 (2002), s. 1211-1217 ISSN 0743-7463 R&D Projects: GA ČR GA202/01/0520 Keywords : zirconium phosphate * intercalation * alkanols Subject RIV: CA - Inorganic Chemistry Impact factor: 3.248, year: 2002
Properties of carbonisation products obtained from impregnated coal
Czech Academy of Sciences Publication Activity Database
Plevová, Eva; Šugárková, Věra; Kaloč, M.; Vaculíková, Lenka
-, - (2008), s. 52-61. ISBN 978-80-248-1939-6 Grant - others:GA CŘ(CZ) GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : chlorides * impregnation * coal Subject RIV: CC - Organic Chemistry
Czech Academy of Sciences Publication Activity Database
Bahenská, Marie
2011-01-01
Roč. 3, č. 2 (2011), s. 248-263 ISSN 1803-9448 Institutional research plan: CEZ:AV0Z80770509 Keywords : Lengerová, Alena * history of science * Czechoslovak Academy of Science s Subject RIV: AB - History
Lifescience Database Archive (English)
Full Text Available I34.1 Q24.8 MeSH: D008945 C535576 OMIM: 607829 314400 PMID:24867995 (description) ... AUTHORS ... Delling FN, Vasan RS ... TITLE ... Epidem...iology and pathophysiology of mitral valve prolapse: new
2010-04-01
... that date, except as otherwise provided in §§ 10.241 through 10.248; (2) Rum and tafia classified in subheading 2208.40, Harmonized Tariff Schedule of the United States; (3) Sugars, syrups, and sugar-containing...
Sand and clay mineralogy of sal forest soils of the Doon Siwalik ...
Indian Academy of Sciences (India)
3Forest Soil & Land Reclamation Division, Forest Research Institute, Dehradun 248 006, India. ∗ e-mail: ... understanding the distribution of forest types and ... Material and methods. 2.1 Study area .... Finally, for the qualitative and quan-.
Ichnology of the Early Cambrian Tal Group, Mussoorie Syncline ...
Indian Academy of Sciences (India)
Wadia Institute of Himalayan Geology, 33, General Mahadeo Singh Road, Dehradun 248 001, India. ∗ ... Mussoorie Syncline, being one of the five synclines, exposes the Cambrian ... Belt of Lesser Himalaya is represented by the Tal. Group.
Optimal Mirrleesean taxation in a Ben-Porath economy
Czech Academy of Sciences Publication Activity Database
Kapička, Marek
2015-01-01
Roč. 7, č. 2 (2015), s. 219-248 ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal tax es * unobservable human capital * income tax es Subject RIV: AH - Economics Impact factor: 2.567, year: 2015
Czech Academy of Sciences Publication Activity Database
Šimon, Petr; Jambor, R.; Růžička, A.; Dostál, I.
2013-01-01
Roč. 32, č. 1 (2013), s. 239-248 ISSN 0276-7333 Institutional support: RVO:61388971 Keywords : MAIN-GROUP ELEMENTS * BOND COVALENT RADII * CRYSTAL-STRUCTURES Subject RIV: CA - Inorganic Chemistry Impact factor: 4.253, year: 2013
Optical properties of PMMA doped with erbium(III) and ytterbium(III) complexes
Czech Academy of Sciences Publication Activity Database
Prajzler, V.; Huttel, I.; Lyutakov, O.; Oswald, Jiří; Machovič, V.; Jerabek, V.
2009-01-01
Roč. 49, č. 9 (2009), s. 1814-1817 ISSN 0032-3888 Institutional research plan: CEZ:AV0Z10100521 Keywords : polymers * erbium * photoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.248, year: 2009
Czech Academy of Sciences Publication Activity Database
Lecocq, T.; Brasero, N.; De Meulemeester, T.; Michez, D.; Dellicour, S.; Lhomme, P.; de Jonghe, R.; Valterová, Irena; Urbanová, Klára; Rasmont, P.
