INAA of CAIs from the Maralinga CK4 chondrite: Effects of parent body thermal metamorphism

Science.gov (United States)

Lindstrom, D. J.; Keller, L. P.; Martinez, R. R.

1993-01-01

Maralinga is an anomalous CK4 carbonaceous chondrite which contains numerous Ca-, Al-rich inclusions (CAI's) unlike the other members of the CK group. These CAI's are characterized by abundant green hercynitic spinel intergrown with plagioclase and high-Ca clinopyroxene, and a total lack of melilite. Instrumental Neutron Activation Analysis (INAA) was used to further characterize the meteorite, with special focus on the CAI's. High sensitivity INAA was done on eight sample disks about 100-150 microns in diameter obtained from a normal 30 micron thin section with a diamond microcoring device. The CAI's are enriched by 60-70X bulk meteorite values in Zn, suggesting that the substantial exchange of Fe for Mg that made the spinel in the CAI's hercynitic also allowed efficient scavenging of Zn from the rest of the meteorite during parent body thermal metamorphism. Less mobile elements appear to have maintained their initial heterogeneity.

NWA10758: A New CV3 Chondrite Bearing a Giant CAI with Hibonite-Rich Wark-Lovering Rim

Science.gov (United States)

Ross, D. K.; Simon, J. I.; Zolensky, M.

2017-01-01

Northwest Africa (NWA) 10758 is a newly identified carbonaceous chondrite that is a Bali-like oxidized CV3. The large Ca-Al rich inclusion (CAI) in this sample is approx. 2.4 x 1.4 cm. The CAI is transitional in composition between type A and type B, with interior mineralogy dominated by melilite, plus less abundant spinel and Al-Ti rich diopside, and only very minor anorthite (Fig. 1A). This CAI is largely free of secondary alteration in the exposed section we examined, with almost no nepheline, sodalite or Ca-Fe silicates. The Wark-Lovering (WL) rim on this CAI is dominated by hibonite, with lower abundances of spinel and perovskite, and with hibonite locally overlain by melilite plus perovskite (as in Fig. 1B). Note that the example shown in 1B is exceptional. Around most of the CAI, hibonite + spinel + perovskite form the WL rim, without overlying melilite. The WL rim can be unusually thick, ranging from approx. 20 microns up to approx. 150 microns. A well-developed, stratified accretionary rim infills embayments of the CAI, and thins over protuberances in the convoluted CAI surface.

Structural basis of Na+-independent and cooperative substrate/product antiport in CaiT

NARCIS (Netherlands)

Schulze, Sabrina; Köster, Stefan; Geldmacher, Ulrike; Terwisscha van Scheltinga, Anke C.; Kühlbrandt, Werner

2010-01-01

Transport of solutes across biological membranes is performed by specialized secondary transport proteins in the lipid bilayer, and is essential for life. Here we report the structures of the sodium-independent carnitine/butyrobetaine antiporter CaiT from Proteus mirabilis (PmCaiT) at 2.3-Å and from

Ca-Fe and Alkali-Halide Alteration of an Allende Type B CAI: Aqueous Alteration in Nebular or Asteroidal Settings

Science.gov (United States)

Ross, D. K.; Simon, J. I.; Simon, S. B.; Grossman, L.

2012-01-01

Ca-Fe and alkali-halide alteration of CAIs is often attributed to aqueous alteration by fluids circulating on asteroidal parent bodies after the various chondritic components have been assembled, although debate continues about the roles of asteroidal vs. nebular modification processes [1-7]. Here we report de-tailed observations of alteration products in a large Type B2 CAI, TS4 from Allende, one of the oxidized subgroup of CV3s, and propose a speculative model for aqueous alteration of CAIs in a nebular setting. Ca-Fe alteration in this CAI consists predominantly of end-member hedenbergite, end-member andradite, and compositionally variable, magnesian high-Ca pyroxene. These phases are strongly concentrated in an unusual "nodule" enclosed within the interior of the CAI (Fig. 1). The Ca, Fe-rich nodule superficially resembles a clast that pre-dated and was engulfed by the CAI, but closer inspection shows that relic spinel grains are enclosed in the nodule, and corroded CAI primary phases interfinger with the Fe-rich phases at the nodule s margins. This CAI also contains abundant sodalite and nepheline (alkali-halide) alteration that occurs around the rims of the CAI, but also penetrates more deeply into the CAI. The two types of alteration (Ca-Fe and alkali-halide) are adjacent, and very fine-grained Fe-rich phases are associated with sodalite-rich regions. Both types of alteration appear to be replacive; if that is true, it would require substantial introduction of Fe, and transport of elements (Ti, Al and Mg) out of the nodule, and introduction of Na and Cl into alkali-halide rich zones. Parts of the CAI have been extensively metasomatized.

The Relevance of AI Research to CAI.

Science.gov (United States)

Kearsley, Greg P.

This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

Northwest Africa 10758: A New CV3 Chondrite Bearing a Giant CAI with Hibonite-Rich Wark-Lovering Rim

Science.gov (United States)

Ross, D. K.; Simon, J. I.; Zolensky, M.

2017-01-01

Northwest Africa (NWA) 10758 is a newly identified carbonaceous chondrite that is a Bali-like oxidized CV3. The large Ca-Al rich inclusion (CAI) in this sample is approx. 2.4 x 1.4 cm. The CAI is transitional in composition between type A and type B, with interior mineralogy dominated by melilite, plus less abundant spinel and Al-Ti rich diopside, and only very minor anorthite (Fig. 1A). This CAI is largely free of secondary alteration in the exposed section we examined, with almost no nepheline, sodalite or Ca-Fe silicates. The Wark-Lovering (WL) rim on this CAI is dominated by hibonite, with lower abundances of spinel and perovskite, and with hibonite locally overlain by melilite plus perovskite (as in Fig. 1B). Note that the example shown in 1B is exceptional. Around most of the CAI, hibonite + spinel + perovskite form the WL rim, without overlying melilite. The WL rim can be unusually thick, ranging from approx.20 microns up to approx. 150 microns. A well-developed, stratified accretionary rim infills embayments of the CAI, and thins over protuberances in the convoluted CAI surface.

An ion microprobe study of CAIs from CO3 meteorites. [Abstract only

Science.gov (United States)

Russell, S. S.; Greenwood, R. C.; Fahey, A. J.; Huss, G. R.; Wasserburg, G. J.

1994-01-01

When attempting to interpret the history of Ca, Al-rich inclusions (CAIs) it is often difficult to distinguish between primary features inherited from the nebula and those produced during secondary processing on the parent body. We have undertaken a systematic study of CAIs from 10 CO chondrites, believed to represent a metamorphic sequence with the goal of distinguishing primary and secondary features. ALHA 77307 (3.0), Colony (3.0), Kainsaz (3.1), Felix (3.2), ALH 82101 (3.3), Ornans (3.3), Lance (3.4), ALHA 77003 (3.5), Warrenton (3.6), and Isna (3.7) were examined by Scanning Electron Microscopy (SEM) and optical microscopy. We have identified 141 CAIs within these samples, and studied in detail the petrology of 34 inclusions. The primary phases in the lower petrologic types are spinel, melilite, and hibonite. Perovskite, FeS, ilmenite, anorthite, kirschsteinite, and metallic Fe are present as minor phases. Melilite becomes less abundant in higher petrologic types and was not detected in chondrites of type 3.5 and above, confirming previous reports that this mineral easily breaks down during heating. Iron, an element that would not be expected to condense at high temperatures, has a lower abundance in spinel from low-petrologic-type meteorites than those of higher grade, and CaTiO3 is replaced by FeTiO3 in meteorites of higher petrologic type. The abundance of CAIs is similar in each meteorite. Eight inclusions have been analyzed by ion probe. The results are summarized. The results obtained to date show that CAIs in CO meteorites, like those from other meteorite classes, contain Mg* and that Mg in some inclusions has been redistributed.

Gender Role, Gender Identity and Sexual Orientation in CAIS ("XY-Women") Compared With Subfertile and Infertile 46,XX Women.

Science.gov (United States)

Brunner, Franziska; Fliegner, Maike; Krupp, Kerstin; Rall, Katharina; Brucker, Sara; Richter-Appelt, Hertha

2016-01-01

The perception of gender development of individuals with complete androgen insensitivity syndrome (CAIS) as unambiguously female has recently been challenged in both qualitative data and case reports of male gender identity. The aim of the mixed-method study presented was to examine the self-perception of CAIS individuals regarding different aspects of gender and to identify commonalities and differences in comparison with subfertile and infertile XX-chromosomal women with diagnoses of Mayer-Rokitansky-Küster-Hauser syndrome (MRKHS) and polycystic ovary syndrome (PCOS). The study sample comprised 11 participants with CAIS, 49 with MRKHS, and 55 with PCOS. Gender identity was assessed by means of a multidimensional instrument, which showed significant differences between the CAIS group and the XX-chromosomal women. Other-than-female gender roles and neither-female-nor-male sexes/genders were reported only by individuals with CAIS. The percentage with a not exclusively androphile sexual orientation was unexceptionally high in the CAIS group compared to the prevalence in "normative" women and the clinical groups. The findings support the assumption made by Meyer-Bahlburg ( 2010 ) that gender outcome in people with CAIS is more variable than generally stated. Parents and professionals should thus be open to courses of gender development other than typically female in individuals with CAIS.

The Cognitive Assessment Interview (CAI): development and validation of an empirically derived, brief interview-based measure of cognition.

Science.gov (United States)

Ventura, Joseph; Reise, Steven P; Keefe, Richard S E; Baade, Lyle E; Gold, James M; Green, Michael F; Kern, Robert S; Mesholam-Gately, Raquelle; Nuechterlein, Keith H; Seidman, Larry J; Bilder, Robert M

2010-08-01

Practical, reliable "real world" measures of cognition are needed to supplement neurocognitive performance data to evaluate possible efficacy of new drugs targeting cognitive deficits associated with schizophrenia. Because interview-based measures of cognition offer one possible approach, data from the MATRICS initiative (n=176) were used to examine the psychometric properties of the Schizophrenia Cognition Rating Scale (SCoRS) and the Clinical Global Impression of Cognition in Schizophrenia (CGI-CogS). We used classical test theory methods and item response theory to derive the 10-item Cognitive Assessment Interview (CAI) from the SCoRS and CGI-CogS ("parent instruments"). Sources of information for CAI ratings included the patient and an informant. Validity analyses examined the relationship between the CAI and objective measures of cognitive functioning, intermediate measures of cognition, and functional outcome. The rater's score from the newly derived CAI (10 items) correlate highly (r=.87) with those from the combined set of the SCoRS and CGI-CogS (41 items). Both the patient (r=.82) and the informant (r=.95) data were highly correlated with the rater's score. The CAI was modestly correlated with objectively measured neurocognition (r=-.32), functional capacity (r=-.44), and functional outcome (r=-.32), which was comparable to the parent instruments. The CAI allows for expert judgment in evaluating a patient's cognitive functioning and was modestly correlated with neurocognitive functioning, functional capacity, and functional outcome. The CAI is a brief, repeatable, and potentially valuable tool for rating cognition in schizophrenia patients who are participating in clinical trials. Copyright 2010 Elsevier B.V. All rights reserved.

Rancangan Perangkat Lunak Computer Assisted Instruction (CAI Untuk Ilmu Tajwid Berbasis Web

Directory of Open Access Journals (Sweden)

Fenny Purwani

2015-08-01

Full Text Available The development of information technology and science refer to the need of teching-learning concept and mechanism wich are based on information technology, undoubtedly. Regarding the development, it needs qualified human resources and flexible material changing and it should be appropriate with technology and science development. Additionaly, this combines between education based on religious and techology (IMTAK and IPTEK. Internet techology can be used as teaching tool which is known as Computer Assisted Intruction (CAI. CAI software might be one of media or tool in learnig tajwid and it can help people to learn Tajwid easier.

Development of an intelligent CAI system for a distributed processing environment

International Nuclear Information System (INIS)

Fujii, M.; Sasaki, K.; Ohi, T.; Itoh, T.

1993-01-01

In order to operate a nuclear power plant optimally in both normal and abnormal situations, the operators are trained using an operator training simulator in addition to classroom instruction. Individual instruction using a CAI (Computer-Assisted Instruction) system has become popular as a method of learning plant information, such as plant dynamics, operational procedures, plant systems, plant facilities, etc. The outline is described of a proposed network-based intelligent CAI system (ICAI) incorporating multi-medial PWR plant dynamics simulation, teaching aids and educational record management using the following environment: existing standard workstations and graphic workstations with a live video processing function, TCP/IP protocol of Unix through Ethernet and X window system. (Z.S.) 3 figs., 2 refs

A Braça da Rede, uma Técnica Caiçara de Medir

Directory of Open Access Journals (Sweden)

Gilberto Chieus Jr.

2009-08-01

Full Text Available Este artigo relata como os caiçaras da cidade de Ubatuba litoral norte paulista medem suas redes de pesca.Mas antes de estar analisando sua técnica de medir estaremos fazendo uma pequena abordagem da cultura caiçara e suas transformações. Em seguida mostraremos alguns momentos históricos da construção do metro. Depois como os caiçaras medem suas redes e o problema ocorrido no Brasil na implantação do sistema métrico decimal e a resistência de determinadas civilizações que se utiliza de outros padrões para realizar suas medidas, ignorando o atual sistema métrico, devidos o seu contexto cultural. Toda esta discussão está enfocada numa perspectiva histórica da Etnomatemática.

Thermal and chemical evolution in the early solar system as recorded by FUN CAIs: Part I - Petrology, mineral chemistry, and isotopic composition of Allende FUN CAI CMS-1

Science.gov (United States)

Williams, C. D.; Ushikubo, T.; Bullock, E. S.; Janney, P. E.; Hines, R. R.; Kita, N. T.; Hervig, R. L.; MacPherson, G. J.; Mendybaev, R. A.; Richter, F. M.; Wadhwa, M.

2017-03-01

Detailed petrologic, geochemical and isotopic analyses of a new FUN CAI from the Allende CV3 meteorite (designated CMS-1) indicate that it formed by extensive melting and evaporation of primitive precursor material(s). The precursor material(s) condensed in a 16O-rich region (δ17O and δ18O ∼ -49‰) of the inner solar nebula dominated by gas of solar composition at total pressures of ∼10-3-10-6 bar. Subsequent melting of the precursor material(s) was accompanied by evaporative loss of magnesium, silicon and oxygen resulting in large mass-dependent isotope fractionations in these elements (δ25Mg = 30.71-39.26‰, δ29Si = 14.98-16.65‰, and δ18O = -41.57 to -15.50‰). This evaporative loss resulted in a bulk composition similar to that of compact Type A and Type B CAIs, but very distinct from the composition of the original precursor condensate(s). Kinetic fractionation factors and the measured mass-dependent fractionation of silicon and magnesium in CMS-1 suggest that ∼80% of the silicon and ∼85% of the magnesium were lost from its precursor material(s) through evaporative processes. These results suggest that the precursor material(s) of normal and FUN CAIs condensed in similar environments, but subsequently evolved under vastly different conditions such as total gas pressure. The chemical and isotopic differences between normal and FUN CAIs could be explained by sorting of early solar system materials into distinct physical and chemical regimes, in conjunction with discrete heating events, within the protoplanetary disk.

OXYGEN ISOTOPIC COMPOSITIONS OF THE ALLENDE TYPE C CAIs: EVIDENCE FOR ISOTOPIC EXCHANGE DURING NEBULAR MELTING AND ASTEROIDAL THERMAL METAMORPHISM

Energy Technology Data Exchange (ETDEWEB)

Krot, A N; Chaussidon, M; Yurimoto, H; Sakamoto, N; Nagashima, K; Hutcheon, I D; MacPherson, G J

2008-02-21

Based on the mineralogy and petrography, coarse-grained, igneous, anorthite-rich (Type C) calcium-aluminum-rich inclusions (CAIs) in the CV3 carbonaceous chondrite Allende have been recently divided into three groups: (i) CAIs with melilite and Al,Ti-diopside of massive and lacy textures (coarse grains with numerous rounded inclusions of anorthite) in a fine-grained anorthite groundmass (6-1-72, 100, 160), (ii) CAI CG5 with massive melilite, Al,Ti-diopside and anorthite, and (iii) CAIs associated with chondrule material: either containing chondrule fragments in their peripheries (ABC, TS26) or surrounded by chondrule-like, igneous rims (93) (Krot et al., 2007a,b). Here, we report in situ oxygen isotopic measurements of primary (melilite, spinel, Al,Ti-diopside, anorthite) and secondary (grossular, monticellite, forsterite) minerals in these CAIs. Spinel ({Delta}{sup 17}O = -25{per_thousand} to -20{per_thousand}), massive and lacy Al,Ti-diopside ({Delta}{sup 17}O = -20{per_thousand} to -5{per_thousand}) and fine-grained anorthite ({Delta}{sup 17}O = -15{per_thousand} to -2{per_thousand}) in 100, 160 and 6-1-72 are {sup 16}O-enriched relative spinel and coarse-grained Al,Ti-diopside and anorthite in ABC, 93 and TS26 ({Delta}{sup 17}O ranges from -20{per_thousand} to -15{per_thousand}, from -15{per_thousand} to -5{per_thousand}, and from -5{per_thousand} to 0{per_thousand}, respectively). In 6-1-72, massive and lacy Al,Ti-diopside grains are {sup 16}O-depleted ({Delta}{sup 17}O {approx} -13{per_thousand}) relative to spinel ({Delta}{sup 17}O = -23{per_thousand}). Melilite is the most {sup 16}O-depleted mineral in all Allende Type C CAIs. In CAI 100, melilite and secondary grossular, monticellite and forsterite (minerals replacing melilite) are similarly {sup 16}O-depleted, whereas grossular in CAI 160 is {sup 16}O-enriched ({Delta}{sup 17}O = -10{per_thousand} to -6{per_thousand}) relative to melilite ({Delta}{sup 17}O = -5{per_thousand} to -3{per_thousand}). We infer

Stable Magnesium Isotope Variation in Melilite Mantle of Allende Type B1 CAI EK 459-5-1

Science.gov (United States)

Kerekgyarto, A. G.; Jeffcoat, C. R.; Lapen, T. J.; Andreasen, R.; Righter, M.; Ross, D. K.

2014-01-01

Ca-Al-rich inclusions (CAIs) are the earliest formed crystalline material in our solar system and they record early Solar System processes. Here we present petrographic and delta Mg-25 data of melilite mantles in a Type B1 CAI that records early solar nebular processes.

Multiple Nebular Gas Reservoirs Recorded by Oxygen Isotope Variation in a Spinel-rich CAI in CO3 MIL 090019

Science.gov (United States)

Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.

2017-01-01

We conducted NanoSIMS O-isotopic imaging of a primitive spinel-rich CAI spherule (27-2) from the MIL 090019 CO3 chondrite. Inclusions such as 27-2 are proposed to record inner nebula processes during an epoch of rapid solar nebula evolution. Mineralogical and textural analyses suggest that this CAI formed by high temperature reactions, partial melting, and condensation. This CAI exhibits radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting interactions with distinct nebular O-isotopic reservoirs.

The enhancement of students’ mathematical representation in junior high school using cognitive apprenticeship instruction (CAI)

Science.gov (United States)

Yusepa, B. G. P.; Kusumah, Y. S.; Kartasasmita, B. G.

2018-03-01

This study aims to get an in-depth understanding of the enhancement of students’ mathematical representation. This study is experimental research with pretest-posttest control group design. The subject of this study is the students’ of the eighth grade from junior high schools in Bandung: high-level and middle-level. In each school, two parallel groups were chosen as a control group and an experimental group. The experimental group was given cognitive apprenticeship instruction (CAI) treatment while the control group was given conventional learning. The results show that the enhancement of students’ mathematical representation who obtained CAI treatment was better than the conventional one, viewed which can be observed from the overall, mathematical prior knowledge (MPK), and school level. It can be concluded that CAI can be used as a good alternative learning model to enhance students’ mathematical representation.

CAIS/ACSI 2001: Beyond the Web: Technologies, Knowledge and People.

Science.gov (United States)

Canadian Journal of Information and Library Science, 2000

2000-01-01

Presents abstracts of papers presented at the 29th Annual Conference of the Canadian Association for Information Science (CAIS) held in Quebec on May 27-29, 2001. Topics include: professional development; librarian/library roles; information technology uses; virtual libraries; information seeking behavior; literacy; information retrieval;…

CAI多媒體教學軟體之開發模式 Using an Instructional Design Model for Developing a Multimedia CAI Courseware

Directory of Open Access Journals (Sweden)

Hsin-Yih Shyu

1995-09-01

Full Text Available 無This article outlined a systematic instructional design model for developing a multimedia computer-aided instruction (CAI courseware. The model illustrated roles and tasks as two dimensions necessary in a CAI production teamwork. Four major components (Analysis, Design, Development, and Revise/Evaluation following by totally 25 steps are provided. Eight roles with each competent skills were identified. The model will be useful in serving as a framework for developing a mulrimedia CAI courseware for educators, instructional designers and CAI industry developers.

Consumption of fa cai Nostoc soup: a potential for BMAA exposure from Nostoc cyanobacteria in China?

Science.gov (United States)

Roney, Britton R; Renhui, Li; Banack, Sandra Anne; Murch, Susan; Honegger, Rosmarie; Cox, Paul Alan

2009-01-01

Grown in arid regions of western China the cyanobacterium Nostoc flagelliforme--called fa cai in Mandarin and fat choy in Cantonese--is wild-harvested and used to make soup consumed during New Year's celebrations. High prices, up to $125 USD/kg, led to overharvesting in Inner Mongolia, Ningxia, Gansu, Qinghai, and Xinjiang. Degradation of arid ecosystems, desertification, and conflicts between Nostoc harvesters and Mongol herdsmen concerned the Chinese environmental authorities, leading to a government ban of Nostoc commerce. This ban stimulated increased marketing of a substitute made from starch. We analysed samples purchased throughout China as well as in Chinese markets in the United States and the United Kingdom. Some were counterfeits consisting of dyed starch noodles. A few samples from California contained Nostoc flagelliforme but were adulterated with starch noodles. Other samples, including those from the United Kingdom, consisted of pure Nostoc flagelliforme. A recent survey of markets in Cheng Du showed no real Nostoc flagelliforme to be marketed. Real and artificial fa cai differ in the presence of beta-N-methylamino-L-alanine (BMAA). Given its status as a high-priced luxury food, the government ban on collection and marketing, and the replacement of real fa cai with starch substitutes consumed only on special occasions, it is anticipated that dietary exposure to BMAA from fa cai will be reduced in the future in China.

Hunting and use of terrestrial fauna used by Caiçaras from the Atlantic Forest coast (Brazil

Directory of Open Access Journals (Sweden)

Alves Rômulo RN

2009-11-01

Full Text Available Abstract Background The Brazilian Atlantic Forest is considered one of the hotspots for conservation, comprising remnants of rain forest along the eastern Brazilian coast. Its native inhabitants in the Southeastern coast include the Caiçaras (descendants from Amerindians and European colonizers, with a deep knowledge on the natural resources used for their livelihood. Methods We studied the use of the terrestrial fauna in three Caiçara communities, through open-ended interviews with 116 native residents. Data were checked through systematic observations and collection of zoological material. Results The dependence on the terrestrial fauna by Caiçaras is especially for food and medicine. The main species used are Didelphis spp., Dasyprocta azarae, Dasypus novemcinctus, and small birds (several species of Turdidae. Contrasting with a high dependency on terrestrial fauna resources by native Amazonians, the Caiçaras do not show a constant dependency on these resources. Nevertheless, the occasional hunting of native animals represents a complimentary source of animal protein. Conclusion Indigenous or local knowledge on native resources is important in order to promote local development in a sustainable way, and can help to conserve biodiversity, particularly if the resource is sporadically used and not commercially exploited.

Exhumation history of the western Kyrgyz Tien Shan: Implications for intramontane basin formation

Science.gov (United States)

Bande, Alejandro; Sobel, Edward R.; Mikolaichuk, Alexander; Schmidt, Alexander; Stockli, Daniel F.

2017-01-01

The dextral Talas-Fergana Fault separates the western from the central Tien Shan. Recent work has shed light on the Cenozoic evolution of the eastern and central Tien Shan; much less attention has been paid to the western Tien Shan. In this contribution we present new thermochronological ages for the Fergana and Alai ranges that, combined with the available data set, constrain the Cenozoic exhumation history of the western Tien Shan. Following a tectonically quiet early Cenozoic period, we suggest an onset of exhumation at 25 Ma. This early onset was followed by a period of slower exhumation and in some areas minor reheating. A final, strong late Miocene rapid cooling event is well represented in the western Tien Shan as in other sectors of the range. The early onset of uplift of the western Tien Shan dissected the previously continuous westernmost Parathethyan Sea, progressively isolating basins (e.g., Fergana, Tarim, and Alai basins) in the central Asian hinterland. Moreover, the coeval timing of late Miocene uplift along the length of entire Tien Shan implies that neither the Pamir nor Tarim can be the sole driver for exhumation of the entire range.

CAD/CAM/CAI Application for High-Precision Machining of Internal Combustion Engine Pistons

Directory of Open Access Journals (Sweden)

V. V. Postnov

2014-07-01

Full Text Available CAD/CAM/CAI application solutions for internal combustion engine pistons machining was analyzed. Low-volume technology of internal combustion engine pistons production was proposed. Fixture for CNC turning center was designed.

Changes in flavour and microbial diversity during natural fermentation of suan-cai, a traditional food made in Northeast China.

Science.gov (United States)

Wu, Rina; Yu, Meiling; Liu, Xiaoyu; Meng, Lingshuai; Wang, Qianqian; Xue, Yating; Wu, Junrui; Yue, Xiqing

2015-10-15

We measured changes in the main physical and chemical properties, flavour compounds and microbial diversity in suan-cai during natural fermentation. The results showed that the pH and concentration of soluble protein initially decreased but were then maintained at a stable level; the concentration of nitrite increased in the initial fermentation stage and after reaching a peak it decreased significantly to a low level by the end of fermentation. Suan-cai was rich in 17 free amino acids. All of the free amino acids increased in concentration to different degrees, except histidine. Total free amino acids reached their highest levels in the mid-fermentation stage. The 17 volatile flavour components identified at the start of fermentation increased to 57 by the mid-fermentation stage; esters and aldehydes were in the greatest diversity and abundance, contributing most to the aroma of suan-cai. Bacteria were more abundant and diverse than fungi in suan-cai; 14 bacterial species were identified from the genera Leuconostoc, Bacillus, Pseudomonas and Lactobacillus. The predominant fungal species identified were Debaryomyces hansenii, Candida tropicalis and Penicillium expansum. Copyright © 2015 Elsevier B.V. All rights reserved.