2015-01-01
Roč. 18, č. 3 (2015), s. 236-248 ISSN 1367-9430 Institutional support: RVO:61388963 Keywords : Bayesian * bumblebees * endemic * evolutionarily significant unit * genetic marker * insular Subject RIV: CC - Organic Chemistry Impact factor: 2.788, year: 2015
Ligninolytic enzyme complex of Armillaria spp
Czech Academy of Sciences Publication Activity Database
Stoychev, I.; Nerud, František
2000-01-01
Roč. 45, č. 3 (2000), s. 248-250 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5020903 Keywords : lignin olytic enzyme * lignin peroxidase Subject RIV: EE - Microbiology, Virology Impact factor: 0.752, year: 2000
Energy Technology Data Exchange (ETDEWEB)
King, L.J.; Bigelow, J.E.; Collins, E.D.
1977-02-01
During the period January 1, 1976, through June 30, 1976, the following amounts of transuranium elements were recovered from ten irradiated HFIR targets: 2 g /sup 243/Am, 50 g /sup 244/Cm, 29 mg /sup 249/Bk, 277 mg /sup 252/Cf, 1.7 mg /sup 253/Es, and 0.5 pg /sup 257/Fm. About 50 mg of high-purity /sup 248/Cm was purified chemically for shipment, and another 75 mg of /sup 248/Cm was separated from /sup 252/Cf. Nineteen HFIR targets, each containing approximately 9 g of curium, were fabricated. There have been no changes during this report period in the chemical processing flowsheets normally used at TRU. Five neutron sources were fabricated, bringing the total fabricated to 84. Six sources that were used previously in various projects have been returned to TRU and are available for reassignment. Special projects included (1) the continued study of /sup 250/Cm production by irradiation of /sup 248/Cm; (2) the production of 0.54 mg of /sup 250/Cf by irradiation of /sup 249/Bk; (3) the separation of approximately 200 pg of /sup 254/Cf from 39-hr /sup 254m/Es that was produced by irradiation of 5 ..mu..g of /sup 253/Es; and (4) the determination of process steps needed to obtain rare-earth fission products in an oxide form from LiCl-based anion exchange raffinate solution.
Shin, Dong Woo; Shin, Jin Yong; Oh, Sung Jin; Park, Jong Kwon; Yu, Hyeon; Ahn, Min Sung; Bae, Ki Beom; Hong, Kwan Hee; Ji, Yong Il
2016-04-01
The prognostic influence of circumferential resection margin (CRM) status in extraperitoneal rectal cancer probably differs from that of intraperitoneal rectal cancer because of its different anatomical and biological behaviors. However, previous reports have not provided the data focused on extraperitoneal rectal cancer. Therefore, the aim of this study was to examine the prognostic significance of the CRM status in patients with extraperitoneal rectal cancer. From January 2005 to December 2008, 248 patients were treated for extraperitoneal rectal cancer and enrolled in a prospectively collected database. Extraperitoneal rectal cancer was defined based on tumors located below the anterior peritoneal reflection, as determined intraoperatively by a surgeon. Cox model was used for multivariate analysis to examine risk factors of recurrence and mortality in the 248 patients, and multivariate logistic regression analysis was performed to identify predictors of recurrence and mortality in 135 patients with T3 rectal cancer. CRM involvement for extraperitoneal rectal cancer was present in 29 (11.7%) of the 248 patients, and was the identified predictor of local recurrence, overall recurrence, and death by multivariate Cox analysis. In the 135 patients with T3 cancer, CRM involvement was found to be associated with higher probability of local recurrence and mortality. In extraperitoneal rectal cancer, CRM involvement is an independent risk factor of recurrence and survival. Based on the results of the present study, it seems that CRM involvement in extraperitoneal rectal cancer is considered an indicator for (neo)adjuvant therapy rather than conventional TN status.
Animal Production Research Advances - Vol 5, No 4 (2009)
African Journals Online (AJOL)
Carcass Characteristics and Economics of Broiler Chickens Fed Different Levels of Grasshopper Meal in Place of Fish Meal · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MA Muftau, BR Olorede, 248-251 ...