Calcium-aluminum-rich inclusions with fractionation and unknown nuclear effects (FUN CAIs)

DEFF Research Database (Denmark)

Krot, Alexander N.; Nagashima, Kazuhide; Wasserburg, Gerald J.

2014-01-01

We present a detailed characterization of the mineralogy, petrology, and oxygen isotopic compositions of twelve FUN CAIs, including C1 and EK1-4-1 from Allende (CV), that were previously shown to have large isotopic fractionation patterns for magnesium and oxygen, and large isotopic anomalies...

The Range of Initial 10Be/9Be Ratios in the Early Solar System: A Re-Assessment Based on Analyses of New CAIs and Melilite Composition Glass Standards

Science.gov (United States)

Dunham, E.; Wadhwa, M.; Liu, M.-C.

2017-07-01

We report a more accurate range of initial 10Be/9Be in CAIs including FUN CAI CMS-1 from Allende (CV3) and a new CAI from NWA 5508 (CV3) using melilite composition glass standards; we suggest 10Be is largely produced by irradiation in the nebula.

Exploring Chondrule and CAI Rims Using Micro- and Nano-Scale Petrological and Compositional Analysis

Science.gov (United States)

Cartwright, J. A.; Perez-Huerta, A.; Leitner, J.; Vollmer, C.

2017-12-01

As the major components within chondrites, chondrules (mm-sized droplets of quenched silicate melt) and calcium-aluminum-rich inclusions (CAI, refractory) represent the most abundant and the earliest materials that solidified from the solar nebula. However, the exact formation mechanisms of these clasts, and whether these processes are related, remains unconstrained, despite extensive petrological and compositional study. By taking advantage of recent advances in nano-scale tomographical techniques, we have undertaken a combined micro- and nano-scale study of CAI and chondrule rim morphologies, to investigate their formation mechanisms. The target lithologies for this research are Wark-Lovering rims (WLR), and fine-grained rims (FGR) around CAIs and chondrules respectively, present within many chondrites. The FGRs, which are up to 100 µm thick, are of particular interest as recent studies have identified presolar grains within them. These grains predate the formation of our Solar System, suggesting FGR formation under nebular conditions. By contrast, WLRs are 10-20 µm thick, made of different compositional layers, and likely formed by flash-heating shortly after CAI formation, thus recording nebular conditions. A detailed multi-scale study of these respective rims will enable us to better understand their formation histories and determine the potential for commonality between these two phases, despite reports of an observed formation age difference of up to 2-3 Myr. We are using a combination of complimentary techniques on our selected target areas: 1) Micro-scale characterization using standard microscopic and compositional techniques (SEM-EBSD, EMPA); 2) Nano-scale characterization of structures using transmission electron microscopy (TEM) and elemental, isotopic and tomographic analysis with NanoSIMS and atom probe tomography (APT). Preliminary nano-scale APT analysis of FGR morphologies within the Allende carbonaceous chondrite has successfully discerned

Numerical investigation of CAI Combustion in the Opposed- Piston Engine with Direct and Indirect Water Injection

Science.gov (United States)

Pyszczek, R.; Mazuro, P.; Teodorczyk, A.

2016-09-01

This paper is focused on the CAI combustion control in a turbocharged 2-stroke Opposed-Piston (OP) engine. The barrel type OP engine arrangement is of particular interest for the authors because of its robust design, high mechanical efficiency and relatively easy incorporation of a Variable Compression Ratio (VCR). The other advantage of such design is that combustion chamber is formed between two moving pistons - there is no additional cylinder head to be cooled which directly results in an increased thermal efficiency. Furthermore, engine operation in a Controlled Auto-Ignition (CAI) mode at high compression ratios (CR) raises a possibility of reaching even higher efficiencies and very low emissions. In order to control CAI combustion such measures as VCR and water injection were considered for indirect ignition timing control. Numerical simulations of the scavenging and combustion processes were performed with the 3D CFD multipurpose AVL Fire solver. Numerous cases were calculated with different engine compression ratios and different amounts of directly and indirectly injected water. The influence of the VCR and water injection on the ignition timing and engine performance was determined and their application in the real engine was discussed.

Microstructures of Hibonite From an ALH A77307 (CO3.0) CAI: Evidence for Evaporative Loss of Calcium

Science.gov (United States)

Han, Jangmi; Brearley, Adrian J.; Keller, Lindsay P.

2014-01-01

Hibonite is a comparatively rare, primary phase found in some CAIs from different chondrite groups and is also common in Wark-Lovering rims [1]. Hibonite is predicted to be one of the earliest refractory phases to form by equilibrium condensation from a cooling gas of solar composition [2] and, therefore, can be a potential recorder of very early solar system processes. In this study, we describe the microstructures of hibonite from one CAI in ALH A77307 (CO3.0) using FIB/TEM techniques in order to reconstruct its formational history.

CO-Bridged H-Cluster Intermediates in the Catalytic Mechanism of [FeFe]-Hydrogenase CaI.

Science.gov (United States)

Ratzloff, Michael W; Artz, Jacob H; Mulder, David W; Collins, Reuben T; Furtak, Thomas E; King, Paul W

2018-06-20

The [FeFe]-hydrogenases ([FeFe] H 2 ases) catalyze reversible H 2 activation at the H-cluster, which is composed of a [4Fe-4S] H subsite linked by a cysteine thiolate to a bridged, organometallic [2Fe-2S] ([2Fe] H ) subsite. Profoundly different geometric models of the H-cluster redox states that orchestrate the electron/proton transfer steps of H 2 bond activation have been proposed. We have examined this question in the [FeFe] H 2 ase I from Clostridium acetobutylicum (CaI) by Fourier-transform infrared (FTIR) spectroscopy with temperature annealing and H/D isotope exchange to identify the relevant redox states and define catalytic transitions. One-electron reduction of H ox led to formation of H red H + ([4Fe-4S] H 2+ -Fe I -Fe I ) and H red ' ([4Fe-4S] H 1+ -Fe II -Fe I ), with both states characterized by low frequency μ-CO IR modes consistent with a fully bridged [2Fe] H . Similar μ-CO IR modes were also identified for H red H + of the [FeFe] H 2 ase from Chlamydomonas reinhardtii (CrHydA1). The CaI proton-transfer variant C298S showed enrichment of an H/D isotope-sensitive μ-CO mode, a component of the hydride bound H-cluster IR signal, H hyd . Equilibrating CaI with increasing amounts of NaDT, and probed at cryogenic temperatures, showed H red H + was converted to H hyd . Over an increasing temperature range from 10 to 260 K catalytic turnover led to loss of H hyd and appearance of H ox , consistent with enzymatic turnover and H 2 formation. The results show for CaI that the μ-CO of [2Fe] H remains bridging for all of the "H red " states and that H red H + is on pathway to H hyd and H 2 evolution in the catalytic mechanism. These results provide a blueprint for designing small molecule catalytic analogs.

Numerical Investigation Into Effect of Fuel Injection Timing on CAI/HCCI Combustion in a Four-Stroke GDI Engine

Science.gov (United States)

Cao, Li; Zhao, Hua; Jiang, Xi; Kalian, Navin

2006-02-01

The Controlled Auto-Ignition (CAI) combustion, also known as Homogeneous Charge Compression Ignition (HCCI), was achieved by trapping residuals with early exhaust valve closure in conjunction with direct injection. Multi-cycle 3D engine simulations have been carried out for parametric study on four different injection timings in order to better understand the effects of injection timings on in-cylinder mixing and CAI combustion. The full engine cycle simulation including complete gas exchange and combustion processes was carried out over several cycles in order to obtain the stable cycle for analysis. The combustion models used in the present study are the Shell auto-ignition model and the characteristic-time combustion model, which were modified to take the high level of EGR into consideration. A liquid sheet breakup spray model was used for the droplet breakup processes. The analyses show that the injection timing plays an important role in affecting the in-cylinder air/fuel mixing and mixture temperature, which in turn affects the CAI combustion and engine performance.

Source processes of strong earthquakes in the North Tien-Shan region

Science.gov (United States)

Kulikova, G.; Krueger, F.

2013-12-01

Tien-Shan region attracts attention of scientists worldwide due to its complexity and tectonic uniqueness. A series of very strong destructive earthquakes occurred in Tien-Shan at the turn of XIX and XX centuries. Such large intraplate earthquakes are rare in seismology, which increases the interest in the Tien-Shan region. The presented study focuses on the source processes of large earthquakes in Tien-Shan. The amount of seismic data is limited for those early times. In 1889, when a major earthquake has occurred in Tien-Shan, seismic instruments were installed in very few locations in the world and these analog records did not survive till nowadays. Although around a hundred seismic stations were operating at the beginning of XIX century worldwide, it is not always possible to get high quality analog seismograms. Digitizing seismograms is a very important step in the work with analog seismic records. While working with historical seismic records one has to take into account all the aspects and uncertainties of manual digitizing and the lack of accurate timing and instrument characteristics. In this study, we develop an easy-to-handle and fast digitization program on the basis of already existing software which allows to speed up digitizing process and to account for all the recoding system uncertainties. Owing to the lack of absolute timing for the historical earthquakes (due to the absence of a universal clock at that time), we used time differences between P and S phases to relocate the earthquakes in North Tien-Shan and the body-wave amplitudes to estimate their magnitudes. Combining our results with geological data, five earthquakes in North Tien-Shan were precisely relocated. The digitizing of records can introduce steps into the seismograms which makes restitution (removal of instrument response) undesirable. To avoid the restitution, we simulated historic seismograph recordings with given values for damping and free period of the respective instrument and

Conhecimento e uso de plantas em uma comunidade caiçara do litoral sul do Estado do Rio de Janeiro, Brasil Knowledge and use of plants in a Caiçara community located on the southern coast of Rio de Janeiro State, Brazil

Directory of Open Access Journals (Sweden)

Rodrigo Borges

2009-09-01

Full Text Available A Área de Proteção Ambiental de Cairuçu (APA localiza-se no município de Paraty, RJ. É uma unidade de conservação de uso sustentável e dispõe-se a proteger o ambiente natural e as comunidades caiçaras da região. O objetivo deste estudo foi realizar um inventário etnobotânico das plantas conhecidas e utilizadas pela comunidade caiçara que habita a praia de Martim de Sá. Moram no local 30 pessoas das quais 10 foram entrevistadas. As informações etnobotânicas foram obtidas através da observação participante e entrevistas semi-estruturadas. O material botânico coletado foi depositado no Herbário do Instituto de Pesquisas Jardim Botânico do Rio de Janeiro (RB. Foram identificadas 76 espécies pertencentes a 59 gêneros e 30 famílias botânicas consideradas úteis pelos caiçaras. As três espécies mais citadas foram: Sloanea obtusifolia (Sapopema, Scherolobium denudatum (Ingá-ferro e Balizia pedicelaris (Timbuíba. Utilizou-se o Índice de Shannon (H' = 1,81 - base 10 para a análise da diversidade de espécies. O registro sobre o uso dos recursos vegetais na comunidade estudada fornece informações que podem ser utilizadas para programas de conservação baseados no conhecimento local do ambiente.The Cairuçu Environmental Protection Area (APA was created to help assure the protection of the natural environment and its sustainable use by the caiçara communities in the region. This work presents an ethnobotanical inventory of the plants known and used by the caiçara community living on Martim de Sá beach in Paraty municipality, RJ. Thirty people live in the locality and ten of them were interviewed. Ethnobotanical information was obtained through participatory observations and semi-structured interviews with the local residents. All botanical material collected was deposited in the herbarium of the Instituto de Pesquisas Jardim Botânico do Rio de Janeiro (RB. A total of 76 species belonging to 59 genera and 30

CaI and SrI molecules for iodine determination by high-resolution continuum source graphite furnace molecular absorption spectrometry: Greener molecules for practical application.

Science.gov (United States)

Zanatta, Melina Borges Teixeira; Nakadi, Flávio Venâncio; da Veiga, Márcia Andreia Mesquita Silva

2018-03-01

A new method to determine iodine in drug samples by high-resolution continuum source graphite furnace molecular absorption spectrometry (HR-CS GF MAS) has been developed. The method measures the molecular absorption of a diatomic molecule, CaI or SrI (less toxic molecule-forming reagents), at 638.904 or 677.692nm, respectively, and uses a mixture containing 5μg of Pd and 0.5μg of Mg as chemical modifier. The method employs pyrolysis temperatures of 1000 and 800°C and vaporization temperatures of 2300 and 2400°C for CaI and SrI, respectively. The optimized amounts of Ca and Sr as molecule-forming reagents are 100 and 150µg, respectively. On the basis of interference studies, even small chlorine concentrations reduce CaI and SrI absorbance significantly. The developed method was used to analyze different commercial drug samples, namely thyroid hormone pills with three different iodine amounts (15.88, 31.77, and 47.66µg) and one liquid drug with 1% m v -1 active iodine in their compositions. The results agreed with the values informed by the manufacturers (95% confidence level) regardless of whether CaI or SrI was determined. Therefore, the developed method is useful for iodine determination on the basis of CaI or SrI molecular absorption. Copyright © 2017 Elsevier B.V. All rights reserved.

Developing the Coach Analysis and Intervention System (CAIS): establishing validity and reliability of a computerised systematic observation instrument.

Science.gov (United States)

Cushion, Christopher; Harvey, Stephen; Muir, Bob; Nelson, Lee

2012-01-01

We outline the evolution of a computerised systematic observation tool and describe the process for establishing the validity and reliability of this new instrument. The Coach Analysis and Interventions System (CAIS) has 23 primary behaviours related to physical behaviour, feedback/reinforcement, instruction, verbal/non-verbal, questioning and management. The instrument also analyses secondary coach behaviour related to performance states, recipient, timing, content and questioning/silence. The CAIS is a multi-dimensional and multi-level mechanism able to provide detailed and contextualised data about specific coaching behaviours occurring in complex and nuanced coaching interventions and environments that can be applied to both practice sessions and competition.

Calcium and Titanium Isotope Fractionation in CAIS: Tracers of Condensation and Inheritance in the Early Solar Protoplanetary Disk

Science.gov (United States)

Simon, J. I.; Jordan, M. K.; Tappa, M. J.; Kohl, I. E.; Young, E. D.

2016-01-01

The chemical and isotopic compositions of calcium-aluminum-rich inclusions (CAIs) can be used to understand the conditions present in the protoplantary disk where they formed. The isotopic compositions of these early-formed nebular materials are largely controlled by chemical volatility. The isotopic effects of evaporation/sublimation, which are well explained by both theory and experimental work, lead to enrichments of the heavy isotopes that are often exhibited by the moderately refractory elements Mg and Si. Less well understood are the isotopic effects of condensation, which limits our ability to determine whether a CAI is a primary condensate and/or retains any evidence of its primordial formation history.

Glaciers and hydrological changes in the Tien Shan: simulation and prediction

International Nuclear Information System (INIS)

Aizen, V B; Aizen, E M; Kuzmichonok, V A

2007-01-01

In this study, we estimated the current glacier state and forecast the potential impact of global and regional climate change on the glaciers and glacier runoff in the Tien Shan. General (G) and detailed (D) simulations were developed based on assessment of the Tien Shan glacier recession between 1943 and 2003 using an iterative stepwise increase in the equilibrium line altitude of 20 m. The G simulation was developed for 2777 grids each of which covered over 1000 km 2 of glacier surface and D for the 15 953 Tien Shan glaciers. Both simulations employed glacier morphometric characteristics derived from Digital Elevation Model based on remote sensing data, high resolution maps and in situ GPS validation. Simulated changes in glacier area demonstrated that a possible increase in air temperature of 1 deg. C at E-barLA must be compensated by a 100 mm increase in precipitation at the same altitude if Tien Shan glaciers are to be maintained in their current state. An increase in mean air temperature of 4 deg. C and precipitation of 1.1 times the current level could increase E-barLA by 570 m during the 21st century. Under these conditions, the number of glaciers, glacier covered area, glacier volume, and glacier runoff are predicted to be 94%, 69%, 75%, and 75% of current values. The maximum glacier runoff may reach as much as 1.25 times current levels while the minimum will likely equal zero

An experimental study of fuel injection strategies in CAI gasoline engine

Energy Technology Data Exchange (ETDEWEB)

Hunicz, J.; Kordos, P. [Department of Combustion Engines and Transport, Lublin University of Technology, Nadbystrzycka 36, 20-618 Lublin (Poland)

2011-01-15

Combustion of gasoline in a direct injection controlled auto-ignition (CAI) single-cylinder research engine was studied. CAI operation was achieved with the use of the negative valve overlap (NVO) technique and internal exhaust gas re-circulation (EGR). Experiments were performed at single injection and split injection, where some amount of fuel was injected close to top dead centre (TDC) during NVO interval, and the second injection was applied with variable timing. Additionally, combustion at variable fuel-rail pressure was examined. Investigation showed that at fuel injection into recompressed exhaust fuel reforming took place. This process was identified via an analysis of the exhaust-fuel mixture composition after NVO interval. It was found that at single fuel injection in NVO phase, its advance determined the heat release rate and auto-ignition timing, and had a strong influence on NO{sub X} emission. However, a delay of single injection to intake stroke resulted in deterioration of cycle-to-cycle variability. Application of split injection showed benefits of this strategy versus single injection. Examinations of different fuel mass split ratios and variable second injection timing resulted in further optimisation of mixture formation. At equal share of the fuel mass injected in the first injection during NVO and in the second injection at the beginning of compression, the lowest emission level and cyclic variability improvement were observed. (author)

Calcium-aluminum-rich inclusions with fractionation and unidentified nuclear effects (FUN CAIs): II. Heterogeneities of magnesium isotopes and 26Al in the early Solar System inferred from in situ high-precision magnesium-isotope measurements

Science.gov (United States)

Park, Changkun; Nagashima, Kazuhide; Krot, Alexander N.; Huss, Gary R.; Davis, Andrew M.; Bizzarro, Martin

2017-03-01

Calcium-aluminum-rich inclusions with isotopic mass fractionation effects and unidentified nuclear isotopic anomalies (FUN CAIs) have been studied for more than 40 years, but their origins remain enigmatic. Here we report in situ high precision measurements of aluminum-magnesium isotope systematics of FUN CAIs by secondary ion mass spectrometry (SIMS). Individual minerals were analyzed in six FUN CAIs from the oxidized CV3 carbonaceous chondrites Axtell (compact Type A CAI Axtell 2271) and Allende (Type B CAIs C1 and EK1-4-1, and forsterite-bearing Type B CAIs BG82DH8, CG-14, and TE). Most of these CAIs show evidence for excess 26Mg due to the decay of 26Al. The inferred initial 26Al/27Al ratios [(26Al/27Al)0] and the initial magnesium isotopic compositions (δ26Mg0) calculated using an exponential law with an exponent β of 0.5128 are (3.1 ± 1.6) × 10-6 and 0.60 ± 0.10‰ (Axtell 2271), (3.7 ± 1.5) × 10-6 and -0.20 ± 0.05‰ (BG82DH8), (2.2 ± 1.1) × 10-6 and -0.18 ± 0.05‰ (C1), (2.3 ± 2.4) × 10-5 and -2.23 ± 0.37‰ (EK1-4-1), (1.5 ± 1.1) × 10-5 and -0.42 ± 0.08‰ (CG-14), and (5.3 ± 0.9) × 10-5 and -0.05 ± 0.08‰ (TE) with 2σ uncertainties. We infer that FUN CAIs recorded heterogeneities of magnesium isotopes and 26Al in the CAI-forming region(s). Comparison of 26Al-26Mg systematics, stable isotope (oxygen, magnesium, calcium, and titanium) and trace element studies of FUN and non-FUN igneous CAIs indicates that there is a continuum among these CAI types. Based on these observations and evaporation experiments on CAI-like melts, we propose a generic scenario for the origin of igneous (FUN and non-FUN) CAIs: (i) condensation of isotopically normal solids in an 16O-rich gas of approximately solar composition; (ii) formation of CAI precursors by aggregation of these solids together with variable abundances of isotopically anomalous grains-possible carriers of unidentified nuclear (UN) effects; and (iii) melt evaporation of these precursors

電腦輔助教學與個別教學結合: 電腦輔助教學課堂應用初探 Computer-Assisted Instruction Under the Management of Individualized Instruction: A Classroom Management Approach of CAI

Directory of Open Access Journals (Sweden)

Sunny S. J. Lin

1988-03-01

Full Text Available 無First reviews the development of Computer. Assisted Instruction (CAI in Taiwan. This study describes the training of teachers from different levels of schools to design CAI coursewares, and the planning of CAI courseware bank possesses 2,000 supplemental coursewares. Some CAI's c1assroom application system should be carefully established to prevent the easy abuse of a CAI courseware as an instructional plan. The study also claims to steer CAI in our elemantary and secondary education could rely on the mastery learning as the instructional plan. In this case, CAI must limit its role as the formative test and remedial material only. In the higher education , the Keller's Personalized System of Instruction could be an effective c1assroom management system. Therefore, CAI will offer study guide and formative test only. Using these 2 instructional system may enhance student's achievement , and speed up the learning rate at the same time. Combining with individualized instruction and CAI will be one of the most workable approach in current c1assroom . The author sets up an experiment 10 varify their effectiveness and efficiency in the near future.

Changes of Benthic Macroinvertebrates in Thi Vai River and Cai Mep Estuaries Under Polluted Conditions with Industrial Wastewater

Directory of Open Access Journals (Sweden)

Huong Nguyen Thi Thanh

2017-06-01

Full Text Available The pollution on the Thi Vai River has been spreading out rapidly over the two lasted decades caused by the wastewater from the industrial parks in the left bank of Thi Vai River and Cai Mep Estuaries. The evaluation of the benthic macroinvertebrate changes was very necessary to identify the consequences of the industrial wastewater on water quality and aquatic ecosystem of Thi Vai River and Cai Mep Estuaries. In this study, the variables of benthic macroinvertebrates and water quality were investigated in Thi Vai River and Cai Mep Estuaries, Southern Vietnam. The monitoring data of benthic macroinvertebrates and water quality parameters covered the period from 1989 to 2015 at 6 sampling sites in Thi Vai River and Cai Mep Estuaries. The basic water quality parameters were also tested including pH, dissolved oxygen (DO, total nitrogen, and total phosphorus. The biodiversity indices of benthic macroinvertebrates were applied for water quality assessment. The results showed that pH ranged from 6.4 – 7.6 during the monitoring. The DO concentrations were in between 0.20 - 6.70 mg/L. The concentrations of total nitrogen and total phosphorous ranged from 0.03 - 5.70 mg/L 0.024 - 1.380 mg/L respectively. Macroinvertebrate community in the study area consisted of 36 species of polychaeta, gastropoda, bivalvia, and crustacea, of which, species of polychaeta were dominant in species number. The benthic macroinvertebartes density ranged from 0 - 2.746 individuals/m−1 with the main dominant species of Neanthes caudata, Prionospio malmgreni, Paraprionospio pinnata, Trichochaeta carica, Maldane sarsi, Capitella capitata, Terebellides stroemi, Euditylia polymorpha, Grandidierella lignorum, Apseudes vietnamensis. The biodiversity index values during the monitoring characterized for aquatic environmental conditions of mesotrophic to polytrophic. Besides, species richness positively correlated with DO, total nitrogen, and total phosphorus. The results

CAI and training system for the emergency operation procedure in the advanced thermal reactor, FUGEN

International Nuclear Information System (INIS)

Kozaki, T.; Imanaga, K.; Nakamura, S.; Maeda, K.; Sakurai, N.; Miyamoto, M.

2003-01-01

In the Advanced Thermal Reactor (ATR ) of the JNC, 'FUGEN', a symptom based Emergency Operating Procedure (EOF) was introduced in order to operate Fugen more safely and it became necessary for the plant operators to master the EOF. However it took a lot of time for the instructor to teach the EOP to operators and to train them. Thus, we have developed a Computer Aided Instruction (CAI) and Training System for the EOP, by which the operators can learn the EOP and can be trained. This system has two major functions, i.e., CAI and training. In the CAI function, there are three learning courses, namely, the EOP procedure, the simulation with guidance and Q and A, and the free simulation. In the training function, all of necessary control instruments (indicators, switches, annunciators and so forth) and physics models for the EOP training are simulated so that the trainees can be trained for all of the EOPs. In addition, 50 kinds of malfunction models are installed in order to perform appropriate accident scenarios for the EOP. The training of the EOP covers the range from AOO (Anticipated Operational Occurrence) to Over-DBAs (Design Based Accidents). This system is built in three personal computers that are connected by the computer network. One of the computers is expected to be used for the instructor and the other two are for the trainees. The EOP is composed of eight guidelines, such as 'Reactor Control' and 'Depression and Cooling', and the operation screens which are corresponded to the guidelines are respectively provided. According to the trial, we have estimated that the efficiency of the learning and the training would be improved about 30% for the trainee and about 75% for the instructor in the actual learning and training. (author)

On native Danish learners' challenges in distinguishing /tai/, /cai/ and /zai/

DEFF Research Database (Denmark)

Sloos, Marjoleine; Zhang, Chun

2015-01-01

University participated in an ABX experiment. They were auditorily presented pairs of the critical stimuli tai-cai-zai, te-ce-ze and tuo-cuo-zuo combined with all four tones and alternated with fillers. The subjects indicated for each pair which of the two words matched the pinyin description. The expected...... results show that beginner learners perform on chance level regarding the distinction between t and z and between c and z. The reason is that in Danish, which has an aspiration contrast between plosives (like Chinese) /th/ is variably pronounced as affricated /ts/ and many speakers are unaware...

Bird community structure in riparian environments in Cai River, Rio Grande do Sul, Brazil

OpenAIRE

Jaqueline Brummelhaus; Marcia Suelí Bohn; Maria Virginia Petry

2012-01-01

Urbanization produces changes in riparian environments, causing effects in the structure of bird communities, which present different responses to the impacts. We compare species richness, abundance, and composition of birds in riparian environments with different characteristics in Cai River, Rio Grande do Sul, Brazil. We carried out observations in woodland, grassland, and urban environments, between September 2007 and August 2008. We listed 130 bird species, 29 species unique to woodland e...

Reciever Function Transect Across Tibet, Tarim and Tien Shan

Science.gov (United States)

Marshall, B.; Levin, V. L.; Huang, G.; Roecker, S. W.; Wang, H.

2010-12-01

We investigate the region of the ongoing collision between the India and Eurasia tectonic plates that results in widespread deformation of the continental lithosphere. Over the past decade, numerous regional studies were conducted between the Himalaya and the Tien Shan mountains, each illuminating a small part of the area. We combine the data from a number of portable and permanent networks to construct a ~1800 km long profile of lithospheric properties that cross three very different tectonic domains: the Tibetan plateau, the Tarim basin, and the Tien Shan mountains. We use data from 60 stations operated in the region by US, Chinese and French researchers. We use records of distant earthquakes to construct receiver function gathers for each station. The uniformity of processing ensures that our results are comparable along the transect. We examine receiver function gathers at each site, and rank their quality on the basis of number of records, noise levels, and directional stability of the wavefield. We select 27 sites with high-quality data. For these we construct average receiver function traces using data in the 60-85 degree range, and use them as a guide to the lithospheric layering beneath the region. On most receiver functions we constructed the most prominent feature is a positive phase likely associated with the crust-mantle transition. The timing of this phase varies significantly over the length of the profile. Beneath the Tibetan plateau delay times ~7-8 s are seen close to the Himalayas, and nearly 10 s delays are found further north. Delays of 6 to 8 s are seen beneath sites in the Tarim basin and the Tien Shan mountains, and nearly 10 s delays are seen at the border between them. In addition to the pulse associated with the crust-mantle transition we see other locally-consistent features, for example a negative phase with delay values between 3 and 5 s beneath much of the Tibetan plateau.

A Model Driven Question-Answering System for a CAI Environment. Final Report (July 1970 to May 1972).

Science.gov (United States)

Brown, John S.; And Others

A question answering system which permits a computer-assisted instruction (CAI) student greater initiative in the variety of questions he can ask is described. A method is presented to represent the dynamic processes of a subject matter area by augmented finite state automata, which permits efficient inferencing about dynamic processes and…

Multiple Nebular Gas Reservoirs Recorded by Oxygen Isotope Variation in a Spinel-Rich CAI in CO3 MIL 090019

Science.gov (United States)

Simon, J. I.; Simon, S. B.; Nguyen, A. N.; Ross, D. K.; Messenger, S.

2017-07-01

We conducted NanoSIMS ion imaging studies of a primitive spinel-rich CAI from the MIL 090019 CO3 chondrite. It records radial O-isotopic heterogeneity among multiple occurrences of the same mineral, reflecting distinct nebular O-isotopic reservoirs.

Complete genome sequence of Defluviimonas alba cai42T, a microbial exopolysaccharides producer.

Science.gov (United States)

Zhao, Jie-Yu; Geng, Shuang; Xu, Lian; Hu, Bing; Sun, Ji-Quan; Nie, Yong; Tang, Yue-Qin; Wu, Xiao-Lei

2016-12-10

Defluviimonas alba cai42 T , isolated from the oil-production water in Xinjiang Oilfield in China, has a strong ability to produce exopolysaccharides (EPS). We hereby present its complete genome sequence information which consists of a circular chromosome and three plasmids. The strain characteristically contains various genes encoding for enzymes involved in EPS biosynthesis, modification, and export. According to the genomic and physiochemical data, it is predicted that the strain has the potential to be utilized in industrial production of microbial EPS. Copyright © 2016 Elsevier B.V. All rights reserved.

Cualquier tiempo futuro tiene que ser mejor

Directory of Open Access Journals (Sweden)

Paquita Armas Fonseca

2015-01-01

Full Text Available Cuba tiene un importante movimiento caricaturista, conocido y laureado en los diversos lugares del mundo. No es el caso de la historieta que, a pesar de contar con muy buenos dibujantes, el desarrollo dramatúrgico no está a la altura de la imagen por lo que se ha visto limitada en su desarrollo. El guión es el talón de Aquiles del cómic cubano que no ha evolucionado como se hermana la caricatura. Es con la animación que el cómic cubano ha trascendido sus fronteras. Se trata de un movimiento vivo que ha saltado los más increíbles obstáculos.

A Design of Computer Aided Instructions (CAI) for Undirected Graphs in the Discrete Math Tutorial (DMT). Part 1.

Science.gov (United States)

1990-06-01

The objective of this thesis research is to create a tutorial for teaching aspects of undirected graphs in discrete math . It is one of the submodules...of the Discrete Math Tutorial (DMT), which is a Computer Aided Instructional (CAI) tool for teaching discrete math to the Naval Academy and the

A Design of Computer Aided Instructions (CAI) for Undirected Graphs in the Discrete Math Tutorial (DMT). Part 2

Science.gov (United States)

1990-06-01

The objective of this thesis research is to create a tutorial for teaching aspects of undirected graphs in discrete math . It is one of the submodules...of the Discrete Math Tutorial (DMT), which is a Computer Aided Instructional (CAI) tool for teaching discrete math to the Naval Academy and the

Sexual life and sexual wellness in individuals with complete androgen insensitivity syndrome (CAIS) and Mayer-Rokitansky-Küster-Hauser Syndrome (MRKHS).

Science.gov (United States)

Fliegner, Maike; Krupp, Kerstin; Brunner, Franziska; Rall, Katharina; Brucker, Sara Y; Briken, Peer; Richter-Appelt, Hertha

2014-03-01

Sexual wellness depends on a person's physical and psychological constitution. Complete Androgen Insensitivity Syndrome (CAIS) and Mayer-Rokitansky-Küster-Hauser Syndrome (MRKHS) can compromise sexual well-being. To compare sexual well-being in CAIS and MRKHS using multiple measures: To assess sexual problems and perceived distress. To gain insight into participants' feelings of inadequacy in social and sexual situations, level of self-esteem and depression. To determine how these psychological factors relate to sexual (dys)function. To uncover what participants see as the source of their sexual problems. Data were collected using a paper-and-pencil questionnaire. Eleven individuals with CAIS and 49 with MRKHS with/without neovagina treatment were included. Rates of sexual dysfunctions, overall sexual function, feelings of inadequacy in social and sexual situations, self-esteem and depression scores were calculated. Categorizations were used to identify critical cases. Correlations between psychological variables and sexual function were computed. Sexually active subjects were compared with sexually not active participants. A qualitative content analysis was carried out to explore causes of sexual problems. An extended list of sexual problems based on the Diagnostic and Statistical Manual of Mental Disorders, 4th ed., text revision, by the American Psychiatric Association and related distress. Female Sexual Function Index (FSFI), German Questionnaire on Feelings of Inadequacy in Social and Sexual Situations (FUSS social scale, FUSS sexual scale), Rosenberg Self-Esteem Scale (RSE), Brief Symptom Inventory (BSI) subscale depression. Open question on alleged causes of sexual problems. The results point to a far-reaching lack of sexual confidence and sexual satisfaction in CAIS. In MRKHS apprehension in sexual situations is a source of distress, but sexual problems seem to be more focused on issues of vaginal functioning. MRKHS women report being satisfied with their

Adaptation of an aerosol retrieval algorithm using multi-wavelength and multi-pixel information of satellites (MWPM) to GOSAT/TANSO-CAI

Science.gov (United States)

Hashimoto, M.; Takenaka, H.; Higurashi, A.; Nakajima, T.

2017-12-01

Aerosol in the atmosphere is an important constituent for determining the earth's radiation budget, so the accurate aerosol retrievals from satellite is useful. We have developed a satellite remote sensing algorithm to retrieve the aerosol optical properties using multi-wavelength and multi-pixel information of satellite imagers (MWPM). The method simultaneously derives aerosol optical properties, such as aerosol optical thickness (AOT), single scattering albedo (SSA) and aerosol size information, by using spatial difference of wavelegths (multi-wavelength) and surface reflectances (multi-pixel). The method is useful for aerosol retrieval over spatially heterogeneous surface like an urban region. In this algorithm, the inversion method is a combination of an optimal method and smoothing constraint for the state vector. Furthermore, this method has been combined with the direct radiation transfer calculation (RTM) numerically solved by each iteration step of the non-linear inverse problem, without using look up table (LUT) with several constraints. However, it takes too much computation time. To accelerate the calculation time, we replaced the RTM with an accelerated RTM solver learned by neural network-based method, EXAM (Takenaka et al., 2011), using Rster code. And then, the calculation time was shorternd to about one thouthandth. We applyed MWPM combined with EXAM to GOSAT/TANSO-CAI (Cloud and Aerosol Imager). CAI is a supplement sensor of TANSO-FTS, dedicated to measure cloud and aerosol properties. CAI has four bands, 380, 674, 870 and 1600 nm, and observes in 500 meters resolution for band1, band2 and band3, and 1.5 km for band4. Retrieved parameters are aerosol optical properties, such as aerosol optical thickness (AOT) of fine and coarse mode particles at a wavelenth of 500nm, a volume soot fraction in fine mode particles, and ground surface albedo of each observed wavelength by combining a minimum reflectance method and Fukuda et al. (2013). We will show

DUST LOADING OF THE ATMOSPHERE AND GLACIERS IN THE KUMTOR MINING AREA (AKSHYYRAK, TIEN SHAN)

OpenAIRE

V. A. Kuzmichenok

2012-01-01

Industrial development of the Kumtor Gold Mine in the nival-glacial zone of Tien Shan (altitude ranging from 4000 to 4500 m a.s.l.) is inevitably accompanied by the release of some additional amounts of dust in atmosphere. Sampling in 7 points and an analysis of the quantity (weight) of dust in the seasonal snow (September–April) on glaciers show that the dust pollution does not substantially exceed the natural level of dust in Tien Shan. An analysis of almost 3 000 daily measurements of dust...

From Corporate Social Responsibility, through Entrepreneurial Orientation, to Knowledge Sharing: A Study in Cai Luong (Renovated Theatre) Theatre Companies

Science.gov (United States)

Tuan, Luu Trong

2015-01-01

Purpose: This paper aims to examine the role of antecedents such as corporate social responsibility (CSR) and entrepreneurial orientation in the chain effect to knowledge sharing among members of Cai Luong theatre companies in the Vietnamese context. Knowledge sharing contributes to the depth of the knowledge pool of both the individuals and the…

Crystal Growth and Scintillation Properties of Eu2+ doped Cs4CaI6 and Cs4SrI6

Science.gov (United States)

Stand, L.; Zhuravleva, M.; Chakoumakos, B.; Johnson, J.; Loyd, M.; Wu, Y.; Koschan, M.; Melcher, C. L.

2018-03-01

In this work we present the crystal growth and scintillation properties of two new ternarymetal halide scintillators activated with divalent europium, Cs4CaI6 and Cs4SrI6. Single crystals of each compound were grown in evacuated quartz ampoules via the vertical Bridgman technique using a two-zone transparent furnace. Single crystal X-ray diffraction experiments showed that both crystals have a trigonal (R-3c) structure, with a density of 3.99 g/cm3 and 4.03 g/cm3. The radioluminescence and photoluminescence measurements showed typical luminescence properties due to the 5d-4f radiative transitions in Eu2+. At this early stage of development Cs4SrI6:Eu and Cs4CaI6:Eu have shown very promising scintillation properties, with light yields and energy resolutions of 62,300 ph/MeV and 3.3%, and 51,800 photons/MeV and 3.6% at 662 keV, respectively.

¿Qué tienes en la cara, eso se quita?

Directory of Open Access Journals (Sweden)

Jimmy Arévalo Romero

2013-10-01

Full Text Available El presente texto es un ensayo preparado por estudiantes de Medicina que tiene origen en su experiencia personal, ya que trata del padecimiento del acné en lo adolescencia, en él quieren concienciar a lo comunidad en general sobre las consecuencias psicológicas que genera el padecimiento del acné en el adolescente, y estimular a las personas a contribuir al desarrollo de estos jóvenes en la sociedad.

Two years since SSAMS: Status of {sup 14}C AMS at CAIS

Energy Technology Data Exchange (ETDEWEB)

Ravi Prasad, G.V.; Cherkinsky, Alexander; Culp, Randy A.; Dvoracek, Doug K.

2015-10-15

The NEC 250 kV single stage AMS accelerator (SSAMS) was installed two years ago at the Center for Applied Isotope Studies (CAIS), University of Georgia. The accelerator is primarily being used for radiocarbon measurements to test the authenticity of natural and bio-based samples while all other samples such as geological, atmospheric, marine and archaeological. are run on the 500 kV, NEC 1.5SDH-1 model tandem accelerator, which has been operating since 2001. The data obtained over a six months period for OXI, OXII, ANU sucrose and FIRI-D are discussed. The mean value of ANU sucrose observed to be slightly lower than the consensus value. The processed blanks on SSAMS produce lower apparent age compared to the tandem accelerator as expected.

Heterogeneities of the shear wave attenuation field in the lithosphere of East Tien Shan and their relationship with seismicity

Science.gov (United States)

Kopnichev, Yu. F.; Sokolova, I. N.

2012-02-01

The shear wave attenuation field in the lithosphere of Eastern Tien Shan has been mapped. The method based on analysis of the ratio between amplitudes of Sn and Pn waves was used. On aggregate, about 120 seismograms made at the Makanchi station (MKAR), mainly in the period of 2003-2009, at epicentral distances of about 350-1200 km were analyzed. It was found that shear wave attenuation in the lithosphere of Eastern Tien Shan is weaker than that in the region of Central Tien Shan. This agrees with the fact that the rate of deformation of the Earth's crust in Eastern Tien Shan is lower (based on GPS data), as is the seismicity level, in comparison to Central Tien Shan. The zones of high attenuation, where strong earthquakes with M > 7.0 have not occurred for the last 200 years, have been identified: first of all, these are the area west of Urumqi and that of the Lop Nur test site. It is suggested that in the first zone, where an annular seismicity structure has formed over the last 30 years, a strong earthquake may be being prepared. The second zone is most probably related to the uplift of mantle fluids resulting from a long-term intensive technogenic effect, analogous to what has occurred in areas of other nuclear test sites (Nevada and Semipalatinsk).

Salud Tiene Sabor: a model for healthier restaurants in a Latino community.

Science.gov (United States)

Nevarez, Carmen R; Lafleur, Mariah S; Schwarte, Liz U; Rodin, Beth; de Silva, Pri; Samuels, Sarah E

2013-03-01

The prevalence of overweight and obesity in children has risen nationally in recent decades, and is exceptionally high in low-income communities of color such as South Los Angeles CA. Independently owned restaurants participating in the Salud Tiene Sabor program at ethnic foods marketplace Mercado La Paloma in South Los Angeles are responding to the childhood obesity crisis by posting calories for menu items and providing nutrition information to patrons. To evaluate whether menu labeling and nutrition information at point of purchase have an influence on availability of healthy food options, patron awareness of calorie information, and restaurant owners' support of the program. A case-study design using mixed methods included restaurant owner and stakeholder interviews, patron surveys, and environmental assessments. Data were collected using originally designed tools, and analyzed in 2009-2011. Healthy eating options were available at the Mercado La Paloma; restaurant owners and the larger community supported the Salud Tiene Sabor program; 33% of patrons reported calorie information-influenced purchase decisions. Owners of independent restaurants have an important role in improving access to healthy foods in low-income, Latino communities. Copyright © 2013 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

Hypertext and three-dimensional computer graphics in an all digital PC-based CAI workstation.

Science.gov (United States)

Schwarz, D. L.; Wind, G. G.

1991-01-01

In the past several years there has been an enormous increase in the number of computer-assisted instructional (CAI) applications. Many medical educators and physicians have recognized the power and utility of hypertext. Some developers have incorporated simple diagrams, scanned monochrome graphics or still frame photographs from a laser disc or CD-ROM into their hypertext applications. These technologies have greatly increased the role of the microcomputer in education and training. There still remain numerous applications for these tools which are yet to be explored. One of these exciting areas involves the use of three-dimensional computer graphics. An all digital platform increases application portability. Images Figure 1 Figure 2 Figure 3 Figure 4 PMID:1807767

Dietary Changes over Time in a Caiçara Community from the Brazilian Atlantic Forest

Directory of Open Access Journals (Sweden)

Priscila L. MacCord

2006-12-01

Full Text Available Because they are occurring at an accelerated pace, changes in the livelihoods of local coastal communities, including nutritional aspects, have been a subject of interest in human ecology. The aim of this study is to explore the dietary changes, particularly in the consumption of animal protein, that have taken place in Puruba Beach, a rural community of caiçaras on the São Paulo Coast, Brazil, over the 10-yr period from 1992-1993 to 2002-2003. Data were collected during six months in 1992-1993 and during the same months in 2002-2003 using the 24-hr recall method. We found an increasing dependence on external products in the most recent period, along with a reduction in fish consumption and in the number of fish species eaten. These changes, possibly associated with other nonmeasured factors such as overfishing and unplanned tourism, may cause food delocalization and a reduction in the use of natural resources. Although the consequences for conservation efforts in the Atlantic Forest and the survival of the caiçaras must still be evaluated, these local inhabitants may be finding a way to reconcile both the old and the new dietary patterns by keeping their houses in the community while looking for sources of income other than natural resources. The prospect shown here may reveal facets that can influence the maintenance of this and other communities undergoing similar processes by, for example, shedding some light on the ecological and economical processes that may occur within their environment and in turn affect the conservation of the resources upon which the local inhabitants depend.

¿CUÁNTOS SIGNIFICADOS TIENE UN PRODUCTO?

Directory of Open Access Journals (Sweden)

Jose Antonio Paris

2014-06-01

Full Text Available El marketing esencial se basa en la determinación de los significados en la mente del consumidor y de los códigos en la mente del mercado. Para poder sustentar esto se han creado metodologías como las técnicas de afloramiento de significado y las técnicas proyectivas entre otras. Pero, el nuevo problema que surge de esta conceptualización teórica es si vamos a poner al significado en la base del plan de marketing, la pregunta es ¿cuántos significados se deben determinar? Por lo que sabemos cada cultura tiene sus propias significaciones y los significados también cambian con el tiempo incluso lo hacen contextualmente. Lo cual hace aún más complejo el dilema presentado como título de este artículo. En se presentan los argumentos teóricos que sustentan uno de los descubrimientos más importantes del marketing esencial que sostenemos: en general para cada producto o servicio hay cuatro significados dominantes.

A New Type of Foreign Clast in A Polymict Ureilite: A CAI or AL-Rich Chondrule

Science.gov (United States)

Goodrich, C. A.; Ross, D. K.; Treiman, A. H.

2017-01-01

Introduction: Polymict ureilites are breccias interpreted to represent regolith formed on a ureilitic asteroid [1-3]. They consist of approximately 90-95% clasts of various ureilite types (olivine-pyroxene rocks with Fo 75-95), a few % indigenous feldspathic clasts, and a few % foreign clasts [4-20]. The foreign clasts are diverse, including fragments of H, L, LL and R chondrites, angrites, other achondrites, and dark clasts similar to CC [6,7,9-19]. We report a new type of foreign clast in polymict ureilite DaG 999. Methods: Clast 8 in Dar al Gani (DaG) 999/1 (Museum fur Naturkunde) was discovered during a survey of feldspathic clasts in polymict ureilites [19,20]. It was studied by BEI, EMPA, and X-ray mapping on the JEOL 8530F electron microprobe at ARES, JSC. Petrography and Mineral Compositions: Clast 8 is sub-rounded to irregular in shape, approximately 85 micrometers in diameter, and consists of approximately 68% pyroxene and 32% mesostasis (by area). Part of the pyroxene (top half of clast in Fig. 1a and 2) shows a coarse dendritic morphology; the rest appears massive. Mesostasis may be glassy and contains fine needles/grains of pyroxene. The pyroxene has very high CaO (23.5 wt.%) and Al2O3 (19.7 wt.%), with the formula: (Ca(0.91)Mg(0.63)Fe(0.01)Al(sup VI) (0.38)Cr(0.01)Ti(0.05)1.99 Si2O6. The bulk mesostasis also has very high Al2O3 (approximately 26 wt.%). A bulk composition for the clast was obtained by combining modal abundances with phase compositions (Table 1, Fig. 3). Discussion: The pyroxene in clast 8 has a Ca-Al-(Ti)- rich (fassaitic) composition that is clearly distinct from compositions of pyroxenes in main group ureilites [22] or indigenous feldspathic clasts in polymict ureilites [4-8]. It also has significantly higher Al than fassaite in angrites (up to approximately 12 wt.% [23]), which occur as xenoliths in polymict ureilites. Ca-Al-Ti rich pyroxenes are most commonly found in CAIs, Al-rich chondrules and other types of refractory

Empirical Relationship between particulate matter and Aerosol Optical Depth over Northern Tien-Shan, Central Asia

Science.gov (United States)

Measurements were obtained at two sites in northern Tien-Shan in Central Asia during a 1-year period beginning July 2008 to examine the statistical relationship between aerosol optical depth (AOD) and of fine [PM2.5, particles less than 2.5 μm aerodynamic diameter (AD)] and coars...

Los orígenes del grial en la literatura medieval: de Chrétien de Troyes a Robert de Boron

Directory of Open Access Journals (Sweden)

Mario Martín Botero

2010-12-01

Full Text Available Este artículo muestra el origen literario del tema del Grial en la literatura medieval francesa, abordando dos textos esenciales para el surgimiento y consolidación de la “literatura del Grial”: Le Conte du Graal de Chrétien de Troyes y Le Roman de l’Estoire dou Graal de Robert de Boron. Los autores de estas obras establecen las bases para el desarrollo de toda una temática que gira alrededor del Grial a partir del siglo XII hasta nuestros días. El artículo muestra cómo de un objeto apenas sagrado en el texto de Chrétien de Troyes se pasa a una reliquia de la sangre de Cristo en la versión de Robert de Boron.This paper studies the literary origin of the Grail legend in medieval French literature, taking into account two important romances: Le Conte du Graal by Chrétien de Troyes and Le Roman de l’Estoire dou Graal by Robert de Boron. In these two texts the authors established the basis for the development of a new subject matter around the mysterious object called “Grail” from the Middle Ages to the present times. It will also be shown how an object, not totally sacred in Chrétien de Troyes, becomes a relic related with Jesus’s blood in Robert de Boron.

La alucinación verbal tiene la estructura de la holofrase

Directory of Open Access Journals (Sweden)

Arturo de la Pava Ossa

2009-05-01

Full Text Available ¿En qué sentido la alucinaciónauditiva tiene la estructura dela holofrase? La holofrase es lainterjección, dice Lacan en 1958.En 1964, plantea que cuando enel primer par significante no hayintervalo, se solidifica, “se holofrasea”;a lo que añade que algo delmismo orden ocurre en la psicosis.Esta afirmación aporta elementospara pensar que la alucinación esuna holofrase y cómo a partir deella el psicótico construye su delirioparanoico.Palabras clave: holofrase, interjección,alucinación, discurso, funciónfálica.

An Evaluation of the Cognitive and Affective Performance of an Integrated Set of CAI Materials in the Principles of Macroeconomics. Studies in Economic Education, No. 4.

Science.gov (United States)

Daellenbach, Lawrence A.; And Others

The purpose of this study was to determine the effect of computer assisted instruction (CAI) on the cognitive and affective development of college students enrolled in a principles of macroeconomics course. The hypotheses of the experiment were stated as follows: In relation to the traditional principles course, the experimental treatment will…

Permian charnockites in the Pobeda area: Implications for Tarim mantle plume activity and HT metamorphism in the South Tien Shan range

Science.gov (United States)

Loury, Chloé; Rolland, Yann; Lanari, Pierre; Guillot, Stéphane; Bosch, Delphine; Ganino, Clément; Jourdon, Anthony; Petit, Carole; Gallet, Sylvain; Monié, Patrick; Riel, Nicolas

2018-04-01

The Permian history of the Central Asian Orogenic belt is marked by large-scale strike-slip faults that reactivate former Paleozoic structures, delineated by widespread alkaline magmatism. The genetic link between the syn-kinematic granitoids emplaced in the Tien Shan range and magmas emplaced within the Tarim Large Igneous Province, and the interaction between this plume and transcurrent tectonics, are still unsolved issues. We investigated the Pobeda massif, in the eastern Kyrgyz Tien Shan, located at the boundary between the Tien Shan range and the Tarim Craton, which exhibits a high-temperature unit. In this unit, Permian magmatism resulted in the emplacement of alkaline charnockites at mid-crustal levels. The primary mineralogical assemblage is nominally anhydrous and made of ortho- and clino-pyroxenes, fayalite, K-feldspar, plagioclase and quartz. These charnockites are associated with partially-molten paragneisses and marbles. Thermobarometry on these rocks indicates that the charnockites emplaced following the intrusion of a melt at a temperature > 1000 °C and pressure of around 6 kbar, corresponding to depth of 20 km. The resulting thermal anomaly triggered the partial melting of paragneisses. Bulk geochemistry including Sr, Nd, Pb and Hf isotopes suggests that charnockites fit into the Tarim Large Igneous Province magmatic series, with minor crustal assimilation. U-Pb ages on zircons of charnockites and surrounding paragneisses indicate that charnockites intruded and triggered partial melting of the gneisses at c. 287, 275 and 265 Ma. 40Ar/39Ar dating on amphibole gives a similar age as the U-Pb age at 276.2 ± 2.0 Ma. 40Ar/39Ar dating on biotite from the Charnockite unit marbles gives ages at ca. 256-265 Ma, which shows that exhumation onset directly follows the HT history, and is tentatively correlated to top-to-the-North thrusting of the Charnockite unit in a transpressive context. Additional 40Ar/39Ar dating on syn-kinematic white micas from an

DUST LOADING OF THE ATMOSPHERE AND GLACIERS IN THE KUMTOR MINING AREA (AKSHYYRAK, TIEN SHAN

Directory of Open Access Journals (Sweden)

V. A. Kuzmichenok

2012-01-01

Full Text Available Industrial development of the Kumtor Gold Mine in the nival-glacial zone of Tien Shan (altitude ranging from 4000 to 4500 m a.s.l. is inevitably accompanied by the release of some additional amounts of dust in atmosphere. Sampling in 7 points and an analysis of the quantity (weight of dust in the seasonal snow (September–April on glaciers show that the dust pollution does not substantially exceed the natural level of dust in Tien Shan. An analysis of almost 3 000 daily measurements of dust in the surface layer of air at 4 points around the gold mine has also shown that the economic activity has no significant impact on dust production. It is likely that the manmade component of overall dust in the immediate vicinity of the deposit and the gob pile does not exceed 20%. No increase in the content of dust and in its anthropogenic component with time has been found. Thus, we suggest that the principal amount of dust in the area is brought during the cold season from snow-free areas of Central Asia.