A Review of Nature and Antiquities: The Making of Archaeology in the Americas
Directory of Open Access Journals (Sweden)
Tim Murray
2016-02-01
Full Text Available A review of Nature and Antiquities: The Making of Archaeology in the Americas, by Philip Kohl, Irina Podgorny and Stefanie Gänger (Eds., Tucson: University of Arizona Press, 248 pages, $60 US, 2014, ISBN: 9780816531127
Heavy Metals and Physicochemical Properties of Soils in Kano ...
African Journals Online (AJOL)
and such soil properties as organic carbon, available P, total N and basic cations on the other. Keywords: ..... addition through fertilizers and agro-chemicals, their ..... Analysis of Fish Tissue for Trace Metals. Afon ... Nutrition 7(2): 244-248.
Mesophase properties after anthracene thermal exposure
Czech Academy of Sciences Publication Activity Database
Šugárková, Věra; Plevová, Eva; Kaloč, M.
-, - (2008), s. 62-70. ISBN 978-80-248-1939-6 Grant - others:GA ČR GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : mesophase * anthracene * thermal behaviour * anisotropy Subject RIV: CC - Organic Chemistry
Czech Academy of Sciences Publication Activity Database
Doležal, Adam; Doležal, Tomáš
2013-01-01
Roč. 19, 7-8 (2013), s. 242-248 ISSN 1211-4405 R&D Projects: GA ČR GAP408/12/2574 Institutional support: RVO:68378122 Keywords : medical law * causality * medico-legal disputes Subject RIV: AG - Legal Sciences
Serological evidence of exposure to globally relevant zoonotic parasites in the Estonian population
DEFF Research Database (Denmark)
Lassen, Brian; Janson, Marilin; Viltrop, Arvo
2016-01-01
We investigated Estonian population and its selected subgroups for serological evidence of exposure to Ascaris lumbricoides, Echinococcus spp., Taenia solium, Toxocara canis, Toxoplasma gondii, and Trichinella spiralis. Serum samples from 999 adults representing general population, 248 children a...
Acute ischemic stroke prognostication, comparison between ...
African Journals Online (AJOL)
Ossama Y. Mansour
2014-11-20
Nov 20, 2014 ... patients with acute ischemic stroke in comparison with the NIHSS and the GCS. Methods: .... All patients received a CT scan of the brain on admission. Diagnostic ... adjusted for age, sex, Charlson Index and Oxfordshire. 248.
Czech Academy of Sciences Publication Activity Database
Blindauer, C. A.; Sigel, A.; Operschall, B. P.; Griesser, R.; Holý, Antonín; Sigel, H.
2016-01-01
Roč. 103, Jan 8 (2016), s. 248-260 ISSN 0277-5387 Institutional support: RVO:61388963 Keywords : anticancer activity * antivirals * aromatic-ring stacking * isomeric equilibria * nucleotide analogues Subject RIV: CC - Organic Chemistry Impact factor: 1.926, year: 2016
International Nuclear Information System (INIS)
Liu, J.D.; Jin, T.; Zhao, N.R.; Wang, Z.H.; Sun, X.F.; Guan, H.R.; Hu, Z.Q.
2008-01-01
A Ni-base single crystal superalloy was transient liquid phase (TLP) bonded using a Ni-Cr-B amorphous foil at 1230 deg. C for 8 h. Stress rupture tests of the TLP joint and a matrix sample were carried out at 982 deg. C/248 MPa and 1010 deg. C/248 MPa. The microstructures and fracture surfaces were studied using scanning electron microscopy (SEM). Transmission electron microscopy (TEM) investigations were performed after creep rupture testing to examine the deformation substructures. The results show that the stress rupture ductility of TLP joints is significantly decreased compared to the matrix sample. This reduction of the ductility of TLP joints can be attributed to solid solution strengthening by boron atoms, subgrain boundaries formed in the bonding zone and the concentration of creep cavities formed during the last stage of the stress rupture test
Pulsed laser deposition of Tl-Ca-Ba-Cu-O films
International Nuclear Information System (INIS)
Ianno, N.J.; Liou, S.H.; Woollam, J.A.; Thompson, D.; Johs, B.
1990-01-01
Pulsed laser deposition is a technique commonly used to deposit high quality thin films of high temperature superconductors. This paper discusses the results obtained when this technique is applied to the deposition of Tl-Ca-Ba-Cu-O thin films using a frequency doubled Nd:YAG laser operating at 532 nm and an excimer laser operating at 248 nm. Films with onset temperatures of 125 K and zero resistance temperatures of 110 K deposited on (100) oriented MgO from a composite Tl2Ca2Ba2Cu3Ox target were obtained at both wavelengths upon appropriate post deposition annealing. Films deposited at 532 nm exhibit a rough surface, while those deposited at 248 nm are smooth and homogeneous. Upon annealing, films deposited at both wavelengths are single phase Tl2Ca2Ba2Cu3Ox. 12 refs
UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films
International Nuclear Information System (INIS)
Toftmann, B.; Papantonakis, M.R.; Auyeung, R.C.Y.; Kim, W.; O'Malley, S.M.; Bubb, D.M.; Horwitz, J.S.; Schou, J.; Johansen, P.M.; Haglund, R.F.
2004-01-01
A comparative study of thin film production based on gentle laser-ablation techniques has been carried out with the luminescent polymer poly[2-methoxy-5-(2'-ethylhexyloxy)-1,4-phenylene vinylene]. Using a free-electron laser films were made by resonant infrared pulsed laser deposition (RIR-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence
UV and RIR matrix assisted pulsed laser deposition of organic MEH-PPV films
DEFF Research Database (Denmark)
Christensen, Bo Toftmann; Papantonalis, M.R.; Auyeung, R.C.Y.
2004-01-01
-PLD). For the first time resonant infrared matrix assisted pulsed laser evaporation (RIR-MAPLE) was successfully demonstrated on a luminescent polymer system. In addition to this, an excimer laser has been used for UV-MAPLE depositions at 193 and 248-nm irradiation. Films deposited onto NaCl and quartz substrates......A comparative study of thin film production based on gentle laser-ablation techniques has been carried out with the luminescent polymer poly [2-methoxy-5-(2'-ethylhexyloxy)-1,4-phenylene vinylene]. Using a free-electron laser films were made by resonant infrared pulsed laser deposition (RIR...... were analyzed by Fourier transform infrared spectroscopy, UV-visible absorbance and photoluminescence. Photoluminescent material was deposited by RIR-MAPLE and 248-nm MAPLE, while the RIR-PLD and 193-nm-MAPLE depositions displayed the smoothest surfaces but did not show photoluminescence. (C) 2003...
Czech Academy of Sciences Publication Activity Database
Joshi, S.; Kumari, S.; Sarmah, Amrit; Pant, D. D.; Sakhuja, R.
2017-01-01
Roč. 248, Dec (2017), s. 668-677 ISSN 0167-7322 Institutional support: RVO:61388963 Keywords : coumarin * chemosensor * fluorescence * quenching * mercury * DFT calculations Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 3.648, year: 2016
Affinity Capillary Electrophoresis – A Powerful Tool to Investigate Biomolecular Interactions
Czech Academy of Sciences Publication Activity Database
Kašička, Václav
2017-01-01
Roč. 30, č. 5 (2017), s. 248 ISSN 1471-6577 Institutional support: RVO:61388963 Keywords : capillary affinity electrophoresis * biomolecular interactions * binding constants Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 0.663, year: 2016
African Journals Online (AJOL)
Administratör
Key words: Ischemic stroke, Risk factors, In-hospital mortality, Palestine. ABSTRACT. Objective: ..... The Lancet 1990; 335: 765–74. 26. MacMahon S, Rodgers A. ... stay in a stroke rehabilitation unit, Part I: analysis of 248 unscreened patients: ...
28 CFR 2.47 - Warrant placed as a detainer and dispositional review.
2010-07-01
... notified of his right to request counsel under the provisions of § 2.48(b) to assist him in completing this... original sentence is not interrupted by a new conviction (e.g., YCA; NARA; Mexican or Canadian treaty cases...