《采薇》的叙事伦理分析%Narrative Ethics of Cai Wei

Institute of Scientific and Technical Information of China (English)

王海燕

2014-01-01

The controversial dilemma of how to understand Boyi, Shuqi in Luxun’ s novel Cai Wei, it is not a realistic ethical problem, which should be based on the novel's narrative ethics to answer. Narrative ethics refers to various forms of arrangement of ethical dimension revealed. Novel manifests sympathy ethics to Boyi, Shu Qi through the narrative angle choice and narrative distance controlling. Also, by the counterpoint to character, event and ironic expression in structure, novel conveys the ethics excluding to all sorts of characters from emperor Zhouwu to A Jin. Compared to other “Generational change” theme novels of Luxun, the complication of narrative ethics of Cai Wei not only is the projection of reality, but also reflects the further conscious to narrative art of Luxun.%《采薇》中颇有争议的“如何理解伯夷、叔齐”这一难点，并不是一个现实伦理问题，而应依据小说的叙事伦理来解答。叙事伦理即各种形式安排透露出的伦理维度。小说通过叙事角度的选择与叙事距离的控制体现出对伯夷、叔齐的伦理同情，而由结构上的人物对位与事件对位及反讽表达的是对自周武王至阿金诸色人物的伦理拒斥。与前期同是“易代”主题的小说相比，《采薇》叙事伦理的复杂化既是现实的投射，也体现了鲁迅对于小说叙事艺术的进一步自觉。

The origin and evolution of Iskanderkul Lake in the western Tien Shan and related geomorphic hazards

Czech Academy of Sciences Publication Activity Database

Emmer, Adam; Kalvoda, J.

2017-01-01

Roč. 99, č. 2 (2017), s. 139-154 ISSN 0435-3676 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:86652079 Keywords : iskanderkul lake * rockslide dam * outburst flood * tien shan Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 1.302, year: 2016

Miseria y violencia en El Coronel no tiene quien le escriba

Directory of Open Access Journals (Sweden)

Gloria Escobar Soriano

1999-02-01

Full Text Available El trabajo describe la marginación y la pobreza de un sector de la sociedad colombiana en El Coronel no tiene quien le escriba, la célebre novela de Gabriel García Márquez. Mientras el Coronel espera la llegada de la carta, su hijo Agustín, ha muerto por sus actividades revolucionarias. El y su mujer enferma viven en una casa hipotecada y comen de las migajas que le sobran al gallo. El grado de injusticia y violencia política que se respira en el ambiente aumentan la crisis económica del Coronel y generan en él una resistencia pasiva que recobra cuando se niega a vender el gallo y decide esperar la fecha de la pelea.

Crystal structures of coordination polymers from CaI2 and proline

Directory of Open Access Journals (Sweden)

Kevin Lamberts

2015-06-01

Full Text Available Completing our reports concerning the reaction products from calcium halides and the amino acid proline, two different solids were found for the reaction of l- and dl-proline with CaI2. The enantiopure amino acid yields the one-dimensional coordination polymer catena-poly[[aqua-μ3-l-proline-tetra-μ2-l-proline-dicalcium] tetraiodide 1.7-hydrate], {[Ca2(C5H9NO25(H2O]I4·1.7H2O}n, (1, with two independent Ca2+ cations in characteristic seven- and eightfold coordination. Five symmetry-independent zwitterionic l-proline molecules bridge the metal sites into a cationic polymer. Racemic proline forms with Ca2+ cations heterochiral chains of the one-dimensional polymer catena-poly[[diaquadi-μ2-dl-proline-calcium] diiodide], {[Ca(C5H9NO22(H2O2]I2}n, (2. The centrosymmetric structure is built by one Ca2+ cation that is bridged towards its symmetry equivalents by two zwitterionic proline molecules. In both structures, the iodide ions remain non-coordinating and hydrogen bonds are formed between these counter-anions, the amino groups, coordinating and co-crystallized water molecules. While the overall composition of (1 and (2 is in line with other structures from calcium halides and amino acids, the diversity of the carboxylate coordination geometry is quite surprising.

The possibility of controlled auto-ignition (CAI) in gasoline engine and gas to liquid (GTL) as a fuel of diesel engine in Korea

Energy Technology Data Exchange (ETDEWEB)

Jeong, D. [Korea Inst. of Machinery and Materials, Daejou (Korea)

2005-07-01

A significant challenge grows from the ever-increasing demands for the optimization of performance, emissions, fuel economy and drivability. The most powerful technologies in the near future to improve these factors are believed Controlled Auto-Ignition (CAI) in gasoline engine and Gas to Liquid (GTL) as a fuel of Diesel engine. In recent years there has been an increasing trend to use more complex valvetrain designs from traditional camshaft driven mechanical systems to camless electromagnetic or electrohydraulic solutions. Comparing to fixed valve actuation systems, variable valve actuation (VVA) should be powerful to optimize the engine cycle. The matching of valve events to the engine performance and to emission requirements at a given engine or vehicle operating condition can be further optimized to the Controlled Auto-Ignition (CAI) in gasoline engine, which has benefits in NOx emission, fuel consumption, combustion stability and intake throttle load. In case of Diesel engine, the increasing demands for NOx and soot emission reduction have introduced aftertreatment technologies recently, but been in need of basic solution for the future, such as a super clean fuel like Gas to Liquid (GTL), which has benefits in comparability to diesel fuel, independency from crude oil and reduction of CO, THC and soot emissions. Korea looks to the future with these kinds of technologies, and tries to find the possibility for reaching the future targets in the internal combustion engine. (orig.)

Jeux et enjeux d’écriture chez Chrétien de Troyes: l’exemple de «Cligès»

Directory of Open Access Journals (Sweden)

Ida Lucia Machado

2011-10-01

Full Text Available Neste artigo, nos propomos descrever a estética da trama irônica presente na escritura de Chrétien de Troyes, tomando por base seu romance Cligès. A destacar algumas estratégias passíveis de criar o fenômeno irônico, estaremos também mostrando o poder de sedução que emana desta escritura.Nous nous proposons, dans cet artible, de décrire l’esthétique du jeu ironique chez Chrétien de Troyes, em puisant dans son roman Cligès. Enn dégageant qulques unes dês stratégies susceptibles de créer le phénomène ironique, nous montrerons, à la fois, le pouvoir de séduction qui emane de cette écriture.

Crustal block structure by GPS data using neural network in the Northern Tien Shan

Science.gov (United States)

Kostuk, A.; Carmenate, D.

2010-05-01

For over ten years regular GPS measurements have been carried out by Research Station RAS in the Central Asia. The results of these measurements have not only proved the conclusion that the Earth's crust meridional compression equals in total about 17 mm/year from the Tarim massif to the Kazakh shield, but have also allowed estimating deformation behavior in the region. As is known, deformation behavior of continental crust is an actively discussed issue. On the one hand, the Earth's crust is presented as a set of microplates (blocks) and deformation here is a result of shifting along the blocks boundaries, on the other hand, lithospheric deformation is distributed by volume and meets the rheological model of nonlinear viscous fluid. This work represents an attempt to detect the block structure of the surface of the Northern Tien Shan using GPS velocity fields. As a significant difference from analogous works, appears the vector field clustering with the help of neural network used as a classifier by many criteria that allows dividing input space into areas and using of all three components of GPS velocity. In this case, we use such a feature of neural networks as self-organization. Among the mechanisms of self-organization there are two main classes: self-organization based on the Hebb associative rule and the mechanism of neuronal competition based on the generalized Kohonen rule. In this case, we use an approach of self-organizing networks in which we take neuronal competition as an algorithm for their training. As a rule, these are single-layer networks where each neuron is connected to all components of m-dimensional input vector. GPS vectors of the Central Asian velocity field located within the territory of the Northern Tien Shan were used as input patterns. Measurements at GPS sites were fulfilled in 36 hour-long sessions by double-frequency receivers Trimble and Topcon. In so doing, measurement discreteness equaled 30 seconds; the data were processed by

Bird community structure in riparian environments in Cai River, Rio Grande do Sul, Brazil

Directory of Open Access Journals (Sweden)

Jaqueline Brummelhaus

2012-06-01

Full Text Available Urbanization produces changes in riparian environments, causing effects in the structure of bird communities, which present different responses to the impacts. We compare species richness, abundance, and composition of birds in riparian environments with different characteristics in Cai River, Rio Grande do Sul, Brazil. We carried out observations in woodland, grassland, and urban environments, between September 2007 and August 2008. We listed 130 bird species, 29 species unique to woodland environment, and an endangeredspecies: Triclaria malachitacea. Bird abundance differed from woodland (n = 426 individuals to urban environments (n = 939 individuals (F2,6 = 7.315; P = 0.025. Species composition and feeding guilds differed significantly in the bird community structures among these three riparian environments. In the grassland and urban environments there were more generalist insectivorous species, while in the woodland environments we find more leaf and trunk insectivorous species and frugivorous species, sensitive to human impacts. Bird species can be biological quality indicators and they contribute to ecosystems performing relevant functions. With the knowledge on bird community structure and their needs, it is possible to implement management practices for restoration of degraded riparian environments.

Perceptions on hospitality when visiting secluded communities of guaranis, caiçaras e quilombolas in Paraty region

Directory of Open Access Journals (Sweden)

Luis Alberto Beares

2008-10-01

Full Text Available Tourism in secluded communities puts different cultures in contact with each other and must be handled carefully not to cause environmental damage as well as cultural loss which might jeopardize the local development and create hostile relationships. The proposal of in sito tourism, considering the local memory and patrimony as a hospitality potential, was observed during technical visitations to three communities located in the Paraty region and surroundings: Guarani, Caiçara (fishermen and Quilombola(African slaves descendants. Through field work involving visitations to communities and interviews with locals, information regarding cultural differences and the importance of the land occupation in the history of each of the communities was assessed. The common link in the history of these peoples is the struggle for the right of land possession. During visits when people shared their territory various forms of hospitality in each community were verified, issued from different cultures and cultural values.

Cladocera (Crustacea: Branchiopoda of Cat Tien National Park, South Vietnam

Directory of Open Access Journals (Sweden)

Artem Y. Sinev

2013-08-01

Full Text Available Cladocera of Cat Tien National Park, South Vietnam, and the surrounding agricultural area, were surveyed during the spring of 2009 (onset of the wet season and autumn 2010 (end of the wet season. The studied water bodies included two large lakes (Bau Sau and Bau Chim, small lakes and ponds, temporary pools, rivers and streams, as well as rice fields and ponds in an agricultural area beyond the boundaries of the National Park. Fifty three species of Cladocera were found, 18 of them new for Vietnam. Distribution and taxonomical status of the species are discussed. Of the recorded species, 58.5% (31 were found only in the National Park, 34% (18 both in the National Park and the agricultural area, and only 7.5% (4 exclusively in the agricultural area. Of the 20 species new for Vietnam, only one was found both in the National Park and the agricultural area, all others were found in the National Park only. Such a difference can be directly attributed to the loss of natural habitats (forest ponds and streams in agricultural areas and to the pollution by pesticides. Our study shows the importance of surveys in pristine and protected areas, for the full evaluation of regional microcrustacean richness.

Da Chrétien de Troyes a Shakespeare («The tragedy of King Richard the Third», a. I, sc. 2

Directory of Open Access Journals (Sweden)

Alfonso D'Agostino

2015-07-01

Full Text Available L’articolo si propone di considerare le somiglianze fra alcune vicende antico-francesi (l’Yvain di Chrétien de Troyes e il fabliau anonimo De celle que se fist foutre sur la fosse son mari con una scena del Riccardo III di Shakespeare. Anche se non si può dire che il dramma inglese dipenda dai testi narrativi oitanici, esso sviluppa lo stesso motivo della vedova consolata e una serie di motivi secondarî, di immagini (il sangue, il diavolo, la seduzione e di espressioni letterarie in modo sintomaticamente affine. The paper aims to evaluate similarities between some Old-French narratives (Chrétien de Troyes’ Yvain and the anonymous fabliau De celle que se fist foutre sur la fosse son mari and a scene from Shakespeare’s Richard III. Although we cannot affirm that Shakespeare’s play derives from the French narratives, it develops the same theme of “comforted widow” along with a series of secondary themes, of images (the blood, the devil, the seduction and literary expressions in a symptomatically, very similar way.

Du neuf dans les relations de l'Église orthodoxe avec les autres chrétiens

OpenAIRE

Famerée, Joseph

2015-01-01

Cette note évoque quatre réunions scientifiques (Athènes, Chambésy, Thessalonique, Iasi) qui, coup sur coup, de mai 2013 à mai 2014, ont permis à des Orthodoxes d’échanger avec d’autres chrétiens, catholiques notamment, sur des sujets théologiques et œcuméniques importants pour l’évolution des différentes Églises. Une nouvelle génération de théologiens orthodoxes se lève, osant parler librement à propos de leur Église et montrer l’écart entre l’Orthodoxie idéale et l’Orthodoxie réelle, spécia...

Ora et labora. Paradigmes du modèle monacal médiéval chez Chrétien de Troyes / Ora et labora. Paradigms of the Medieval Monastic Model in Chrétien de Troyes’s Work

Directory of Open Access Journals (Sweden)

Diana Gradu

2015-05-01

Full Text Available The medieval monachal model is marked out by the faith, by the power, by the morality. It is also shared between confidence and fear with regard to the power on the earth, but, certainly, all the clerks and the monks of the Middle Age know and assume the rule Redde Caesari quae sunt Cesaris and quae sunt Dei Deo. The medieval literature, the unfaithful mirror, is reflected in an incomplete and sometimes idealized way, the example of the hermit, but it constitutes in the essential source of its paradigm. I shall stop to Chrétien of Troyes and to its novels, they are the most glorious proof of the Renaissance of the 12th century.

New Petrology, Mineral Chemistry and Stable MG Isotope Compositions of an Allende CAI: EK-459-7-2

Science.gov (United States)

Jeffcoat, C. R.; Kerekgyarto, A. G.; Lapen, T. J.; Righter, M.; Simon, J. I.; Ross, D. K.

2016-01-01

Calcium-aluminum-rich inclusions (CAIs) are the key to understanding physical and chemical conditions in the nascent solar nebula. These inclusions have the oldest radiometric ages of solar system materials and are composed of phases that are predicted to condense early from a gas of solar composition. Thus, their chemistry and textures record conditions and processes in the earliest stages of development of the solar nebula. Type B inclusions are typically larger and more coarse grained than other types with substantial evidence that many of them were at least partially molten. Type B inclusions are further subdivided into Type B1 (possess thick melilite mantle) and Type B2 (lack melilite mantle). Despite being extensively studied, the origin of the melilite mantles of Type B1 inclusions remains uncertain. We present petrologic and chemical data for a Type B inclusion, EK-459-7-2, that bears features found in both Type B1 and B2 inclusions and likely represents an intermediate between the two types. Detailed studies of more of these intermediate objects may help to constrain models for Type B1 rim formation.

Development of Petrov glacial-lake system (Tien Shan and outburst risk assessment

Directory of Open Access Journals (Sweden)

I. A. Torgoev

2013-01-01

Full Text Available Global climate warming causes an intensive melting and retreat of glaciers in the Tien Shan mountains. Melting water of glaciers causes overfilling of high mountain lakes. The increase of the surface and volume of the Petrov Lake accompanied with the decrease of stability of the dam represents an extremely dangerous situation that can produce a natural disaster. Failure can happen due to erosion, a buildup of water pressure, an earthquake or if a large enough portion of a glacier breaks off and massively displaces the waters in a glacial lake at its base. In case of the lake dam rupture, flooding of a disposal site of highly toxic tailing from the gold mine Kumtor is a threat. If this happens, the toxic waste containing cyanides would contaminate a large area in the Naryn (Syrdarya river basin. Even if the flooding of the disposal site does not occur, the damage after lake dam fracture will be immense due to the glacial lake outburst flood may be a devastating mudslide. In order to prevent or reduce the risk of this event we recommend performing engineering surveys for the development and implementation of the project for the controlled reduction of water level in the Blue Bay of the Petrov Lake to a safe volume.

La falta de financiacion publica hipoteca el futuro del acelerador de protones valenciano. La Universidad de Valencia tiene avanzado el diseno de este dispositivo de alta tecnologia

CERN Multimedia

Jatvia, J M

2002-01-01

"La Universidad de Valencia tiene avanzado el diseno de un acelerador lineal de protones, cuya culminacion depende del compromiso del Consell en sufragar la plantilla que necesitaria el centro para estar operativo" (1 page).

Une catastrophe glorieuse : le martyre des premiers chrétiens du Japon, Nagasaki, 1597

Directory of Open Access Journals (Sweden)

Clotilde Jacquelard

2011-11-01

Full Text Available Le naufrage du galion San Felipe dans le port de Urado (Shikoku, Japon en octobre 1596 fut le déclencheur d’un désastre missionnaire : le martyre de vingt-six chrétiens, franciscains espagnols et chrétiens japonais, à Nagasaki, le 5 février 1597. Cet article s’attache à examiner la relation dialectique entre les deux événements par l’étude de deux discours missionnaires franciscains hagiographiques. Il s’agit tout d’abord de rappeler la lecture providentialiste du temps à travers la perception de présages matériels et spirituels de la part des acteurs, puis de montrer que ces évènements paroxystiques révèlent en même temps qu’ils résolvent – temporairement – des tensions et des crises latentes, résultat de la confrontation entre plusieurs communautés culturelles comme la japonaise, l’espagnole et la portugaise, autour de prétentions géopolitiques, commerciales et religieuses dans cette zone de frontière de l’antiméridien du Pacifique nord.El naufragio del galeón San Felipe en el puerto de Urado (Shikoku, Japón en octubre de 1596 desembocó en un desastre misionero : el martirio de veintiséis cristianos, franciscanos españoles y cristianos japoneses, en Nagasaki, el 5 de febrero de 1597. Este artículo quiere examinar la relación dialéctica entre ambos acontecimientos, mediante el estudio de dos discursos misioneros franciscanos hagiográficos. Se trata de recordar primero la lectura providencialista de la época a través de la percepción de presagios tanto materiales como espirituales por parte de los actores, y mostrar luego que estos acontecimientos paroxísticos revelan, al mismo tiempo que resuelven –temporalmente– tensiones y crisis latentes, resultados de la confrontación de varias comunidades culturales como la japonesa, la española y la portuguesa, en torno a pretensiones geopolíticas, comerciales y religiosas en la zona fronteriza del antimeridiano del Pacífico norte.

Dietary exposure to aflatoxin B-1, ochratoxin A and fuminisins of adults in Lao Cai province, Viet Nam: A total dietary study approach

DEFF Research Database (Denmark)

Bui, Huong Mai; Le Danh Tuyen; Do Huu Tuan

2016-01-01

Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province...... higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin...... B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical...

Search for EAS radio-emission at the Tien-Shan shower installation at a height of 3340 m above sea level

Science.gov (United States)

Beisenova, A.; Boos, E.; Haungs, A.; Sadykov, T.; Salihov, N.; Shepetov, A.; Tautayev, Y.; Vildanova, L.; Zhukov, V.

2017-06-01

The complex EAS installation of the Tien Shan mountain cosmic ray station which is situated at a height of 3340 m above sea level includes the scintillation and Cherenkov detectors of charged shower particles, an ionization calorimeter and a set of neutron detectors for registering the hadronic component of the shower, and a number of underground detectors of the penetrative EAS component. Now it is intended to expand this installation with a promising method for detecting the radio-emission generated by the particles of the developing shower. The facility for radio-emission detection consists of a three crossed dipole antennae, one being set vertically, and another two - mutually perpendicularly in a horizontal plane, all of them being connected to a three-channel radio-frequency amplifier of German production. By the passage of an extensive air shower, which is defined by a scintillation shower detector system, the output signal of antenna amplifier is digitized by a fast multichannel DT5720 ADC of Italian production, and kept within computer memory. The further analysis of the detected signal anticipates its operation according to a special algorithm and a search for the pulse of radio-emission from the shower. A functional test of the radio-installation is made with artificial signals which imitate those of the shower, and with the use of a N1996A type wave analyzer of Agilent Technologies production. We present preliminary results on the registration of extensive air shower emission at the Tien Shan installation which were collected during test measurements held in Summer 2016.

ESTUDIO COMPARATIVO DEL EFECTO DE ZHONGJI (RM3) MOXADO MAS PUNTOS REGULARES VS PUNTOS REGULARES EN PACIENTES CON NEUROPATIA DIABETICA -NO TIENE CARATULA-

OpenAIRE

LERMA GARCIA, HECTOR ALFONSO

2010-01-01

ANTECEDENTES: DESDE LA ANTIGUEDAD SE HA COMPROBADO LA EFECTIVIDAD DE LA ACUPUNTURA PARA EL TRATAMIENTO DEL DOLOR Y PARA LA DIABETES EN EL SER HUMANO. OBJETIVO: EL PRESENTE ESTUDIO TIENE COMO OBJETIVO ANALIZAR EL EFECTO DEL TRATAMIENTO DEL DOLOR Y ALTERACIONES SENSITIVAS EN PACIENTES CON NEUROPATIA DIABETICA. METODO: SE ESTUDIARON TREINTA PACIENTES CON UN DIAGNOSTICO DE NEUROPATIA DIABETICA LOS CUALES SE DIVIDIERON EN TRES GRUPOS A LOS CUALES SE LES APLICO EN EL GRUPO 1 ZHONG...

Paleo-Climate and Glaciological Reconstruction in Central Asia through the Collection and Analysis of Ice Cores and Instrumental Data from the Tien Shan

International Nuclear Information System (INIS)

Vladimir Aizen; Donald Bren; Karl Kreutz; Cameron Wake

2001-01-01

While the majority of ice core investigations have been undertaken in the polar regions, a few ice cores recovered from carefully selected high altitude/mid-to-low latitude glaciers have also provided valuable records of climate variability in these regions. A regional array of high resolution, multi-parameter ice core records developed from temperate and tropical regions of the globe can be used to document regional climate and environmental change in the latitudes which are home to the vase majority of the Earth's human population. In addition, these records can be directly compared with ice core records available from the polar regions and can therefore expand our understanding of inter-hemispheric dynamics of past climate changes. The main objectives of our paleoclimate research in the Tien Shan mountains of middle Asia combine the development of detailed paleoenvironmental records via the physical and chemical analysis of ice cores with the analysis of modern meteorological and hydrological data. The first step in this research was the collection of ice cores from the accumulation zone of the Inylchek Glacier and the collection of meteorological data from a variety of stations throughout the Tien Shan. The research effort described in this report was part of a collaborative effort with the United State Geological Survey's (USGS) Global Environmental Research Program which began studying radionuclide deposition in mid-latitude glaciers in 1995

Paleo-Climate and Glaciological Reconstruction in Central Asia through the Collection and Analysis of Ice Cores and Instrumental Data from the Tien Shan

Energy Technology Data Exchange (ETDEWEB)

Vladimir Aizen; Donald Bren; Karl Kreutz; Cameron Wake

2001-05-30

While the majority of ice core investigations have been undertaken in the polar regions, a few ice cores recovered from carefully selected high altitude/mid-to-low latitude glaciers have also provided valuable records of climate variability in these regions. A regional array of high resolution, multi-parameter ice core records developed from temperate and tropical regions of the globe can be used to document regional climate and environmental change in the latitudes which are home to the vase majority of the Earth's human population. In addition, these records can be directly compared with ice core records available from the polar regions and can therefore expand our understanding of inter-hemispheric dynamics of past climate changes. The main objectives of our paleoclimate research in the Tien Shan mountains of middle Asia combine the development of detailed paleoenvironmental records via the physical and chemical analysis of ice cores with the analysis of modern meteorological and hydrological data. The first step in this research was the collection of ice cores from the accumulation zone of the Inylchek Glacier and the collection of meteorological data from a variety of stations throughout the Tien Shan. The research effort described in this report was part of a collaborative effort with the United State Geological Survey's (USGS) Global Environmental Research Program which began studying radionuclide deposition in mid-latitude glaciers in 1995.

Registration of intensive hard X-rays and soft gamma-rays from the thunderstorm clouds at Tien-Shan installation Adron

International Nuclear Information System (INIS)

Antonova, V.P.; Kryukov, S.V.; Vil'danova, L.I.; Gurevich, A.V.; Zybin, K.P.; Kokobaev, M.M.; Nesterova, N.M.; Piskal', V.V.; Ptitsyn, M.O.; Chubenko, A.P.; Shchepetov, A.L.

2001-01-01

The Adron installation mounted at the Tien-Shan station is intended for studying the extensive air showers. The Adron installation consists of a neutron supermonitor charged particles detector, muon detector and detector for registering the hard X-ray and soft gamma-radiation from the thunderstorm clouds accomplished on the basis of the Geiger-Mueller counters with sensitivity area of 16-17 m 2 . The intensive fluxes of the hard X-ray and soft gamma-radiation from the thunderstorm clouds passing over the Adron installation at the height below 1 km are registered using this installation. The short-time radiation flares of 1-5 min duration are separated at the background of the intensity slow change. This testifies to the benefit of existence of the runaway electron effect in the thunderstorm clouds [ru

Seismic triggering of landslides, Part A: Field evidence from the Northern Tien Shan

Science.gov (United States)

Havenith, H.-B.; Strom, A.; Jongmans, D.; Abdrakhmatov, A.; Delvaux, D.; Tréfois, P.

Landslides triggered by strong earthquakes often caused most of the global damage and most of all casualties related to the events, such as shown by the M = 7.7 Peru earthquake in 1970, by the M = 7.6 El Salvador earthquake in 2001 or by the M = 7.4 Khait (Tajikistan) earthquake in 1949. The obvious impact of a landslide on the population is directly related to its movement. Yet, prediction of future failure potential and hence future risk to population is necessary in order to avoid further catastrophes and involves the analyses of the origin of seismic instability. The seismic landslide potential is mainly determined by the interaction between the regional seismic hazard and local geological conditions. At a local scale, seismic factors interfering with geological conditions can produce site-specific ground motions. The influence of such Site Effects on instability is the principal topic of this paper, which is divided into two parts, A and B. The present Part A is concerned with the correlation of field data with observed instability phenomena. Field data were obtained on mainly three landslide sites in the Northern Tien Shan Mountains in Kyrgyzstan, Central Asia. Geophysical prospecting, earthquake recordings, geological observation, trenching and geotechnical tests were the main investigation tools. The collected information gives an insight in the geological background of the slope failure and allows us to roughly infer failure mechanisms from field evidence. A detailed analysis of the susceptibility of a mechanism to specific geological conditions will be shown in Part B.

Seismic triggering of landslides, Part A: Field evidence from the Northern Tien Shan

Directory of Open Access Journals (Sweden)

H.-B. Havenith

2003-01-01

Full Text Available Landslides triggered by strong earthquakes often caused most of the global damage and most of all casualties related to the events, such as shown by the M = 7.7 Peru earthquake in 1970, by the M = 7.6 El Salvador earthquake in 2001 or by the M = 7.4 Khait (Tajikistan earthquake in 1949. The obvious impact of a landslide on the population is directly related to its movement. Yet, prediction of future failure potential and hence future risk to population is necessary in order to avoid further catastrophes and involves the analyses of the origin of seismic instability. The seismic landslide potential is mainly determined by the interaction between the regional seismic hazard and local geological conditions. At a local scale, seismic factors interfering with geological conditions can produce site-specific ground motions. The influence of such Site Effects on instability is the principal topic of this paper, which is divided into two parts, A and B. The present Part A is concerned with the correlation of field data with observed instability phenomena. Field data were obtained on mainly three landslide sites in the Northern Tien Shan Mountains in Kyrgyzstan, Central Asia. Geophysical prospecting, earthquake recordings, geological observation, trenching and geotechnical tests were the main investigation tools. The collected information gives an insight in the geological background of the slope failure and allows us to roughly infer failure mechanisms from field evidence. A detailed analysis of the susceptibility of a mechanism to specific geological conditions will be shown in Part B.

«Si una mujer tiene la cabeza grande»: fisionomía y carácter femenino en un texto asiriobabilónico

OpenAIRE

Couto Ferreira, Érica

2008-01-01

El cuerpo humano en Mesopotamia era entendido como objeto adivinatorio: un sistema de signos, portador de mensajes sobre el propio individuo, cuyo significado debía decodificarse mediante la observación y la interpretación. Tomando como fuente principal de mi trabajo la serie fisionómica Šumma sinništu qaqqada rabât («Si una mujer tiene la cabeza grande»), analizo, por una parte, los mecanismos por los que se promueve una determinada visión de las mujeres en la adivinación fisionómica a parti...

The enigmas of The grail. on The ConTroversy over The UniTy of Li Contes deL GraaL of ChréTien de Troyes

Directory of Open Access Journals (Sweden)

Victoria Cirlot

2014-12-01

Full Text Available This paper presents a review of the controversy about the unity of the last roman of Chrétien de Troyes, Li Contes del Graal which took place in the late fifties between Martí de Riquer, Jean Frappier and Erich Köhler. More than fifty years later, this paper will appraise the contributions that this controversy made to Romance philology, and, in particular, to the assessment of the last work of the Champenian writer.

Fluxes of 10-2000 GeV hadrons in EAS produced by 1-100 PeV PCR according to Tien Shan data

International Nuclear Information System (INIS)

Nesterova, N.M.; Pavlyuchenko, V.P.; Chubenko, A.P.; Shchepetov, A.L.; Mukhamedshin, R.A.

2005-01-01

The experimental data on the hadrons spectra with the energy of 10-2000 GeV in the extensive air showers with the electrons number N e =3 x 10 5 -10 8 at the distances of 3-60 m from the axis are obtained at the Tien-Shan mountainous facility (690 g/cm 2 ) by means of the 18NM64 neutron monitor and ionization calorimeter. The obtained results are compared with the calculations by the MS0-model. The comparison shows that the singular hadrons experimental number significantly exceeds the calculational value. This may be brought by the change in the PCR character and its interaction with the air atoms nuclei by the energies above several PeV [ru

Orelhas de elefante, olhos de coruja, dentes de javali: maravilhoso e descritivo em Yvain ou le chevalier au lion, de Chrétien de Troyes

OpenAIRE

Luis Claudio Kinker Caliendo

2009-01-01

No final do século XII, Chrétien de Troyes considerado por muitos críticos o maior poeta francês da chamada Idade Média compõe um poema narrativo Yvain ou le Chevalier au Lion no qual se percebem elementos tidos como característicos do gênero maravilhoso, tais quais objetos mágicos e seres extraordinários, como monstros e gigantes. Esses elementos entre outros fatores levaram boa parte da crítica a enxergar na poesia medieval, durante muito tempo, uma certa ingenuidade, típica de uma in...

Los enigmas del Grial. En torno a la polémica sobre la unidad de El Cuento del Grial de Chrétien de Troyes

Directory of Open Access Journals (Sweden)

Victoria Cirlot

2014-12-01

Full Text Available Relectura de la polémica acerca de la unidad del último roman de Chrétien de Troyes, Li Contes del Graal que tuvo lugar a finales de los años cincuenta entre Martín de Riquer, Jean Frappier y Erich Köhler. Más de cincuenta años después se trata de valorar las aportaciones que dicha polémica supuso para la filología románica y, en concreto, para la valoración de la última obra del escritor de la Champaña.

EVIDENCE FOR MULTIPLE SOURCES OF 10Be IN THE EARLY SOLAR SYSTEM

International Nuclear Information System (INIS)

Wielandt, Daniel; Krot, Alexander N.; Bizzarro, Martin; Nagashima, Kazuhide; Huss, Gary R.; Ivanova, Marina A.

2012-01-01

Beryllium-10 is a short-lived radionuclide (t 1/2 = 1.4 Myr) uniquely synthesized by spallation reactions and inferred to have been present when the solar system's oldest solids (calcium-aluminum-rich inclusions, CAIs) formed. Yet, the astrophysical site of 10 Be nucleosynthesis is uncertain. We report Li-Be-B isotope measurements of CAIs from CV chondrites, including CAIs that formed with the canonical 26 Al/ 27 Al ratio of ∼5 × 10 –5 (canonical CAIs) and CAIs with Fractionation and Unidentified Nuclear isotope effects (FUN-CAIs) characterized by 26 Al/ 27 Al ratios much lower than the canonical value. Our measurements demonstrate the presence of four distinct fossil 10 Be/ 9 Be isochrons, lower in the FUN-CAIs than in the canonical CAIs, and variable within these classes. Given that FUN-CAI precursors escaped evaporation-recondensation prior to evaporative melting, we suggest that the 10 Be/ 9 Be ratio recorded by FUN-CAIs represents a baseline level present in presolar material inherited from the protosolar molecular cloud, generated via enhanced trapping of galactic cosmic rays. The higher and possibly variable apparent 10 Be/ 9 Be ratios of canonical CAIs reflect additional spallogenesis, either in the gaseous CAI-forming reservoir, or in the inclusions themselves: this indicates at least two nucleosynthetic sources of 10 Be in the early solar system. The most promising locale for 10 Be synthesis is close to the proto-Sun during its early mass-accreting stages, as these are thought to coincide with periods of intense particle irradiation occurring on timescales significantly shorter than the formation interval of canonical CAIs.

INFEKSI KOMUNITAS (IK/INFEKSI LUAR RUMAH SAKIT (ILRS (COMMUNITY ACQUIRED INFECTION DI RUMAH SAKIT KHUSUS PENYAKIT MENULAR, JAKARTA

Directory of Open Access Journals (Sweden)

Janas Janas

2012-09-01

Full Text Available A one year prospective study was conducted at the Infectious Diseases Hospital (IDH of Jakarta in 1982-1983 to survey the rate of community acquired infection (CAI. Blood culture, rectal swab, urine culture and in some patients cerebro spinal fluid culture were obtained randomly from hospitalized patient at the time of admission. From 723 patients with age 2 months-70 years, who were examined and fulfilled the study criteria, 504 (69,7% patients were positive for CAI resulted in total of 611 CAIs. Based on anatomical location, this number consists of 53.5% CAI of GI Tract, 20.9% CAI of Urinary Tract, 9.5% CAI bacteremia and 0.6% CAI involving central nervous system. Incidence rate was significantly higher in female (74.1% compared to male (65.7% (p<0.02. It was also higher in >12 years patients (73.9% compared to children <12 years (p<0,01. Diarrhea patients had significantly higher CAI (77.4% compared to febrile patients (55.2% (p<0,01. Patients who had not received antibiotic prior to admission had higher rate of CAI (70.9% compared to who received it prior to admission (67.1% Etiologic agents most commonly recovered were gram negative bacterias (94.9% with Vibrio cholerae (48.6% as the leading cause, and only 5.1% were gram positive. Some of bacteria found as the etiologic agent of CAI, were Salmonella group D, Salmonella group E4, Proteus vulgaris and ruttgerii, Klebsiella pneumoniae, Mima polymorpha, Alkaligenes sp showed high rate of resistancy to commonly used antibiotics. (Ampicillin, Tetracycline, Chloramphenicol and Trimethoprim + Sulfamethoxazole. Average duration of hospitalization for CAI cases (6,4 days was longer than in cases without CAI (4,3 days. There were 11 deaths (2.2% in cases with CAI and 2 deaths (1.4% in patients without CAI, with death rate was higher in males (2.4% compared to female (1.9%, and highest was in less than 1 year old age group patient (13.6%, also significantly higher in febrile patients compared to

Self-regulation by industry of food marketing is having little impact during children's preferred television.

Science.gov (United States)

Potvin Kent, Monique; Dubois, Lise; Wanless, Alissa

2011-10-01

To examine the efficacy of self-regulation of food marketing to children by comparing, during children's preferred viewing on television, the differences in food/beverage marketing between two groups of corporations: 17 corporations participating in the Canadian Children's Food and Beverage Advertising Initiative (CAI) and 35 corporations not participating (non-CAI) in this initiative. The food/beverage marketing activities of CAI and non-CAI corporations during 99.5 hours of children's preferred viewing on television were compared. First, the preferred television viewing of 272 children aged 10-12 years from Ontario and Quebec who completed TV viewing journals for a seven-day period was determined. A total of 32 television stations were simultaneously recorded, and a content analysis of children's preferred viewing was conducted and included coding all food/beverage promotions and their nutritional content. Each food/beverage promotion was classified by corporation type (i.e., CAI or non-CAI). The CAI was responsible for significantly more food/beverage promotions, and used media characters and repetition more frequently in their food/beverage promotions than the non-CAI group. Nutritionally, the CAI food/beverage promotions were higher in fats, sugar, sodium and energy per 100 grams. A significantly greater proportion of the CAI food/beverage promotions were considered 'less healthy' compared to the non-CAI promotions. With the exception of the four corporations that did not market to children at all, the commitments that have been made in the CAI are not having a significant impact on the food and beverage marketing environment on television which is viewed by 10-12-year-olds.

A 'college of astrology and medicine'? Charles V, Gervais Chrétien, and the scientific manuscripts of Maître Gervais's College.

Science.gov (United States)

Boudet, Jean-Patrice

2010-06-01

Considered an institution mainly devoted to astrology and medicine by Simon de Phares and by some historians who believe that he was reliable, the college founded in 1371 by Charles V's first physician, Gervais Chrétien, was in fact primarily dedicated to theological students. It was not before 1377 that there were created there two bursaries for scholares regis, specialising in 'licit mathematical sciences', and two medical fellowships. Yet the influence of the activity of these fellows seems to have been rather moderate and-as far as we can learn from the material still extant, notably from manuscripts that belonged to Maître Gervais' College and to some of its members-this institution was devoted much more to theological studies than to medicine and the quadrivium.

Vers une “écriture métisse”: le roman des immigrants haïtiens du Québec Writing the cultural cross-currents: the Haitian immigrants’ novel in Quebec

Directory of Open Access Journals (Sweden)

Józef Kwaterko

2010-12-01

Full Text Available mémoriel et langagier dans les romans des immigrants haïtiens au Québec.Après quelques considérations sociologiques sur l’écriture migrante(diasporique, on observera les enjeux esthétiques du métissage sur un axediachronique : les années 1970 où l’espace-temps du pays d’origine dominela représentation, les années 1980 où le travail du deuil apporte des effetsd’hybridation, et à partir du milieu des années 1980 à nos jours lorsque lesromanciers haïtiens assument l’exil et se réapproprient à distance leur paysdélaissé.The aim of this paper is to recognize the manifestations of the culturalhybridization (métissage among Haitian novelists who immigrated to Quebec. After some sociological characteristics of the migrant writing, the mainaesthetics features will be observed on diachronic level: during the 1970s,when the place of the country of origin dominate the representation, duringthe 1980s when the feeling of split identity increase the effects of hybridity,and since the middle of 1980s when the Haitian writers assume their exileby entering into an intercultural, dialogic relationship with their abandonedcountry.

Sexual violence and the risk of HIV transmission in sexual partners of male injecting drug users in Tien Du district, Bac Ninh province of Vietnam.

Science.gov (United States)

Do, Vinh Thi; Ho, Hien Thi; Nguyen, Tri Manh; Do, Huynh Khac

2018-04-01

We conducted a cross-sectional study among 148 women who were regular sexual partners of male injecting drug users in Tien Du, Bac Ninh province, Vietnam to identify the rate of HIV infection and factors associated with HIV transmission among them. HIV infection rate among sexual partners was high, 11.5%. Sexual violence was prevalent, 63.5% among sexual partners; 94.1% (16/17) among those with HIV. We discovered an association between sexual violence and HIV infection. Sexual partners suffering from sexual violence caused by their regular sexual partners faced 9.24 times higher HIV risk than those who did not have sexual violence.

Karyotype variation and conservation in morphotypes of non-heading Chinese cabbage

NARCIS (Netherlands)

Zheng, Jin Shuang; Sun, Cheng Zhen; Xiao, Dong; Zhang, Shu Ning; Bonnema, Guusje; Hou, Xi Lin

2015-01-01

Non-heading Chinese cabbage encompasses a wide diversity of morphotypes, like the well-known Pak-choi, Wu ta cai, Cai xin, Tai cai, and Fen nei cai. Despite recent developments in re-sequencing which results in the detection of SNPs, insertions, deletions and copy number variants, there has been

Feedback and Feedforward Control During Walking in Individuals With Chronic Ankle Instability.

Science.gov (United States)

Yen, Sheng-Che; Corkery, Marie B; Donohoe, Amy; Grogan, Maddison; Wu, Yi-Ning

2016-09-01

Study Design Controlled laboratory study. Background Recurrent ankle sprains associated with chronic ankle instability (CAI) occur not only in challenging sports but also in daily walking. Understanding whether and how CAI alters feedback and feedforward controls during walking may be important for developing interventions for CAI prevention or treatment. Objective To understand whether CAI is associated with changes in feedback and feedforward control when individuals with CAI are subjected to experimental perturbation during walking. Methods Twelve subjects with CAI and 12 control subjects walked on a treadmill while adapting to external loading that generated inversion perturbation at the ankle joint. Ankle kinematics around heel contact during and after the adaptation were compared between the 2 groups. Results Both healthy and CAI groups showed an increase in eversion around heel contact in early adaptation to the external loading. However, the CAI group adapted back toward the baseline, while the healthy controls showed further increase in eversion in late adaptation. When the external loading was removed in the postadaptation period, healthy controls showed an aftereffect consisting of an increase in eversion around heel contact, but the CAI group showed no aftereffect. Conclusion The results provide preliminary evidence that CAI may alter individuals' feedback and feedforward control during walking. J Orthop Sports Phys Ther 2016;46(9):775-783. Epub 5 Aug 2016. doi:10.2519/jospt.2016.6403.

Isotopic coherence of refractory inclusions from CV and CK meteorites: Evidence from multiple isotope systems

Science.gov (United States)

Shollenberger, Quinn R.; Borg, Lars E.; Render, Jan; Ebert, Samuel; Bischoff, Addi; Russell, Sara S.; Brennecka, Gregory A.

2018-05-01

Calcium-aluminum-rich inclusions (CAIs) are the oldest dated materials in the Solar System and numerous previous studies have revealed nucleosynthetic anomalies relative to terrestrial rock standards in many isotopic systems. However, most of the isotopic data from CAIs has been limited to the Allende meteorite and a handful of other CV3 chondrites. To better constrain the isotopic composition of the CAI-forming region, we report the first Sr, Mo, Ba, Nd, and Sm isotopic compositions of two CAIs hosted in the CK3 desert meteorites NWA 4964 and NWA 6254 along with two CAIs from the CV3 desert meteorites NWA 6619 and NWA 6991. After consideration of neutron capture processes and the effects of hot-desert weathering, the Sr, Mo, Ba, Nd, and Sm stable isotopic compositions of the samples show clearly resolvable nucleosynthetic anomalies that are in agreement with previous results from Allende and other CV meteorites. The extent of neutron capture, as manifested by shifts in the observed 149Sm-150Sm isotopic composition of the CAIs is used to estimate the neutron fluence experienced by some of these samples and ranges from 8.40 × 1013 to 2.11 × 1015 n/cm2. Overall, regardless of CAI type or host meteorite, CAIs from CV and CK chondrites have similar nucleosynthetic anomalies within analytical uncertainty. We suggest the region that CV and CK CAIs formed was largely uniform with respect to Sr, Mo, Ba, Nd, and Sm isotopes when CAIs condensed and that CAIs hosted in CV and CK meteorites are derived from the same isotopic reservoir.

De la chair imbibée de foi : la viande comme marqueur de la frontière entre chrétiens et musulmans en Éthiopie

Directory of Open Access Journals (Sweden)

Éloi Ficquet

2006-05-01

Full Text Available Jamais en Éthiopie un chrétien et un musulman ne mangent de viande ensemble. Consommer de la viande qui n’a pas été consacrée à sa propre foi est appréhendé comme un acte hautement sacrilège équivalent à une apostasie. Cet interdit doit être compris dans une perspective comparative large sur les pratiques et les débats qui restreignent la commensalité de la viande entre les chrétiens et les musulmans. Les usages éthiopiens ont accentué cette question pour en faire un interdit puissant, marqueur d’une frontière interreligieuse. Comme toute frontière, cette « frontière carnée » a été le lieu de confrontations, d’aménagements et de transgressions dont les effets ont contribué à la construction de l’espace national éthiopien contemporain.Christians and Muslims in Ethiopia never eat meat together. Consuming meat that was not consecrated to one’s faith is seen as a highly sacrilegious act equal to apostasy. This interdict must be understood in comparative perspective that looks at the restrictions regarding the sharing of meat between Christians and Muslims. Ethiopian customs have emphasized this issue to turn it into a powerful interdict, tracing an inter-religious boundary. Like any boundary, this “dietary boundary” has been the site of confrontations, readjustments and transgressions whose effects have contributed to the building of a contemporary Ethiopian national space.

Conodont geothermometry in pyroclastic kimberlite: constraints on emplacement temperatures and cooling histories

Science.gov (United States)

Pell, Jennifer; Russell, James K.; Zhang, Shunxin

2018-03-01

Kimberlite pipes from Chidliak, Baffin Island, Nunavut, Canada host surface-derived Paleozoic carbonate xenoliths containing conodonts. Conodonts are phosphatic marine microfossils that experience progressive, cumulative and irreversible colour changes upon heating that are experimentally calibrated as a conodont colour alteration index (CAI). CAI values permit us to estimate the temperatures to which conodont-bearing rocks have been heated. Conodonts have been recovered from 118 samples from 89 carbonate xenoliths collected from 12 of the pipes and CAI values within individual carbonate xenoliths show four types of CAI distributions: (1) CAI values that are uniform throughout the xenolith; (2) lower CAIs in core of a xenolith than the rim; (3) CAIs that increase from one side of the xenolith to the other; and, (4) in one xenolith, higher CAIs in the xenolith core than at the rim. We have used thermal models for post-emplacement conductive cooling of kimberlite pipes and synchronous heating of conodont-bearing xenoliths to establish the temperature-time history of individual xenoliths within the kimberlite bodies. Model results suggest that the time-spans for xenoliths to reach the peak temperatures recorded by CAIs varies from hours for the smallest xenoliths to 2 or 3 years for the largest xenoliths. The thermal modelling shows the first three CAI patterns to be consistent with in situ conductive heating of the xenoliths coupled to the cooling host kimberlite. The fourth pattern remains an anomaly.

Calcium and titanium isotopes in refractory inclusions from CM, CO, and CR chondrites

Science.gov (United States)

Kööp, Levke; Davis, Andrew M.; Krot, Alexander N.; Nagashima, Kazuhide; Simon, Steven B.

2018-05-01

Previous studies have shown that CV and CM chondrites incorporated Ca, Al-rich inclusions (CAIs) with different isotopic characteristics, which may represent different snapshots in the isotopic evolution of the early Solar System. To better understand how the isotopic characteristics of CAIs vary between different chondrite groups, we have studied calcium and titanium isotopes in CAIs from CM, CO, and CR chondrites. We show that all three chondrite groups contain CAIs with large anomalies in 48Ca and/or 50Ti (10s of ‰ or 100s of ε-units) as well as CAIs with no anomalies resolved beyond measurement uncertainties. Isotopically, the anomalous CO and CR chondrite CAIs resemble the platy hibonite crystals (PLACs) from CM chondrites, but they are more mineralogically complex. The new data are consistent with the well-established mutual exclusivity relationship between incorporation of 26Al and the presence of large anomalies in 48Ca and 50Ti. The two highly anomalous CO chondrite CAIs have correlated anomalies in 46Ti and 50Ti, while most other highly anomalous CAIs do not. This result could indicate that the reservoir with coupled 46Ti and 50Ti that was sampled by bulk meteorites and CV chondrite CAIs already existed before arrival and/or homogeneous distribution of 26Al in the protoplanetary disk. Among the studied CM chondrite CAIs are ten spinel-hibonite inclusions (SHIBs) with known oxygen isotopic compositions. Our results show that these objects sampled a reservoir that was well-mixed in oxygen, calcium, and titanium isotopes. We further show that SHIBs tend to be slightly enriched in the heavy calcium isotopes, suggesting that their formation history was different from CV chondrite CAIs.

La Fábula Ovidiana de Filomela revisada por la Edad Media: de Chrétien de Troyes a Alfonso x

Directory of Open Access Journals (Sweden)

Mario Martín Botero García

2014-12-01

Full Text Available En este trabajo se expone el contraste entre las dos traducciones al francés y al castellano de Filomela, una de las fábulas de las Metamorfosis de Ovidio, realizadas en los siglos xii y xiii por Chrétien de Troyes y Alfonso X. Por medio del análisis y cotejo de tres momentos narrativos, veremos la forma en que la materia antigua es tratada según el contexto determinado en el que se producen las traducciones. La versión francesa hace énfasis en una dimensión cortés en donde el personaje femenino es altamente valorado; por su parte, la versión castellana reivindica una racionalización de la fábula ovidiana, supeditada a una visión política e histórica. Se puede constatar así que las traducciones medievales no son serviles con respecto a la fuente latina sino que demuestran una gran libertad en la selección y combinación de elementos.

Complete Androgen Insensitivity Syndrome in Three Sisters

Directory of Open Access Journals (Sweden)

Levent Verim

2014-01-01

Full Text Available Disorders of sexual development (DSD are congenital anomalies due to atypical development of chromosomes, gonads and anatomy. Complete androgen insensitivity syndrome (CAIS, also known as testicular feminization (TF is a rare DSD disease. The majority of CAIS patients apply to hospital with the complaint of primary amenorrhea or infertility. Given that CAIS patients are all phenotypically female while having 46, XY karyotypes, CAIS diagnosis should be disclosed in an age-appropriate manner preferably by a mental health professional. Cases are reported here for three 46XY siblings consistent with CAIS.

Effects of 1,25-Dihydroxycholecalciferol on Recovery and Resolution of Late Transient Neonatal Hypocalcemia

Directory of Open Access Journals (Sweden)

McKay SiripoomV

2010-03-01

Full Text Available Background. Late transient neonatal hypocalcemia with hyperphosphatemia is potentially life-threatening. The use of dihydroxycholecalciferol in the management of neonatal hypocalcemia is unexplored. Objective. We hypothesized adding dihydroxycholecalciferol to intravenous continuous calcium infusion (CaI will achieve accelerated correction of hypocalcemia. Design/Methods. A controlled double-blind randomized placebo group was organized to compare the addition of dihydroxycholecalciferol to CaI in 3–14 day old neonates presenting with hypocalcemia, hyperphosphatemia and seizures. Ionized calcium and phosphorus were measured to adjust CaI and maintain eucalcemia. Time to resolution of hypocalcemia was defined as time from starting CaI to the first ionized calcium of  mmol/L. CaI was discontinued when ionized calcium levels were  mmol/L on two measurements and the infant tolerated feeds. Results. Fourteen neonates were studied without statistical difference between groups. Time to correction of hypocalcemia for 1,25 dihydroxycholecalciferol versus placebo was versus hours respectively (. The duration of CaI was versus hours respectively (. Conclusions. The addition of dihydroxycholecalciferol to standard CaI therapy reduced the duration of CaI, but did not reduce the time to correct hypocalcemia in neonates with late transient hypocalcemia.

Tectonically controlled relief evolution in the Northern Tien Shan and Junggar Alatau from the Eocene to the Present

Science.gov (United States)

Seib, N.; Kley, J.; Voigt, T.; Kober, M.

2012-04-01

The Cenozoic Tien Shan and Junggar Alatau mountains developed on the southern part of the Paleozoic Altaid orogen as a far-field effect of the collision of the Indian and Eurasian plates. Highland terrain, active seismicity, and fast GPS-derived motions are evidence of rapid ongoing mountain growth today. Variations in relief energy, hight-to-width ratio of ranges and apatite fission track (AFT) exhumation ages suggest they rose at different times. The strong dissection of the higher ridges (heights of up to 2km), indicates an earlier onset and higher rates of uplift. At the other end of the spectrum are low, little dissected ridges. According to AFT ages, exhumation in the Junggar Range began at 9 Ma (Jolivet et al., 2010), circa 11 Ma in the central Kyrgyz Range (Sobel et al., 2006) and 10 Ma in the Terskey Alatau. An AFT age of the low Sogety range is 77 Ma, suggesting that the Cenozic exhumation of the ridge was insufficient to expose rocks from below c.3 km depth. The synclinal lows between the basement highs preserve Cenozoic strata of Eocene to Quaternary age, probably deposited in a once continuous basin (the Ili Basin) and recording the entire history of Tien Shan uplift. Facies pattern of proximal alluvial fans are strictly related to the recent higher mountain areas in the north and in the south. During Middle Miocene, a large lake developed in the basin center. Up to the Middle Miocene sedimentation was accompanied by normal faulting of small magnitude. The main Cenozoic folding and thrusting occurred after that time and before deposition of the Chorgos formation. Shortening was accommodated by reactivation of inherited basement structures, by a switch to reverse or strike-slip motion on normal faults, and the nucleation of new thrusts. The majority of faults which emplace basement rocks over upper Cenozoic sediments dip steeply at angles of 60-70˚, and some have throws of more than 200 m. They are marked by topographic steps and contrasting morphology

Plant growth-promoting activities of Streptomyces spp. in sorghum and rice.