Czech Academy of Sciences Publication Activity Database
Langerová, Hana; Ruml, T.; Rumlová, M.
2017-01-01
Roč. 248, Oct (2017), s. 19-25 ISSN 0166-0934 Institutional support: RVO:61388963 Keywords : intracytoplasmic particles (ICAPs) * retrovirus * assembly * Mason-Pfizer monkey virus Subject RIV: EE - Microbiology, Virology OBOR OECD: Virology Impact factor: 1.693, year: 2016
Cretaceous park of sex determination: sex chromosomes are conserved across iguanas
Czech Academy of Sciences Publication Activity Database
Rovatsos, M.; Pokorná, Martina; Altmanová, M.; Kratochvíl, L.
2014-01-01
Roč. 10, č. 3 (2014), s. 20131093 ISSN 1744-9561 R&D Projects: GA ČR GAP506/10/0718 Institutional support: RVO:67985904 Keywords : Anolis * lizard * male heterogamety Subject RIV: EG - Zoology Impact factor: 3.248, year: 2014
Kultura organizace a syndrom vyhoření
Czech Academy of Sciences Publication Activity Database
Havrdová, Z.; Šolcová, Iva; Hradcová, D.; Rohanová, E.
2010-01-01
Roč. 54, č. 3 (2010), s. 235-248 ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : organizational culture * employee satisfaction * health vs. social services Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010
Czech Academy of Sciences Publication Activity Database
Balek, V.; Mitsuhashi, T.; Zeleňák, V.; Večerníková, Eva; Šubrt, Jan; Haneda, H.; Bezdička, Petr
2002-01-01
Roč. 248, č. 1 (2002), s. 47-53 ISSN 0021-9797 Institutional research plan: CEZ:AV0Z4032918 Keywords : emanation thermal analysis * TiO2 * RuO2 Subject RIV: CA - Inorganic Chemistry Impact factor: 1.466, year: 2002
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
mean rate 0.084 m/y) whereas comparatively six salt lakes (out of seven salt lakes) exhibited ∼3 times higher mean rate of lake level ... Centre for Glaciology, Wadia Institute of Himalayan Geology, 33 GMS Road, Dehradun 248 001, India.
76 FR 60873 - Jeffery M. Freesemann, M.D.; Decision and Order
2011-09-30
... of probation with limitations, reporting conditions, and ethics training would ``provide adequate... to purchase methamphetamine. Id. Galvan also telephoned Phil Nunez (Nunez), an individual the... admitted to practice medicine in California) he was hired by a Bakersfield physician. Tr. 248. The...
Prevalence and risk factors of anaemia in paediatric patients in ...
African Journals Online (AJOL)
South African Journal of Child Health ... deficiency 42.3% (p=0.001), glucose-6 phosphate dehydrogenase (G6PD) deficiency 24.8% (p=0.02), ... Malaria and iron deficiency remain common among ill children <5 years old who are anaemic.
2013-12-20
...: Federal Power Act, 16 U.S.C. 791(a)-825(r). h. Applicant Contact: David Brown Kinloch, Lock 14 Hydro... of: (1) An existing 248-foot- long, 17-foot-high concrete lock and dam with a 319-foot-long stone...
Vergilius ja eesti heksameetri probleem / Ants Oras
Oras, Ants
2004-01-01
Varem ilmunud: Tulimuld, 1962, nr. 4, lk. 242-248 ; rmt.: Vergilius Maro, Publius. Aeneis : eepos kaheteistkümnes laulus. Lund : Eesti Kirjanike Kooperatiiv, 1975, lk. 512 ; rmt.: Vergilius Maro, Publius. Bucolica. Aeneis. Tallinn : Hortus Litterarum, 1992, lk. 55-61, pealkirjaga "Saateks"
Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)
Czech Academy of Sciences Publication Activity Database
Pavlíková, H.; Witter, K.; Míšek, Ivan
2001-01-01
Roč. 248, č. 3 (2001), s. 270-270 ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001
ORF Alignment: NC_004557 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248