Science.gov (United States)

Gopalakrishnan, Subramaniam; Srinivas, Vadlamudi; Sree Vidya, Meesala; Rathore, Abhishek

2013-01-01

Five strains of Streptomyces (CAI-24, CAI-121, CAI-127, KAI-32 and KAI-90) were earlier reported by us as biological control agents against Fusarium wilt of chickpea caused by Fusarium oxysporum f. sp. ciceri (FOC). In the present study, the Streptomyces were characterized for enzymatic activities, physiological traits and further evaluated in greenhouse and field for their plant growth promotion (PGP) of sorghum and rice. All the Streptomyces produced lipase, β-1-3-glucanase and chitinase (except CAI-121 and CAI-127), grew in NaCl concentrations of up to 6%, at pH values between 5 and 13 and temperatures between 20 and 40°C and were highly sensitive to Thiram, Benlate, Captan, Benomyl and Radonil at field application level. When the Streptomyces were evaluated in the greenhouse on sorghum all the isolates significantly enhanced all the agronomic traits over the control. In the field, on rice, the Streptomyces significantly enhanced stover yield (up to 25%; except CAI-24), grain yield (up to 10%), total dry matter (up to 18%; except CAI-24) and root length, volume and dry weight (up to 15%, 36% and 55%, respectively, except CAI-24) over the control. In the rhizosphere soil, the Streptomyces significantly enhanced microbial biomass carbon (except CAI-24), nitrogen, dehydrogenase (except CAI-24), total N, available P and organic carbon (up to 41%, 52%, 75%, 122%, 53% and 13%, respectively) over the control. This study demonstrates that the selected Streptomyces which were antagonistic to FOC also have PGP properties.

Autonomous geodynamics of the Pamir-Tien Shan junction zone from seismology data

Science.gov (United States)

Lukk, A. A.; Shevchenko, V. I.; Leonova, V. G.

2015-11-01

The geodynamics of the Tajik Depression, the junction zone of the Pamirs and Tien Shan, is typically considered in the context of plate tectonic concept, which implies intense subhorizontal compression of the zone resulting from the subduction of the Indian and Eurasian lithospheric plates. This convergence has been reliably confirmed by the GPS measurements. However, the joint analysis of the geological structure, seismicity, and geodimeter measurements conducted during a few years at the Garm geodynamical testing site of the Schmidt Institute of Physics of the Earth, Russian Academy of Sciences, demonstrates a widening of the Tajik Depression instead of its shortening, as should be expected from the subhorizontal compression predominant in the present-day stress-state of this region. This conclusion, together with the data from the other regions, suggests that, along with the plate tectonic mechanisms, there are also other, local, autonomous drivers that contribute to the tectogenesis of this region. Besides, the probable existence of these autonomous sources within the Tajik Depression directly follows from the seismology data. Among them is the crustal spreading within the depression suggested by the seismotectonic displacements in the focal mechanisms of the earthquakes. These displacements are directed in different azimuths off the axial's most subsided part of the depression at a depth of 20-30 km. Above this region the distribution of seismotectonic deformations (STD) is chaotic. This pattern of deformation is barely accounted for by a simple model of subhorizontal compression of the Earth's crust in the region. In our opinion, these features of the seismotectonic deformation in the crust within the studied part of the Tajik Depression is probably associated with the gain in the volume of the rocks due to the inflow of the additional material, which is supplied from the bottom crust or upper mantle by the deep fluids. This increase in the rock volume

Severe neutropenia at time of port insertion is not a risk factor for catheter-associated infections in children with acute lymphoblastic leukemia.

Science.gov (United States)

Junqueira, Beatriz L P; Connolly, Bairbre; Abla, Oussama; Tomlinson, George; Amaral, Joao G

2010-09-15

The objective of this study was to determine whether severe neutropenia on the day of port-a-catheter (PORT) insertion was a risk factor for catheter-associated infection (CAI) in children with acute lymphoblastic leukemia (ALL). This was a retrospective study of children with ALL who had a PORT insertion between January 2005 and August 2008. Early (≤ 30 days) and late (>30 days) postprocedure complications were reviewed. The length of follow-up ranged between 7 months and 42 months. In total, 192 PORTs were inserted in 179 children. There were 43 CAIs (22%), and the infection rate was 0.35 per 1000 catheter-days. The CAI rate (15%) in children who had severe neutropenia on the day of the procedure did not differ statistically from the CAI rate (24%) in children who did not have severe neutropenia (P = .137). Conversely, patients with severe neutropenia who had a CAI were more likely to have their PORT removed (P = .019). The most common organisms to cause catheter removal were coagulase-negative Staphylococcus and Staphylococcus aureus. Patients with high-risk ALL had a statistically significant higher incidence of late CAI than patients with standard-risk ALL (P = .012). Age (P = .272), positive blood culture preprocedure (P = 1.0), and dexamethasone use (P = .201) were not risk factors for CAI. Patients who had an early CAI did not have a greater chance of having a late CAI. The catheter infection-free survival rate at 1 year was 88.6%. The current results indicated that severe neutropenia on the day of PORT insertion does not increase the risk of CAI in children with ALL. © 2010 American Cancer Society.

A Theory-Based Exploration of Condomless Anal Intercourse Intention Among Young Men Who Have Sex with Men of Different Sexual Roles in Taiwan.

Science.gov (United States)

Chu, Jen-Hao; Huang, Jiun-Hau

2017-11-28

In recent years, men who have sex with men (MSM) have accounted for over 80% of all new HIV cases in Taiwan. More than 70% of new cases have occurred in those aged 15-34 years. Condomless anal intercourse (CAI) has been identified as the main route of HIV transmission among MSM. To systematically examine CAI intention and associated factors among young MSM in Taiwan, an anonymous online survey based on the Theory of Planned Behavior (TPB) was conducted. Data from 694 MSM aged 15-39 years were included in the analysis. This study found that, overall, all five TPB factors (i.e., attitudes toward positive and negative outcomes regarding CAI, perceived support for CAI from important others, and perceived behavioral control of CAI under facilitating and constraining conditions) were significantly associated with CAI intention. When data were stratified by sexual role (i.e., receptive, versatile, and insertive), the associations between TPB factors and CAI intention varied. Of the five TPB factors, positive attitudes toward positive outcomes regarding CAI were most strongly associated with high CAI intention (AOR 5.68 for all young MSM; AOR 3.80-15.93, depending on sexual role). Findings from this study could inform the development of theory-driven HIV prevention programs as well as future research and practice. These results also highlight the importance of tailoring HIV prevention initiatives for young MSM of different sexual roles to optimize the program effectiveness.

Uncovering driving forces on greenhouse gas emissions in China’ aluminum industry from the perspective of life cycle analysis

International Nuclear Information System (INIS)

Liu, Zhe; Geng, Yong; Adams, Michelle; Dong, Liang; Sun, Lina; Zhao, Jingjing; Dong, Huijuan; Wu, Jiao; Tian, Xu

2016-01-01

Highlights: • Energy-related GHG emission trajectories, features and driving forces of CAI are analyzed from the perspective of LCA. • CAI experienced a rapid growth of energy-related GHG emissions from 2004 to 2013. • Energy-scale effect is the main driving force for energy-related GHG emissions increase in CAI. • Construction and transportation-related activities account for more than 40% of the total embodied emissions. • Policy implications such as developing secondary aluminum industry, improving energy mix etc, are raised. - Abstract: With the rapid growth of aluminum production, reducing greenhouse gas (GHG) emissions in China’s aluminum industry (CAI) is posing a significant challenge. In this study, the energy-related GHG emission trajectories, features and driving forces of CAI are analyzed from the perspective of life cycle analysis (LCA) from 2004 to 2013. Results indicate that CAI experienced a rapid growth of energy-related GHG emissions with an average annual growth of 28.5 million tons CO_2e from 2004 to 2013. Energy-scale effect is the main driving force for energy-related GHG emissions increase in CAI, while emission-factor effect of secondary aluminum production plays a marginal effect. Construction and transportation-related activities account for the bulk of the embodied emissions, accounting for more than 40% of the total embodied emissions from CAI. Policy implications for GHG mitigation within the CAI, such as developing secondary aluminum industry, improving energy mix and optimizing resource efficiency of production, are raised.

NCBI nr-aa BLAST: CBRC-PHAM-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1277 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 2e-09 73% ...

NCBI nr-aa BLAST: CBRC-PHAM-01-1632 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-1632 emb|CAI12641.1| caspase 7, apoptosis-related cysteine peptidase [...Homo sapiens] emb|CAI16007.1| caspase 7, apoptosis-related cysteine peptidase [Homo sapiens] CAI12641.1 3e-25 69% ...

The effectiveness of foot orthotics in improving postural control in individuals with chronic ankle instability: a critically appraised topic.

Science.gov (United States)

Gabriner, Michael L; Braun, Brittany A; Houston, Megan N; Hoch, Matthew C

2015-02-01

Chronic ankle instability (CAI) is a condition commonly experienced by physically active individuals. It has been suggested that foot orthotics may increase a CAI patient's postural control. For patients with CAI, is there evidence to suggest that an orthotic intervention will help improve postural control? The literature was searched for studies of level 2 evidence or higher that investigated the effects of foot orthotics on postural control in patients with CAI. The search of the literature produced 5 possible studies for inclusion; 2 studies met the inclusion criteria and were included. One randomized controlled trial and 1 outcomes study were included. Foot orthotics appear to be effective at improving postural control in patients with CAI. There is moderate evidence to support the use of foot orthotics in the treatment of CAI to help improve postural control. There is grade B evidence that foot orthotics help improve postural control in people with CAI. The Centre of Evidence Based Medicine recommends a grade of B for level 2 evidence with consistent findings.

Oxygen isotopic abundances in calcium- aluminum-rich inclusions from ordinary chondrites: implications for nebular heterogeneity.

Science.gov (United States)

McKeegan, K D; Leshin, L A; Russell, S S; MacPherson, G J

1998-04-17

The oxygen isotopic compositions of two calcium-aluminum-rich inclusions (CAIs) from the unequilibrated ordinary chondrite meteorites Quinyambie and Semarkona are enriched in 16O by an amount similar to that in CAIs from carbonaceous chondrites. This may indicate that most CAIs formed in a restricted region of the solar nebula and were then unevenly distributed throughout the various chondrite accretion regions. The Semarkona CAI is isotopically homogeneous and contains highly 16O-enriched melilite, supporting the hypothesis that all CAI minerals were originally 16O-rich, but that in most carbonaceous chondrite inclusions some minerals exchanged oxygen isotopes with an external reservoir following crystallization.

Rhenium-osmium systematics of calcium-aluminium-rich inclusions in carbonaceous chondrites

Science.gov (United States)

Becker, H.; Morgan, J.W.; Walker, R.J.; MacPherson, G.J.; Grossman, J.N.

2001-01-01

The Re-Os isotopic systematics of calcium-aluminium-rich inclusions (CAIs) in chondrites were investigated in order to shed light on the behavior of the Re-Os system in bulk chondrites, and to constrain the timing of chemical fractionation in primitive chondrites. CAIs with relatively unfractionated rare earth element (REE) patterns (groups I, III, V, VI) define a narrow range of 187Re/188Os (0.3764-0.4443) and 187Os/188Os (0.12599-0.12717), and high but variable Re and Os abundances (3209-41,820 ppb Os). In contrast, CAIs that show depletions in highly refractory elements and strongly fractionated REE patterns (group II) also show a much larger range in 187Re/188Os (0.409-0.535) and 187Os/188Os (0.12695-0.13770), and greater than an order of magnitude lower Re and Os abundances than other groups (e.g., 75.7-680.2 ppb Os). Sixteen bulk CAIs and CAI splits plot within analytical uncertainty of a 4558 Ga reference isochron, as is expected for materials of this antiquity. Eight samples, however, plot off the isochron. Several possible reasons for these deviations are discussed. Data for multiple splits of one CAI indicate that the nonisochronous behavior for at least this CAI is the result of Re-Os reequilibration at approximately 1.6 Ga. Thus, the most likely explanation for the deviations of most of the nonisochronous CAIs is late-stage open-system behavior of Re and Os in the asteroidal environment. The 187Os/188Os-Os systematics of CAIs are consistent with previous models that indicate group II CAIs are mixtures of components that lost the bulk of their highly refractory elements in a previous condensation event and a minor second component that provided refractory elements at chondritic relative proportions. The high Re/Os of group II CAIs relative to other CAIs and chondrite bulk rocks may have been caused by variable mobilization of Re and Os during medium- to low-temperature parent body alteration ??4.5 Ga ago. This model is favored over nebular models, which

Peroneal electromechanical delay and fatigue in patients with chronic ankle instability.

Science.gov (United States)

Flevas, Dimitrios A; Bernard, Manfred; Ristanis, Stavros; Moraiti, Constantina; Georgoulis, Anastasios D; Pappas, Evangelos

2017-06-01

The purpose of this study was to investigate the effect of chronic ankle instability (CAI) on electromechanical delay times (EMD) before and after fatigue. Understanding the mechanisms that contribute to CAI is essential for the development of effective rehabilitation programmes. It was hypothesized that patients with CAI will demonstrate prolonged EMD times compared to healthy subjects and that fatigue will cause greater increases in EMD times in the CAI group. Twenty-one male volunteers participated in the study providing data on 16 ankles with CAI and 26 with no history of ankle injury. EMD was measured on an isokinetic dynamometer. Measurements were taken with the ankle in neutral (0°) and at 30° of inversion. All subjects followed an isokinetic fatigue protocol until eversion torque fell below 50 % of initial torque for three consecutive repetitions. A 2 × 2 × 2 ANOVA was used to calculate the effect of ankle status (CAI vs. healthy), fatigue, angle (0° vs. 30°) and their interactions on EMD. Fatigue caused a significant increase on EMD [non-fatigued: 122(29)ms vs. fatigue 155(54)ms; p ankle status and angle was found (p = 0.026) with CAI ankles demonstrating longer EMD [CAI: 156(45)ms vs. healthy: 133(40)ms] in neutral but not at 30° of inversion [CAI: 133(46)ms vs. 132(33)ms]. Patients with CAI had longer EMD times in neutral, but not when the ankle was placed in inversion. This suggests that rehabilitation programmes may be more effective when retraining occurs with the ankle in neutral position. It is likely that low EMD times prevent ankle acceleration at the beginning of the mechanism of injury, but they are less important when the ankle has already inverted at 30°. Both CAI and healthy subjects demonstrated longer EMD after fatigue, emphasizing the importance of proper conditioning in the prevention of delayed peroneal response and subsequent ankle injury. Improving resistance to fatigue of the peroneals may prove to be an effective

LISP教育用ICAIシステムの開発

OpenAIRE

伊藤, 寿勝; 島本, 肇; 黒島, 利一; 杉岡, 一郎

1989-01-01

Traditional computer-assisted instruction (CAI) has advantages and also has some of disadvantages that should be improved. To study intelligent CAI (ICAI) is regarded as trial to better CAI by using techniques in knowledge engineering. The system that was constructed in this research consists of three different modules ―a special knowledge module, a student model module and a guide rule module― to solve some problems of conventional CAI. For future researchers, the opportunity for engaging th...

“Et qui or me vaurra entendre, cuer et oreilles me doit rendre”: espacios de lectura y público de los roman courtois de Chrétien de Troyes (siglos XII-XIII

Directory of Open Access Journals (Sweden)

Diego Carlo Améndolla Spinola

2016-06-01

Full Text Available Basado en los planteamientos de la lógica social del texto, este artículo presenta un estudio del público que escuchaba los romances corteses entre los siglo XII y XIII, específicamente los realizados por Chrétien de Troyes –clérigo lector de la Corte de Leonor de Aquitania y de Enrique II Plantagenet–, además de establecer y analizar las diversas salas de los castillos donde estas obras literarias eran narradas.

NCBI nr-aa BLAST: CBRC-DDIS-03-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DDIS-03-0067 emb|CAI21049.1| novel protein similar to vertebrate syntaxin 7 (S...TX7) [Danio rerio] emb|CAI29417.1| novel protein similar to vertebrate syntaxin 7 (STX7) [Danio rerio] CAI21049.1 1e-17 24% ...

Lower extremity joint coupling variability during gait in young adults with and without chronic ankle instability.

Science.gov (United States)

Lilley, Thomas; Herb, Christopher C; Hart, Joseph; Hertel, Jay

2018-06-01

Chronic ankle instability (CAI) is a condition resulting from a lateral ankle sprain. Shank-rearfoot joint-coupling variability differences have been found in CAI patients; however, joint-coupling variability (VCV) of the ankle and proximal joints has not been explored. Our purpose was to analyse VCV in adults with and without CAI during gait. Four joint-coupling pairs were analysed: knee sagittal-ankle sagittal, knee sagittal-ankle frontal, hip frontal-ankle sagittal and hip frontal-ankle frontal. Twenty-seven adults participated (CAI:n = 13, Control:n = 14). Lower extremity kinematics were collected during walking (4.83 km/h) and jogging (9.66 km/h). Vector-coding was used to assess the stride-to-stride variability of four coupling pairs. During walking, CAI patients exhibited higher VCV than healthy controls for knee sagittal-ankle frontal in latter parts of stance thru mid-swing. When jogging, CAI patients demonstrated lower VCV with specific differences occurring across various intervals of gait. The increased knee sagittal-ankle frontal VCV in CAI patients during walking may indicate an adaptation to deal with the previously identified decrease in variability in transverse plane shank and frontal plane rearfoot coupling during walking; while the decreased ankle-knee and ankle-hip VCV identified in CAI patients during jogging may represent a more rigid, less adaptable sensorimotor system ambulating at a faster speed.

Dietary exposure to aflatoxin B1, ochratoxin A and fuminisins of adults in Lao Cai province, Viet Nam: A total dietary study approach.

Science.gov (United States)

Huong, Bui Thi Mai; Tuyen, Le Danh; Tuan, Do Huu; Brimer, Leon; Dalsgaard, Anders

2016-12-01

Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province, Vietnam. A total of 42 composite food samples representing 1134 individual food samples were prepared according to normal household practices and analysed for the three mycotoxins. Results showed that the dietary exposure to aflatoxin B1 (39.4 ng/kg bw/day) and ochratoxin A (18.7 ng/kg bw/day) were much higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical solutions which could reduce mycotoxin contamination as well as to determine the health effects of the co-exposure to different types of mycotoxins. Copyright © 2016 Elsevier Ltd. All rights reserved.

Detection of combustion start in the controlled auto ignition engine by wavelet transform of the engine block vibration signal

International Nuclear Information System (INIS)

Kim, Seonguk; Min, Kyoungdoug

2008-01-01

The CAI (controlled auto ignition) engine ignites fuel and air mixture by trapping high temperature burnt gas using a negative valve overlap. Due to auto ignition in CAI combustion, efficiency improvements and low level NO x emission can be obtained. Meanwhile, the CAI combustion regime is restricted and control parameters are limited. The start of combustion data in the compressed ignition engine are most critical for controlling the overall combustion. In this research, the engine block vibration signal is transformed by the Meyer wavelet to analyze CAI combustion more easily and accurately. Signal acquisition of the engine block vibration is a more suitable method for practical use than measurement of in-cylinder pressure. A new method for detecting combustion start in CAI engines through wavelet transformation of the engine block vibration signal was developed and results indicate that it is accurate enough to analyze the start of combustion. Experimental results show that wavelet transformation of engine block vibration can track the start of combustion in each cycle. From this newly developed method, the start of combustion data in CAI engines can be detected more easily and used as input data for controlling CAI combustion

Detection of combustion start in the controlled auto ignition engine by wavelet transform of the engine block vibration signal

Science.gov (United States)

Kim, Seonguk; Min, Kyoungdoug

2008-08-01

The CAI (controlled auto ignition) engine ignites fuel and air mixture by trapping high temperature burnt gas using a negative valve overlap. Due to auto ignition in CAI combustion, efficiency improvements and low level NOx emission can be obtained. Meanwhile, the CAI combustion regime is restricted and control parameters are limited. The start of combustion data in the compressed ignition engine are most critical for controlling the overall combustion. In this research, the engine block vibration signal is transformed by the Meyer wavelet to analyze CAI combustion more easily and accurately. Signal acquisition of the engine block vibration is a more suitable method for practical use than measurement of in-cylinder pressure. A new method for detecting combustion start in CAI engines through wavelet transformation of the engine block vibration signal was developed and results indicate that it is accurate enough to analyze the start of combustion. Experimental results show that wavelet transformation of engine block vibration can track the start of combustion in each cycle. From this newly developed method, the start of combustion data in CAI engines can be detected more easily and used as input data for controlling CAI combustion.

Inhibition of metastasis, angiogenesis, and tumor growth by Chinese herbal cocktail Tien-Hsien Liquid

International Nuclear Information System (INIS)

Chia, Jean-San; Du, Jia-Ling; Hsu, Wei-Bin; Sun, Andy; Chiang, Chun-Pin; Wang, Won-Bo

2010-01-01

Advanced cancer is a multifactorial disease that demands treatments targeting multiple cellular pathways. Chinese herbal cocktail which contains various phytochemicals may target multiple dys-regulated pathways in cancer cells and thus may provide an alternative/complementary way to treat cancers. Previously we reported that the Chinese herbal cocktail Tien-Hsien Liguid (THL) can specifically induce apoptosis in various cancer cells and have immuno-modulating activity. In this study, we further evaluated the anti-metastatic, anti-angiogenic and anti-tumor activities of THL with a series of in vitro and in vivo experiments. The migration and invasion of cancer cells and endothelial cells was determined by Boyden chamber transwell assays. The effect of THL on pulmonary metastasis was done by injecting CT-26 colon cancer cells intravenously to syngenic mice. The in vitro and in vivo microvessel formation was determined by the tube formation assay and the Matrigel plug assay, respectively. The in vivo anti-tumor effect of THL was determined by a human MDA-MB-231 breast cancer xenograft model. The expression of metalloproteinase (MMP)-2, MMP-9, and urokinase plasminogen activator (uPA) was measured by gelatin zymography. The expression of HIF-1α and the phosphorylation of ERK1/2 were determined by Western blot. THL inhibited the migration and invasion ability of various cancer cells in vitro, decreased the secretion of MMP-2, MMP-9, and uPA and the activity of ERK1/2 in cancer cells, and suppressed pulmonary metastasis of CT-26 cancer cells in syngenic mice. Moreover, THL inhibited the migration, invasion, and tube formation of endothelial cells in vitro, decreased the secretion of MMP-2 and uPA in endothelial cells, and suppressed neovascularization in Matrigel plugs in mice. Besides its inhibitory effect on endothelial cells, THL inhibited hypoxia-induced HIF-1α and vascular endothelial growth factor-A expression in cancer cells. Finally, our results show that THL

Propagation properties of the chirped Airy beams through the gradient-index medium

Science.gov (United States)

Feng, Liyan; Zhang, Jianbin; Pang, Zihao; Wang, Linyi; Zhong, Tianfen; Yang, Xiangbo; Deng, Dongmei

2017-11-01

Through analytical derivation and numerical analysis, the propagation properties of the chirped Airy(CAi) beams in the gradient-index medium are investigated. The intensity and the phase distributions, the propagation trajectory and the Poynting vector of the CAi beams are demonstrated to investigate the propagation properties. Owing to the special and symmetrical refractive index profile of the gradient-index medium, the CAi beams propagate periodically. The effects of the distribution factor and the chirped parameter on the propagation of the CAi beams are analyzed. As the increasing of the distribution factor, the intensity distribution of the CAi beams is more scattering. However, with the chirped parameter increasing, the focusing property of the CAi beams strengthens. The variation of the chirped parameter can change the position of the peak intensity maximum, but it cannot alter the period of the peak intensity. The variations of the initial phase and the energy of the beams in the transverse plane expedite accordingly.

Canine-assisted therapy for children with ADHD: preliminary findings from the positive assertive cooperative kids study.

Science.gov (United States)

Schuck, Sabrina E B; Emmerson, Natasha A; Fine, Aubrey H; Lakes, Kimberley D

2015-02-01

The objective of this study was to provide preliminary findings from an ongoing randomized clinical trial using a canine-assisted intervention (CAI) for 24 children with ADHD. Project Positive Assertive Cooperative Kids (P.A.C.K.) was designed to study a 12-week cognitive-behavioral intervention delivered with or without CAI. Children were randomly assigned to group therapy with or without CAI. Parents of children in both groups simultaneously participated in weekly parent group therapy sessions. Across both treatment groups, parents reported improvements in children's social skills, prosocial behaviors, and problematic behaviors. In both groups, the severity of ADHD symptoms declined during the course of treatment; however, children who received the CAI model exhibited greater reductions in the severity of ADHD symptoms than did children who received cognitive-behavioral therapy without CAI. Results suggest that CAI offers a novel therapeutic strategy that may enhance cognitive-behavioral interventions for children with ADHD. © 2013 SAGE Publications.

182Hf-182W age dating of a 26Al-poor inclusion and implications for the origin of short-lived radioisotopes in the early Solar System.

Science.gov (United States)

Holst, Jesper C; Olsen, Mia B; Paton, Chad; Nagashima, Kazuhide; Schiller, Martin; Wielandt, Daniel; Larsen, Kirsten K; Connelly, James N; Jørgensen, Jes K; Krot, Alexander N; Nordlund, Ake; Bizzarro, Martin

2013-05-28

Refractory inclusions [calcium-aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., (26)Al, (41)Ca, and (182)Hf) synthesized in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed with the canonical abundance of (26)Al corresponding to (26)Al/(27)Al of ∼5 × 10(-5), rare CAIs with fractionation and unidentified nuclear isotope effects (FUN CAIs) record nucleosynthetic isotopic heterogeneity and (26)Al/(27)Al of Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the (182)Hf-(182)W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with (26)Al/(27)Al of ∼3 × 10(-6). The decoupling between (182)Hf and (26)Al requires distinct stellar origins: steady-state galactic stellar nucleosynthesis for (182)Hf and late-stage contamination of the protosolar molecular cloud by a massive star(s) for (26)Al. Admixing of stellar-derived (26)Al to the protoplanetary disk occurred during the epoch of CAI formation and, therefore, the (26)Al-(26)Mg systematics of CAIs cannot be used to define their formation interval. In contrast, our results support (182)Hf homogeneity and chronological significance of the (182)Hf-(182)W clock.

Chronic Ankle Instability and Neural Excitability of the Lower Extremity.

Science.gov (United States)

McLeod, Michelle M; Gribble, Phillip A; Pietrosimone, Brian G

2015-08-01

Neuromuscular dysfunction of the leg and thigh musculature, including decreased strength and postural control, is common in patients with chronic ankle instability (CAI). Understanding how CAI affects specific neural pathways may provide valuable information for targeted therapies. To investigate differences in spinal reflexive and corticospinal excitability of the fibularis longus and vastus medialis between limbs in patients with unilateral CAI and between CAI patients and participants serving as healthy controls. Case-control study. Research laboratory. A total of 56 participants volunteered, and complete data for 21 CAI patients (9 men, 12 women; age = 20.81 ± 1.63 years, height = 171.57 ± 11.44 cm, mass = 68.84 ± 11.93 kg) and 24 healthy participants serving as controls (7 men, 17 women; age = 22.54 ± 2.92 years, height = 172.35 ± 10.85 cm, mass = 69.15 ± 12.30 kg) were included in the final analyses. Control participants were matched to CAI patients on sex, age, and limb dominance. We assigned "involved" limbs, which corresponded with the involved limbs of the CAI patients, to control participants. Spinal reflexive excitability was assessed via the Hoffmann reflex and normalized to a maximal muscle response. Corticospinal excitability was assessed using transcranial magnetic stimulation. Active motor threshold (AMT) was defined as the lowest transcranial magnetic stimulation intensity required to elicit motor-evoked potentials equal to or greater than 100 μV in 5 of 10 consecutive stimuli. We obtained motor-evoked potentials (MEPs) at percentages ranging from 100% to 140% of AMT. Fibularis longus MEP amplitudes were greater in control participants than in CAI patients bilaterally at 100% AMT (control involved limb: 0.023 ± 0.031; CAI involved limb: 0.014 ± 0.008; control uninvolved limb: 0.021 ± 0.022; CAI uninvolved limb: 0.015 ± 0.007; F1,41 = 4.551, P = .04) and 105% AMT (control involved limb: 0.029 ± 0.026; CAI involved limb: 0.021 ± 0

Effect of the muon component of cosmic rays on the results of hadron experiments with the big ionization calorimeter (BIC) of the Tien Shan station

Energy Technology Data Exchange (ETDEWEB)

Bogdanov, A. G., E-mail: AGBogdanov@mephi.ru; Kokoulin, R. P.; Petrukhin, A. A.; Shalabaeva, A. V. [Moscow Engineering Physics Institute (State University) (Russian Federation); Yakovlev, V. I. [Russian Academy of Sciences, Lebedev Institute of Physics (Russian Federation)

2008-01-15

A full-scale simulation of the response of the big ionization calorimeter (BIC) at the Tien Shan station to the passage of single protons and muons was performed on the basis of the GEANT4 package in order to estimate the contribution of the muon cosmic-ray component to the generation of unusual events (such as Anti-Centauros), which were recorded by this facility, and to the imitation of the long-flying component, which changes the shape of the average cascade curve. A comparison of the results of this simulation with experimental data reveals that the appearance of Anti-Centauros may be reasonably explained by the contribution of multiple interactions of single muons, but that muon events are insufficient for explaining the change in the shape of the cascade curve (in particular, the emergence of a second maximum).

Effects of 1,25-Dihydroxycholecalciferol on Recovery and Resolution of Late Transient Neonatal Hypocalcemia

Directory of Open Access Journals (Sweden)

Lefkothea Karaviti

2010-01-01

Full Text Available Background. Late transient neonatal hypocalcemia with hyperphosphatemia is potentially life-threatening. The use of 1.25 dihydroxycholecalciferol in the management of neonatal hypocalcemia is unexplored. Objective. We hypothesized adding 1.25 dihydroxycholecalciferol to intravenous continuous calcium infusion (CaI will achieve accelerated correction of hypocalcemia. Design/Methods. A controlled double-blind randomized placebo group was organized to compare the addition of 1.25 dihydroxycholecalciferol to CaI in 3–14 day old neonates presenting with hypocalcemia, hyperphosphatemia and seizures. Ionized calcium and phosphorus were measured to adjust CaI and maintain eucalcemia. Time to resolution of hypocalcemia was defined as time from starting CaI to the first ionized calcium of ≥1.1 mmol/L. CaI was discontinued when ionized calcium levels were ≥1.1 mmol/L on two measurements and the infant tolerated feeds. Results. Fourteen neonates were studied without statistical difference between groups. Time to correction of hypocalcemia for 1,25 dihydroxycholecalciferol versus placebo was 7.2 ± 1.9 versus 11.5 ± 3.4 hours respectively (p=.26. The duration of CaI was 15.0 ± 1.5 versus 24.8 ± 4.4 hours respectively (p=.012. Conclusions. The addition of 1.25 dihydroxycholecalciferol to standard CaI therapy reduced the duration of CaI, but did not reduce the time to correct hypocalcemia in neonates with late transient hypocalcemia.

New directions in e-learning research in health professions education: Report of two symposia.

Science.gov (United States)

Triola, Marc M; Huwendiek, Sören; Levinson, Anthony J; Cook, David A

2012-01-01

The use of Computer Assisted Instruction (CAI) is rising across health professions education. Research to date is of limited use in guiding the implementation and selection of CAI innovations. In the context of two symposia, systemic reviews were discussed that evaluate literature in Internet-based learning, Virtual Patients, and animations. Each session included a debate with the goal of reaching consensus on best current practices and future research. Thematic analysis of the discussions was performed to arrange the questions by theme, eliminate redundancy, and craft them into a cohesive narrative. The question analysis revealed that there are clear advantages to the use of CAI, and that established educational theories should certainly inform the future development and selection of CAI tools. Schools adopting CAI need to carefully consider the benefits, cost, available resources, and capacity for teachers and learners to accept change in their practice of education. Potential areas for future research should focus on the effectiveness of CAI instructional features, integration of e-learning into existing curricula and with other modalities like simulation, and the use of CAI in assessment of higher-level outcomes. There are numerous opportunities for future research and it will be important to achieve consensus on important themes.

KAPSE Interface Team (KIT) Public Report. Volume 8, Part 1

Science.gov (United States)

1989-10-01

visitors were introduced. Mike Tedd of the University of Wales represented the United Kingdom on the KIT for Sue Bond , who will be the primary...CAIS subprogram callable by APSE tools.I 2.1 Scope of the CAIS. The CAIS shall provide interfaces sufficient to support the use of APSEs for wide

Dynamic ankle control in athletes with ankle instability during sports maneuvers.

Science.gov (United States)

Lin, Cheng-Feng; Chen, Chin-Yang; Lin, Chia-Wei

2011-09-01

Ankle sprain is a common sports injury. While the effects of static constraints in stabilizing the ankle joint are relatively well understood, those of dynamic constraints are less clear and require further investigation. This study was undertaken to evaluate the dynamic stability of the ankle joint during the landing phase of running and stop-jump maneuvers in athletes with and without chronic ankle instability (CAI). Controlled laboratory study. Fifteen athletes with CAI and 15 age-matched athletes without CAI performed running and stop-jump landing tasks. The dynamic ankle joint stiffness, tibialis anterior (TA)/peroneus longus (PL) and TA/gastrocnemius lateralis (GL) co-contraction indices, ankle joint angle, and root-mean-square (RMS) of the TA, PL, and GL electromyographic signals were measured during each task. During running, the CAI group exhibited a greater ankle inversion angle than the control group in the pre-landing phase (P = .012-.042) and a lower dynamic ankle joint stiffness in the post-landing phase (CAI: 0.109 ± 0.039 N·m/deg; control: 0.150 ± 0.068 N·m/deg; P = .048). In the stop-jump landing task, athletes with CAI had a significantly lower TA/PL co-contraction index during the pre-landing phase (CAI: 49.1 ± 19; control: 64.8 ± 16; P = .009). In addition, the CAI group exhibited a greater ankle inversion (P = .049), a lower peak eversion (P = .04), and a smaller RMS of the PL electromyographic signal in the post-landing phase (CAI: 0.73 ± 0.32; control: 0.51 ± 0.22; P = .04). Athletes with CAI had a relatively inverted ankle, reduced muscle co-contraction, and a lower dynamic stiffness in the ankle joint during the landing phase of sports maneuvers and this may jeopardize the stability of the ankle. Sports training or rehabilitation programs should differentiate between the pre-landing and post-landing phases of sports maneuvers, and should educate athletes to land with an appropriate ankle position and muscle recruitment.

Comparison of post-cervical and cervical porcine artificial insemination in nulliparous and multiparous

Directory of Open Access Journals (Sweden)

Luchetti CG

2016-12-01

Full Text Available The post-cervical artificial insemination (PCAI in sows increases semen performance compared to cervical artificial insemination (CAI. In Argentina the use of the PCAI is restricted to multiparous while it is not applied to nulliparous. The aim of this study was to compare porcine CAI and PCAI in nulliparous and multiparous. Pregnancy rates and number of live pups with CAI and PCAI in nulliparous and multiparous, assessing advantages and disadvantages of each method were compared. This is a small-scale work (4 CAI and 7 PCAI in nulliparous, 3 CAI and 3 PCAI in multiparous in a small field productive site in the Province of Buenos Aires. Here the boar was omitted for heat detection and to stimulate the sow during AI. Pregnancy rates and the number of pups born alive per pregnant sow were similar with the two techniques and two categories. The PCAI is a good practice in nulliparous and multiparous because this technique increases semen performance compared to CAI and it is omitted the presence of the boar.

Evidence for Widespread 26Al in the Solar Nebula and Constraints for Nebula Time Scales

Science.gov (United States)

Russell; Srinivasan; Huss; Wasserburg; MacPherson

1996-08-09

A search was made for 26Mg (26Mg*) from the decay of 26Al (half-life = 0.73 million years) in Al-rich objects from unequilibrated ordinary chondrites. Two Ca-Al-rich inclusions (CAIs) and two Al-rich chondrules (not CAIs) were found that contained 26Al when they formed. Internal isochrons for the CAIs yielded an initial 26Al/27Al ratio [(26Al/27Al)0] of 5 x 10(-5), indistinguishable from most CAIs in carbonaceous chondrites. This result shows that CAIs with this level of 26Al are present throughout the classes of chondrites and strengthens the notion that 26Al was widespread in the early solar system. The two Al-rich chondrules have lower 26Mg*, corresponding to a (26Al/27Al)0 ratio of approximately 9 x 10(-6). Five other Al-rich chondrules contain no resolvable 26Mg*. If chondrules and CAIs formed from an isotopically homogeneous reservoir, then the chondrules with 26Al must have formed or been last altered approximately2 million years after CAIs formed; the 26Mg*-free chondrules formed >1 to 3 million years later still. Because 26Mg*-containing and 26Mg*-free chondrules are both found in Chainpur, which was not heated to more than approximately400°C, it follows that parent body metamorphism cannot explain the absence of 26Mg* in some of these chondrules. Rather, its absence indicates that the lifetime of the solar nebula over which CAIs and chondrules formed extended over approximately5 million years.

Inhibition of metastasis, angiogenesis, and tumor growth by Chinese herbal cocktail Tien-Hsien Liquid

Directory of Open Access Journals (Sweden)

Sun Andy

2010-04-01

Full Text Available Abstract Background Advanced cancer is a multifactorial disease that demands treatments targeting multiple cellular pathways. Chinese herbal cocktail which contains various phytochemicals may target multiple dys-regulated pathways in cancer cells and thus may provide an alternative/complementary way to treat cancers. Previously we reported that the Chinese herbal cocktail Tien-Hsien Liguid (THL can specifically induce apoptosis in various cancer cells and have immuno-modulating activity. In this study, we further evaluated the anti-metastatic, anti-angiogenic and anti-tumor activities of THL with a series of in vitro and in vivo experiments. Methods The migration and invasion of cancer cells and endothelial cells was determined by Boyden chamber transwell assays. The effect of THL on pulmonary metastasis was done by injecting CT-26 colon cancer cells intravenously to syngenic mice. The in vitro and in vivo microvessel formation was determined by the tube formation assay and the Matrigel plug assay, respectively. The in vivo anti-tumor effect of THL was determined by a human MDA-MB-231 breast cancer xenograft model. The expression of metalloproteinase (MMP-2, MMP-9, and urokinase plasminogen activator (uPA was measured by gelatin zymography. The expression of HIF-1α and the phosphorylation of ERK1/2 were determined by Western blot. Results THL inhibited the migration and invasion ability of various cancer cells in vitro, decreased the secretion of MMP-2, MMP-9, and uPA and the activity of ERK1/2 in cancer cells, and suppressed pulmonary metastasis of CT-26 cancer cells in syngenic mice. Moreover, THL inhibited the migration, invasion, and tube formation of endothelial cells in vitro, decreased the secretion of MMP-2 and uPA in endothelial cells, and suppressed neovascularization in Matrigel plugs in mice. Besides its inhibitory effect on endothelial cells, THL inhibited hypoxia-induced HIF-1α and vascular endothelial growth factor-A expression

Odd Bed-fellows: British Christians and Communists in the Struggle for Peace D’étranges compagnons : chrétiens et communistes britanniques dans la lutte pour la paix

Directory of Open Access Journals (Sweden)

Jeremy Tranmer

2011-04-01

Full Text Available Au début des années 1950, le doyen de l’archevêché de Cantorbéry œuvra au sein du mouvement pour la paix et participa à des activités organisées par le parti communiste britannique. En 1983, le prêtre catholique Bruce Kent, leader de la Campagne pour le Désarmement Nucléaire, loua l’engagement des communistes britanniques en faveur de la paix. Cet article cherche à examiner pourquoi et comment chrétiens et communistes surmontèrent leurs différences et coopérèrent dans la lutte contre l’arme nucléaire.

The cardiac anesthetic index of isoflurane in green iguanas.

Science.gov (United States)

Mosley, Craig A E; Dyson, Doris; Smith, Dale A

2003-06-01

To determine the cardiac anesthetic index (CAI) of isoflurane in green iguanas and whether butorphanol affected the CAI. Prospective randomized controlled trial. 7 healthy mature iguanas. In 5 iguanas, CAI was determined after induction of anesthesia with isoflurane alone, and in 5 iguanas, CAI was determined after induction of anesthesia with isoflurane and IM administration of butorphanol (1 mg/kg [0.45 mg/lb]). Three iguanas underwent both treatments. Animals were equilibrated for 20 minutes at 1.5 times the minimum alveolar concentration (MAC) of isoflurane and observed for evidence of cardiovascular arrest. If there was no evidence of cardiovascular arrest, end-tidal isoflurane concentration was increased by 20%, and animals were allowed to equilibrate for another 20 minutes. This process was repeated until cardiovascular arrest occurred or vaporizer output could no longer be consistently increased. The CAI was calculated by dividing the highest end-tidal isoflurane concentration by the MAC. None of the iguanas developed cardiovascular arrest and all survived. Mean +/- SD highest end-tidal isoflurane concentration during anesthesia with isoflurane alone (9.2 +/- 0.60%) was not significantly different from mean concentration during anesthesia with isoflurane and butorphanol (9.0 +/- 0.43%). The CAI was > 4.32. Results suggest that the CAI of isoflurane in green iguanas is > 4.32 and not affected by administration of butorphanol. Isoflurane appears to be a safe anesthetic in green iguanas.

Diameter dependent electron transfer kinetics in semiconductor-enzyme complexes.

Science.gov (United States)

Brown, Katherine A; Song, Qing; Mulder, David W; King, Paul W

2014-10-28

Excited state electron transfer (ET) is a fundamental step for the catalytic conversion of solar energy into chemical energy. To understand the properties controlling ET between photoexcited nanoparticles and catalysts, the ET kinetics were measured for solution-phase complexes of CdTe quantum dots and Clostridium acetobutylicum [FeFe]-hydrogenase I (CaI) using time-resolved photoluminescence spectroscopy. Over a 2.0-3.5 nm diameter range of CdTe nanoparticles, the observed ET rate (kET) was sensitive to CaI concentration. To account for diameter effects on CaI binding, a Langmuir isotherm and two geometric binding models were created to estimate maximal CaI affinities and coverages at saturating concentrations. Normalizing the ET kinetics to CaI surface coverage for each CdTe diameter led to k(ET) values that were insensitive to diameter, despite a decrease in the free energy for photoexcited ET (ΔGET) with increasing diameter. The turnover frequency (TOF) of CaI in CdTe-CaI complexes was measured at several molar ratios. Normalization for diameter-dependent changes in CaI coverage showed an increase in TOF with diameter. These results suggest that k(ET) and H2 production for CdTe-CaI complexes are not strictly controlled by ΔG(ET) and that other factors must be considered.

Spatiotemporal postural control deficits are present in those with chronic ankle instability

Directory of Open Access Journals (Sweden)

McKeon Patrick O

2008-06-01

Full Text Available Abstract Background Postural control deficits have been purported to be a potential contributing factor in chronic ankle instability (CAI. Summary forceplate measures such as center of pressure velocity and area have not consistently detected postural control deficits associated with CAI. A novel measurement technique derived from the dynamical systems theory of motor control known as Time-to-boundary (TTB has shown promise in detecting deficits in postural control related to chronic ankle instability (CAI. In a previous study, TTB deficits were detected in a sample of females with CAI. The purpose of this study was to examine postural control in sample of males and females with and without CAI using TTB measures. Methods This case-control study was performed in a research laboratory. Thirty-two subjects (18 males, 14 females with self-reported CAI were recruited and matched to healthy controls. All subjects performed three, ten-second trials of single-limb stance on a forceplate with eyes open and eyes closed. Main outcome measures included the TTB absolute minimum (s, mean of TTB minima (s, and standard deviation of TTB minima (s in the anteroposterior and mediolateral directions. A series of group by gender analyses of variance were conducted to evaluate the differences in postural control for all TTB variables separately with eyes open and eyes closed. Results There were no significant group by gender interactions or gender main effects for any of the measures. There, however, significant group main effects for 4 of the 6 measures with eyes closed as the CAI group demonstrated significant deficits in comparison to the control group. There were no significant differences between groups in any of the TTB measures with eyes open. Conclusion TTB deficits were present in the CAI group compared to the control group. These deficits were detected with concurrent removal of visual input. CAI may place significantly greater constraints on the

182Hf-182W age dating of a 26Al-poor inclusion and implications for the origin of short-lived radioisotopes in the early Solar System

DEFF Research Database (Denmark)

Holst, Jesper Christian; Olsen, Mia Bjørg Stolberg; Paton, Chad

2013-01-01

provide a unique window into the earliest Solar System, including the origin of short-lived radioisotopes. However, their chronology is unknown. Using the 182Hf–182W chronometer, we show that a FUN CAI recording a condensation origin from a solar gas formed coevally with canonical CAIs, but with 26Al/27Al......Refractory inclusions [calcium–aluminum-rich inclusions, (CAIs)] represent the oldest Solar System solids and provide information regarding the formation of the Sun and its protoplanetary disk. CAIs contain evidence of now extinct short-lived radioisotopes (e.g., 26Al, 41Ca, and 182Hf) synthesized...... in one or multiple stars and added to the protosolar molecular cloud before or during its collapse. Understanding how and when short-lived radioisotopes were added to the Solar System is necessary to assess their validity as chronometers and constrain the birthplace of the Sun. Whereas most CAIs formed...

Ready, set,...quit exclamation point A review of the controlled-air incinerator

International Nuclear Information System (INIS)

Reader, G.E.

1996-01-01

The Los Alamos National Laboratory (LANL) Controlled-Air Incinerator (CAI) has had a long and productive past as a research and development tool. It now appears that use of the CAI to treat LANL legacy and other wastes under the Federal Facilities Compliance Act is no longer viable due to numerous programmatic problems. This paper will review the history of the CAI. Various aspects associated with the CAI and how those aspects resulted in the loss of this Department of Energy asset as a viable waste treatment option will also be discussed. Included are past missions and tests-CAI capabilities, emissions, and permits; Federal Facility Compliance Act and associated Agreement; National Environmental Policy Act coverage; cost; budget impacts; public perception; the U.S. Environmental Protection Agency Combustion Strategy; Independent Technical Review open-quotes Redclose quotes Team review; waste treatment alternative technologies; the New Mexico Environment Department; and future options and issues

Increases in cellular calcium concentration stimulate pepsinogen secretion from dispersed chief cells

International Nuclear Information System (INIS)

Raufman, J.P.; Berger, S.; Cosowsky, L.; Straus, E.

1986-01-01

Intracellular calcium concentration ([Ca]i) and pepsinogen secretion from dispersed chief cells from guinea pig stomach were determined before and after stimulation with calcium ionophores. [Ca]i was measured using the fluorescent probe quin2. Basal [Ca]i was 105 +/- 4 nM. Pepsinogen secretion was measured with a new assay using 125 I-albumin substrate. This assay is 1000-fold more sensitive than the widely-used spectrophotometric assay, technically easy to perform, rapid, and relatively inexpensive. The kinetics and stoichiometry of ionophore-induced changes in [Ca]i and pepsinogen secretion were similar. These data support a role for calcium as a cellular mediator of pepsinogen secretion

Computer based training for nuclear operations personnel: From concept to reality

International Nuclear Information System (INIS)

Widen, W.C.; Klemm, R.W.

1986-01-01

Computer Based Training (CBT) can be subdivided into two categories: Computer Aided Instruction (CAI), or the actual presentation of learning material; and Computer Managed Instruction (CMI), the tracking, recording, and documenting of instruction and student progress. Both CAI and CMI can be attractive to the student and to the training department. A brief overview of CAI and CMI benefits is given in this paper

Evaluación del nivel del conocimiento que tiene el personal de enfermería sobre la guía de manejo de Trastorno Afectivo Bipolar (TAB

Directory of Open Access Journals (Sweden)

Lady Lizcano

2011-12-01

Full Text Available El Trastorno Afectivo Bipolar (TAB ocupa el primer lugar de las quince primeras causas por consulta externa en el año 2009 con 1.423 casos sobre un total de 7.177 consultas. La investigación realizada tiene como objetivo determinar el nivel de conocimiento del personal de enfermería que labora en una Empresa Social del Estado especializado en psiquiatría. La prevalencia de esta patología hace relevante la evaluación de la guía del Trastorno Afectivo Bipolar (TAB. El instrumento utilizado fue aplicado a 52 trabajadores de la institución, arrojando como resultado un bajo nivel de conocimiento con relación a la aplicación guía de atención de enfermería de manejo para el paciente con Trastorno Afectivo Bipolar (TAB.

Coded aperture imaging of alpha source spatial distribution

International Nuclear Information System (INIS)

Talebitaher, Alireza; Shutler, Paul M.E.; Springham, Stuart V.; Rawat, Rajdeep S.; Lee, Paul

2012-01-01

The Coded Aperture Imaging (CAI) technique has been applied with CR-39 nuclear track detectors to image alpha particle source spatial distributions. The experimental setup comprised: a 226 Ra source of alpha particles, a laser-machined CAI mask, and CR-39 detectors, arranged inside a vacuum enclosure. Three different alpha particle source shapes were synthesized by using a linear translator to move the 226 Ra source within the vacuum enclosure. The coded mask pattern used is based on a Singer Cyclic Difference Set, with 400 pixels and 57 open square holes (representing ρ = 1/7 = 14.3% open fraction). After etching of the CR-39 detectors, the area, circularity, mean optical density and positions of all candidate tracks were measured by an automated scanning system. Appropriate criteria were used to select alpha particle tracks, and a decoding algorithm applied to the (x, y) data produced the de-coded image of the source. Signal to Noise Ratio (SNR) values obtained for alpha particle CAI images were found to be substantially better than those for corresponding pinhole images, although the CAI-SNR values were below the predictions of theoretical formulae. Monte Carlo simulations of CAI and pinhole imaging were performed in order to validate the theoretical SNR formulae and also our CAI decoding algorithm. There was found to be good agreement between the theoretical formulae and SNR values obtained from simulations. Possible reasons for the lower SNR obtained for the experimental CAI study are discussed.

Tectono-thermal evolution in a region with thin-skinned tectonics: the western nappes in the Cantabrian Zone (Variscan belt of NW Spain)

Science.gov (United States)

Bastida, F.; Brime, C.; García-López, S.; Sarmiento, G. N.

The palaeotemperature distribution in the transition from diagenesis to metamorphism in the western nappes of the Cantabrian Zone (Somiedo, La Sobia and Aramo Units) are analysed by conodont colour alteration index (CAI) and illite crystallinity (IC). Structural and stratigraphic control in distribution of CAI and IC values is observed. Both CAI and IC value distributions show that anchizonal conditions are reached in the lower part of the Somiedo Unit. A disruption of the thermal trend by basal thrusts is evidenced by CAI and IC values. There is an apparent discrepancy between the IC and CAI values in Carboniferous rocks of the Aramo Unit; the IC has mainly anchizonal values, whereas the CAI has diagenetic values. Discrepant IC values are explained as a feature inherited from the source area. In the Carboniferous rocks of the La Sobia Unit, both IC and CAI indicate diagenetic conditions. The anchimetamorphism predated completion of emplacement of the major nappes; it probably developed previously and/or during the early stages of motion of the units. Temperature probably decreased when the metamorphosed zones of the sheets rose along ramps and were intensely eroded. In the context of the Iberian Variscan belt, influence of tectonic factors on the metamorphism is greater in the internal parts, where the strain and cleavage are always present, than in the external parts (Cantabrian Zone), where brittle deformation and rock translation are dominant, with an increasing role of the burial on the metamorphism.

Reseña de: Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XVe-XVIe siècles.Villeneuve d’Ascq...

Directory of Open Access Journals (Sweden)

Enrique Cantera Montenegro

2017-05-01

Full Text Available Caselli, Elisa, Antijudaïsme, pouvoir politique et administration de la justice. Juifs, chrétiens et converts dans l’ espace jurisdictionnel de la Chancillería de Valladolid (XV^e-XVI^e siècles. Villeneuve d’Ascq Cedex. Atelier National de Reproduction des Thèses, 2016. 396 págs. isbn: 978-2-7295-8891-5.

Corundum-Hibonite Inclusions and the Environments of High Temperature Processing in the Early Solar System

Science.gov (United States)

Needham, A. W.; Messenger, S.

2013-01-01

Calcium, Aluminum-rich inclusions (CAIs) are composed of the suite of minerals predicted to be the first to condense from a cooling gas of solar composition [1]. Yet, the first phase to condense, corundum, is rare in CAIs, having mostly reacted to form hibonite followed by other phases at lower temperatures. Many CAIs show evidence of complex post-formational histories, including condensation, evaporation, and melting [e.g. 2, 3]. However, the nature of these thermal events and the nebular environments in which they took place are poorly constrained. Some corundum and corundum-hibonite grains appear to have survived or avoided these complex CAI reprocessing events. Such ultra-refractory CAIs may provide a clearer record of the O isotopic composition of the Sun and the evolution of the O isotopic composition of the planet-forming region [4-6]. Here we present in situ O and Mg isotopic analyses of two corundum/hibonite inclusions that record differing formation histories.

Publications | Page 232 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

O cerco flutuante e os caiçaras do litoral norte de São Paulo, com ênfase à pesca de trindade, RJ (open access). O cerco flutuante, armadilha fixa de pesca, é utilizado por caiçaras do litoral sudeste do Brasil na pesca artesanal. Essa técnica faz parte de um conjunto de influências históricas que formou a cultura caiçara e ...

Effect of metabolic and respiratory acidosis on intracellular calcium in osteoblasts.

Science.gov (United States)

Frick, Kevin K; Bushinsky, David A

2010-08-01

In vivo, metabolic acidosis {decreased pH from decreased bicarbonate concentration ([HCO(3)(-)])} increases urine calcium (Ca) without increased intestinal Ca absorption, resulting in a loss of bone Ca. Conversely, respiratory acidosis [decreased pH from increased partial pressure of carbon dioxide (Pco(2))] does not appreciably alter Ca homeostasis. In cultured bone, chronic metabolic acidosis (Met) significantly increases cell-mediated net Ca efflux while isohydric respiratory acidosis (Resp) does not. The proton receptor, OGR1, appears critical for cell-mediated, metabolic acid-induced bone resorption. Perfusion of primary bone cells or OGR1-transfected Chinese hamster ovary (CHO) cells with Met induces transient peaks of intracellular Ca (Ca(i)). To determine whether Resp increases Ca(i), as does Met, we imaged Ca(i) in primary cultures of bone cells. pH for Met = 7.07 ([HCO(3)(-)] = 11.8 mM) and for Resp = 7.13 (Pco(2) = 88.4 mmHg) were similar and lower than neutral (7.41). Both Met and Resp induced a marked, transient increase in Ca(i) in individual bone cells; however, Met stimulated Ca(i) to a greater extent than Resp. We used OGR1-transfected CHO cells to determine whether OGR1 was responsible for the greater increase in Ca(i) in Met than Resp. Both Met and Resp induced a marked, transient increase in Ca(i) in OGR1-transfected CHO cells; however, in these cells Met was not different than Resp. Thus, the greater induction of Ca(i) by Met in primary bone cells is not a function of OGR1 alone, but must involve H(+) receptors other than OGR1, or pathways sensitive to Pco(2), HCO(3)(-), or total CO(2) that modify the effect of H(+) in primary bone cells.

The discriminant validity of the culture assessment instrument: A comparison of company sub-cultures

Directory of Open Access Journals (Sweden)

Leo Petkoon

2004-10-01

Full Text Available The primary purpose of this study was to assess the discriminant validity of the Culture Assessment Instrument (CAI; that is to distinguish between company mean sub-culture scores and between mean scores of a target company and that of a norm group. The primary data was obtained by a sample of convenience (N = 593 from a transport organisation. The secondary data of the norm group was constituted by convenience samples (N = 4066 from various companies originating from different industries. The 56 item scores of the CAI were factor analysed on two levels followed by iterative item analyses. Although significant differences were detected between mean culture scores, only a small proportion of the variance in these scores could be attributed to culture differences. On these grounds, the CAI does not possess discriminant validity. Suggestions for improving the CAI were made. Opsomming Die primêre doel van die studie was om die diskriminante geldigheid van die ‘Culture Assessment Instrument’ (CAI te beoordeel; dit is om tussen ondernemings se gemiddelde kultuur-subtelling te onderskei en tussen die gemiddelde tellings van ‘n teiken onderneming en ’n normgroep. Die primêre data is verkry van ’n geleentheidsteekproef (N = 593 uit ’n transport-onderneming. Die sekondêre data van die normgroep is saamgestel uit geleentheidsteekproewe (N = 4066 van verskillende ondernemings afkomstig uit verskeie industrieë. Die 56 itemtellings van die CAI is op twee vlakke gefaktoranaliseer, gevolg deur iteratiewe itemontledings. Ofskoon beduidende verskille tussen gemiddelde kultuurtellings gevind is, kon slegs ’n klein proporsie van die variansie in die tellings aan kultuurverskille toegeskryf word. Op hierdie gronde beskik die CAI nie oor diskriminante geldigheid nie. Voorstelle ter verbetering van die CAI is gemaak.

Deviations in gait metrics in patients with chronic ankle instability: a case control study.

Science.gov (United States)

Gigi, Roy; Haim, Amir; Luger, Elchanan; Segal, Ganit; Melamed, Eyal; Beer, Yiftah; Nof, Matityahu; Nyska, Meir; Elbaz, Avi

2015-01-01

Gait metric alterations have been previously reported in patients suffering from chronic ankle instability (CAI). Previous studies of gait in this population have been comprised of relatively small cohorts, and the findings of these studies are not uniform. The objective of the present study was to examine spatiotemporal gait metrics in patients with CAI and examine the relationship between self-reported disease severity and the magnitude of gait abnormalities. Forty-four patients with CAI were identified and compared to 53 healthy controls. Patients were evaluated with spatiotemporal gait analysis via a computerized mat and with the Short Form (SF) - 36 health survey. Patients with CAI were found to walk with approximately 16% slower walking velocity, 9% lower cadence and approximately 7% lower step length. Furthermore, the base of support, during walking, in the CAI group was approximately 43% wider, and the single limb support phase was 3.5% shorter compared to the control group. All of the SF-36 8-subscales, as well as the SF-36 physical component summary and SF-36 mental component summary, were significantly lower in patients with CAI compared to the control group. Finally, significant correlations were found between most of the objective gait measures and the SF-36 mental component summary and SF-36 physical component summary. The results outline a gait profile for patients suffering from CAI. Significant differences were found in most spatiotemporal gait metrics. An important finding was a significantly wider base of support. It may be speculated that these gait alterations may reflect a strategy to deal with imbalance and pain. These findings suggest the usefulness of gait metrics, alongside with the use of self-evaluation questionnaires, in assessing disease severity of patients with CAI.

Population genetic diversity and structure analysis of wild apricot (Prunus armeniaca L.) revealed by ssr markers in the Tien-Shan mountains of China

International Nuclear Information System (INIS)

Hu, X.; Ni, B.; Zheng, P.; Li, M.

2018-01-01

The simple sequence repeat markers were used to investigate the population genetic diversity and structure of 212 germplasm samples from 14 apricot (Prunus armeniaca) populations in the western of Tien-Shan Mountains, Sinkiang, China. The relatively high expected heterozygosity and Shannon's diversity index indicated the apricot populations maintained a high level of genetic diversity (He = 0.6109, I = 1.2208), with the population in Tuergen ditch of Xinyuan County having the highest genetic diversity index. A high level of intra-population genetic differentiation (91.51%) and a lower level of inter-population genetic differentiation were occurred, as well as a moderate but steady inter-population gene flow (Nm = 2.3735). The self-incompatible pattern, wide distribution, and long-distance pollen transmission via insects and gale are the main factors underlying the genetic variation structure. The UPGMA cluster analysis and genetic structure analysis showed that apricot germplasm could be divided into two or four groups, which was basically consistent with the geographic distribution pattern. The inter-population genetic distance and geographic distance showed a significant correlation (r = 0.2658, p<0.05). (author)

Oxygen isotope exchange between refractory inclusion in allende and solar nebula Gas

Science.gov (United States)

Yurimoto; Ito; Nagasawa

1998-12-04

A calcium-aluminum-rich inclusion (CAI) from the Allende meteorite was analyzed and found to contain melilite crystals with extreme oxygen-isotope compositions ( approximately 5 percent oxygen-16 enrichment relative to terrestrial oxygen-16). Some of the melilite is also anomalously enriched in oxygen-16 compared with oxygen isotopes measured in other CAIs. The oxygen isotopic variation measured among the minerals (melilite, spinel, and fassaite) indicates that crystallization of the CAI started from oxygen-16-rich materials that were probably liquid droplets in the solar nebula, and oxygen isotope exchange with the surrounding oxygen-16-poor nebular gas progressed through the crystallization of the CAI. Additional oxygen isotope exchange also occurred during subsequent reheating events in the solar nebula.

Origin of opaque assemblages in C3V meteorites - Implications for nebular and planetary processes

Science.gov (United States)

Blum, Joel D.; Wasserburg, G. J.; Hutcheon, I. D.; Beckett, J. R.; Stolper, E. M.

1989-01-01

The results of analyses of meteoritic opaque assemblages (OAs) are presented and used in conjunction with literature data on phase equilibria and diffusion to further develop the hypothesis of Blum et al. (1989) for the origin of OAs in Ca,Al-rich inclusions (CAIs). Based on the results of the analyses, it is suggested that OAs formed after the crystallization of host CAIs by exsolution, sulfidation, and oxidation of precursor alloys at low temperatures (about 770 K) and higher than solar gas sulfur and oxygen fugacities. This model contrasts with previous models that call upon the formation of CAI OAs by aggregation of previously formed phases in the solar nebula prior to the crystallization of CAIs.

Conodont color alteration index and upper Paleozoic thermal history of the Amazonas Basin, Brazil

Science.gov (United States)

Cardoso, Cassiane Negreiros; Sanz-López, Javier; Blanco-Ferrera, Silvia; Lemos, Valesca Brasil; Scomazzon, Ana Karina

2015-12-01

The conodont color alteration index (CAI) was determined in elements from core samples of the Frasnian Barreirinha Formation (one well) and of the Pennsylvanian-Permian Tapajós Group (twenty three wells and one limestone quarry) in the Amazonas Basin. The thermal history of the basin is analyzed using the CAI value distribution represented in maps and stratigraphic sections through correlation schemes, and in conjunction with previously published data. The pattern of palaeotemperatures for CAI values of 1.5-3 is coincident with organic matter maturation under a sedimentary overburden providing diagenetic conditions in the oil/gas window. Locally, conodonts show metamorphism (CAI value of 6-7) in relation to the intrusion of diabase bodies in beds including high geothermal gradient evaporites. Microtextural alteration on the surface conodonts commonly shows several types of overgrowth microtextures developed in diagenetic conditions. Locally, recrystallization in conodonts with a high CAI value is congruent with contact metamorphism in relation to Mesozoic intrusions. The CAI values of 1.5 or 2 observed close to the surface in several areas of the basin may be interpreted in relation to a high thermal palaeogradient derived from the magmatic episode or/and to the local denudation of the upper part of the Paleozoic succession prior to this thermal event.

Individuals with chronic ankle instability exhibit dynamic postural stability deficits and altered unilateral landing biomechanics: A systematic review.

Science.gov (United States)

Simpson, Jeffrey D; Stewart, Ethan M; Macias, David M; Chander, Harish; Knight, Adam C

2018-06-13

To evaluate the literature regarding unilateral landing biomechanics and dynamic postural stability in individuals with and without chronic ankle instability (CAI). Four online databases (PubMed, ScienceDirect, Scopus, and SportDiscus) were searched from the earliest records to 31 January 2018, as well as reference sections of related journal articles, to complete the systematic search. Studies investigating the influence of CAI on unilateral landing biomechanics and dynamic postural stability were systematically reviewed and evaluated. Twenty articles met the criteria and were included in the systematic review. Individuals with CAI were found to have deficits in dynamic postural stability on the affected limb with medium to large effect sizes and altered lower extremity kinematics, most notably in the ankle and knee, with medium to large effect sizes. Additionally, greater loading rates and peak ground reaction forces, in addition to reductions in ankle muscle activity were also found in individuals with CAI during unilateral jump-landing tasks. Individuals with CAI demonstrate dynamic postural stability deficits, lower extremity kinematic alterations, and reduced neuromuscular control during unilateral jump-landings. These are likely factors that contribute recurrent lateral ankle sprain injuries during dynamic activity in individuals with CAI. Copyright © 2018 Elsevier Ltd. All rights reserved.

Computer aided information system for a PWR

International Nuclear Information System (INIS)

Vaidian, T.A.; Karmakar, G.; Rajagopal, R.; Shankar, V.; Patil, R.K.

1994-01-01

The computer aided information system (CAIS) is designed with a view to improve the performance of the operator. CAIS assists the plant operator in an advisory and support role, thereby reducing the workload level and potential human errors. The CAIS as explained here has been designed for a PWR type KLT- 40 used in Floating Nuclear Power Stations (FNPS). However the underlying philosophy evolved in designing the CAIS can be suitably adopted for other type of nuclear power plants too (BWR, PHWR). Operator information is divided into three broad categories: a) continuously available information b) automatically available information and c) on demand information. Two in number touch screens are provided on the main control panel. One is earmarked for continuously available information and the other is dedicated for automatically available information. Both the screens can be used at the operator's discretion for on-demand information. Automatically available information screen overrides the on-demand information screens. In addition to the above, CAIS has the features of event sequence recording, disturbance recording and information documentation. CAIS design ensures that the operator is not overburdened with excess and unnecessary information, but at the same time adequate and well formatted information is available. (author). 5 refs., 4 figs

Zigzag et « carré plastique » haïtiens en Amérique du nord à travers l’Autobiographie américaine de Dany Laferrière

OpenAIRE

Olivier-Messonnier, Laurence

2015-01-01

L’ « Autobiographie américaine » de Dany Laferrière et le « carré plastique » de Léonel Jules, artistes et amis haïtiens émigrés au Québec, déconstruisent la ville américaine par l’éclatement textuel et la plasticité picturale. Mythifient-ils pour autant le berceau natal ? L’écriture plastique et poétique efface les frontières. The « American Autobiography » by Dany Laferrière and the « Carré Plastique » by Léonel Jules, Haitian artists and friends who emigrated to Quebec, deconstruct the ...

Oxygen isotopic composition of relict olivine grains in cosmic spherules: Links to chondrules from carbonaceous chondrites

Digital Repository Service at National Institute of Oceanography (India)

Rudraswami, N.G.; ShyamPrasad, M.; Nagashima, K.; Jones, R.H.

aluminium rich inclusions (CAIs), amoeboid olivine aggregates (AOAs), and some porphyritic chondrules from carbonaceous chondrites. These grains appear to have recorded the initial oxygen isotopic composition of the inner solar nebula. Three olivine... to the major components of meteorites such as chondrules and calcium-aluminium-rich inclusions (CAIs). CAIs, the first solar system objects in the solar nebula, are formed by condensation of refractory minerals at high temperatures. They are 16O...

High-precision Al-Mg isotopic systematics in USNM 3898 - The benchmark "ALL" for initial 87Sr/86Sr in the earliest Solar System

Science.gov (United States)

MacPherson, G. J.; Defouilloy, C.; Kita, N. T.

2018-06-01

The Allende CAI USNM 3898 is the basis for "ALL", the lowest measured initial 87Sr/86Sr value in any solar system material including other CAIs (Gray et al., 1973). If the value ALL is correct (debated), then USNM 3898 must be 1-2 million years older than other CAIs (Podosek et al., 1991). This would require in turn that it have a much higher initial 26Al/27Al value than other CAIs, on the order of 4 × 10-4. Podosek et al. (1991) showed that this is not the case, with initial 26Al/27Al = (4.5 ± 0.7) × 10-5, but their Mg-isotopic data had large error bars and there was clear isotopic disturbance in the data having the highest 27Al/24Mg. Without the latter data, the slope of their isochron is higher (5.10 ± 1.19) × 10-5) and within (large) error of being supracanonical. We used high-precision SIMS to re-determine the initial 26Al/27Al in this CAI and obtained a value of (5.013 ± 0.099) × 10-5, with an intercept δ26Mg* = - 0.008 ± 0.048 and MSWD = 1.3. This value is indistinguishable from that measured in many other CAIs and conclusively shows that USNM 3898 is not uniquely ancient. We also confirmed evidence of later isotopic disturbance, similar to what Podosek et al. found, indicating a re-melting and evaporation event some 200,000 years after initial CAI solidification.

Condomless anal intercourse among males and females at high risk for heterosexual HIV infection

Science.gov (United States)

German, Danielle; Nguyen, Trang; Ogbue, Christine Powell; Flynn, Colin

2015-01-01

Background Understanding and addressing heterosexual HIV transmission requires attention to the range and context of heterosexual sexual behaviors. We sought to determine population-based prevalence of condomless anal intercourse (CAI) among individuals at increased heterosexual HIV risk in Baltimore and to identify demographic, behavioral, and health related correlates. Methods Data were from a cross-sectional study of 185 males and 198 females at increased heterosexual risk for HIV recruited using respondent driven sampling as part of CDC's National HIV Behavioral Surveillance Project in Baltimore, August-December 2010. Bivariate and multivariate logistic regression examined factors associated with heterosexual CAI. Results The sample was majority African-American, with mean age of 38 among men and 34 among women. Forty-two percent of men (95% C.I.: 30.9, 52.0%) and 38% of women (95% C.I.: 29.4, 47.2%) reported any CAI in the past year, with variance by partner type and gender. Among men, CAI was significantly associated with homelessness, casual and exchange partners, same sex partner in past year, and substance use. Among women, CAI was significantly associated with lower education, casual and exchange partners, same sex partner in past year, multiple partners, and substance use. In adjusted gender-specific models, males and females with increasing numbers of partners were more likely to engage in CAI. Conclusions It is important to recognize the efficiency of transmission of HIV and other STIs through CAI. There is a need to broaden heterosexual sexual health promotion and HIV/STI prevention to adequately and appropriately address risks and prevention strategies for anal intercourse. PMID:25970308

Isotopic diversity in nebular dust: The distribution of Ti isotopic anomalies in carbonaceous chondrites

International Nuclear Information System (INIS)

Niemeyer, S.

1988-01-01

Average Ti isotopic patterns are derived for each class of carbonaceous chondrite from a chemically characterized suite of whole-rock samples. There is a well-resolved excess of 50 Ti in a subset of CI meteorites. Mean values of the 50 Ti excess for the four classes span a range of only 2 ε-units, with an apparent positive correlation with Al content. Previous evidence for anomalies in chondrules is augmented here by demonstrating that: (1) the more pristine Ca-Al-rich inclusions (CAIs) in Efremovka show the same isotopic pattern as the typical Allende CAI; and, (2) CM and CV matrix carry 50 Ti excesses of about 2 ε-units. The distribution of Ti isotopic anomalies among matrix, chondrules, and CAIs suggests a model in which all three constituents formed from precursor-assemblages in which some chemical memories were still intact; the isotopic differences reflect fractionations among the carrier phases of the different isotopic components. Chondrules formed by a mostly closed-system melting of their precursors, and thus provide a recording of the extent of nebular heterogeneity on the mg-size scale. The larger anomalies in CAIs, compared to matrix and most (but not all) chondrules, are attributed primarily to an open- rather than closed-system processing of the CAI precursors. Precursors of both FUN and normal CAIs experienced an episode of intense processing, perhaps partial melting, that created the FUN characteristics, but for normal CAIs the FUN effects were erased by subsequent isotopic equilibration and exchange

Field evaluation of spatial repellency of metofluthrin-impregnated latticework plastic strips against Aedes aegypti (L.) and analysis of environmental factors affecting its efficacy in My Tho City, Tien Giang, Vietnam.

Science.gov (United States)

Kawada, Hitoshi; Iwasaki, Tomonori; LE Loan, Luu; Tien, Tran Khanh; Mai, Nguyen Thi Nhu; Shono, Yoshinori; Katayama, Yasuyuki; Takagi, Masahiro

2006-12-01

Spatial repellency of metofluthrin-impregnated polyethylene latticework plastic strips against Aedes aegypti mosquitoes was evaluated. Analysis of environmental factors affecting the efficacy of these strips, such as room temperature, humidity, and house structure, was performed in a residential area in My Tho City, Tien Giang Province, Vietnam. Treatment with the strips at the rate of 1 strip per 2.6-5.52 m(2) (approximately 600 mg per 2.6-5.52 m(2)) reduced the collection of Ae. aegypti resting inside the houses for at least eight weeks. Multiple regression analysis indicated that both increase in the average room temperature and decrease in the area of openings in the rooms that were treated with the strips positively affected the spatial repellency of metofluthrin.

Research on the Use of Computer-Assisted Instruction.

Science.gov (United States)

Craft, C. O.

1982-01-01

Reviews recent research studies related to computer assisted instruction (CAI). The studies concerned program effectiveness, teaching of psychomotor skills, tool availability, and factors affecting the adoption of CAI. (CT)

Abundance, distribution and bioavailability of major and trace elements in surface sediments from the Cai River estuary and Nha Trang Bay (South China Sea, Vietnam)

Science.gov (United States)

Koukina, S. E.; Lobus, N. V.; Peresypkin, V. I.; Dara, O. M.; Smurov, A. V.

2017-11-01

Major (Si, Al, Fe, Ti, Mg, Ca, Na, K, S, P), minor (Mn) and trace (Li, V, Cr, Co, Ni, Cu, Zn, As, Sr, Zr, Mo, Cd, Ag, Sn, Sb, Cs, Ba, Hg, Pb, Bi and U) elements, their chemical forms and the mineral composition, organic matter (TOC) and carbonates (TIC) in surface sediments from the Cai River estuary and Nha Trang Bay were first determined along the salinity gradient. The abundance and ratio of major and trace elements in surface sediments are discussed in relation to the mineralogy, grain size, depositional conditions, reference background and SQG values. Most trace-element contents are at natural levels and are derived from the composition of rocks and soils in the watershed. A severe enrichment of Ag is most likely derived from metal-rich detrital heavy minerals such as Ag-sulfosalts. Along the salinity gradient, several zones of metal enrichment occur in surface sediments because of the geochemical fractionation of the riverine material. The parts of actually and potentially bioavailable forms (isolated by four single chemical reagent extractions) are most elevated for Mn and Pb (up to 36% and 32% of total content, respectively). The possible anthropogenic input of Pb in the region requires further study. Overall, the most bioavailable parts of trace elements are associated with easily soluble amorphous Fe and Mn oxyhydroxides. The sediments are primarily enriched with bioavailable metal forms in the riverine part of the estuary. Natural (such as turbidities) and human-generated (such as urban and industrial activities) pressures are shown to influence the abundance and speciation of potential contaminants and therefore change their bioavailability in this estuarine system.

Thermal and chemical evolution in the early Solar System as recorded by FUN CAIs: Part II - Laboratory evaporation of potential CMS-1 precursor material

Science.gov (United States)

Mendybaev, Ruslan A.; Williams, Curtis D.; Spicuzza, Michael J.; Richter, Frank M.; Valley, John W.; Fedkin, Alexei V.; Wadhwa, Meenakshi

2017-03-01

We present the results of laboratory experiments in which a forsterite-rich melt estimated to be a potential precursor of Allende CMS-1 FUN CAI was evaporated into vacuum for different lengths of time at 1900 °C. The evaporation of this melt resulted in residues that define trajectories in chemical as well as magnesium, silicon and oxygen isotopic composition space and come very close to the measured properties of CMS-1. The isotopic composition of the evaporation residues was also used to determine the kinetic isotopic fractionation factors [α2,1 (vapor-melt) defined as the ratio of isotopes 2 and 1 of a given element in the evaporating gas divided by their ratio in the evaporating source] for evaporation of magnesium (α25,24 for 25Mg/24Mg), silicon (α29,28 for 29Si/28Si) and oxygen (α18,16 for 18O/16O) from the forsterite-rich melt at 1900 °C. The values of α25,24 = 0.98383 ± 0.00033 and α29,28 = 0.99010 ± 0.00038 are essentially independent of change in the melt composition as evaporation proceeds. In contrast, α18,16 changes from 0.9815 ± 0.0016 to ∼0.9911 when the residual melt composition changes from forsteritic to melilitic. Using the determined values of α25,24 and α29,28 and present-day bulk chemical composition of the CMS-1, the composition of the precursor of the inclusion was estimated to be close to the clinopyroxene + spinel + forsterite assemblage condensed from a solar composition gas. The correspondence between the chemical composition and isotopic fractionation of experimental evaporation residues and the present-day bulk chemical and isotopic compositions of CMS-1 is evidence that evaporation played a major role in the chemical evolution of CMS-1.

De l’utopie socialiste au réalisme chrétien

Directory of Open Access Journals (Sweden)

Isabelle Richet

2006-03-01

Full Text Available Le New Deal est le premier mouvement réformiste d’ampleur dans l’histoire des Etats‑Unis qui n’ait pas été inspiré, ni soutenu, par les forces du protestantisme. Si une majorité des protestants et de leur clergé se sont opposés au New Deal à partir de positions conservatrices, le théologien Reinhold Niebuhr en a développé au départ une virulente critique de gauche avant de finalement rallier le président démocrate à la fin des années trente. Nourrie par le rejet de l’idéalisme du Social Gospel, incapable à ses yeux de comprendre les rapports sociaux en terme de classe et de pouvoir, la critique de Niebuhr emprunte les outils d’analyse marxistes pour développer une approche réaliste, tant du point de vue des fins que des moyens de la lutte politique. Le New Deal lui apparaît avant tout comme un programme visant à sauver le capitalisme, alors que la société fondée sur la justice qu’il envisage passe par la socialisation des moyens de production qui ne pourra émerger qu’à travers des conflits sociaux au cours desquels les moyens de lutte même violents sont justifiés. Mais sous l’influence des évènements en Europe au lendemain de la victoire d’Hitler, Reinhold Niebuhr se tourne au milieu des années trente vers une réflexion théologique inspirée de l’orthodoxie de Karl Barth et de son frère Richard Niebuhr, qui l’amène à réintroduire le péché comme la limite absolue de toute l’expérience humaine, interdisant d’envisager la création d’une société de paix et de justice. Ce nouvel absolutisme théologique nourrit un relativisme politique, le réalisme chrétien consistant désormais à choisir la moins mauvaise des options en présence. De ce point de vue, le président démocrate qui appelle à la préparation militaire s’impose désormais comme le choix le plus réaliste face à la montée du fascisme en Europe.The New Deal was the first major reformist experiment in the

Elimination of Cancer Stem-Like “Side Population” Cells in Hepatoma Cell Lines by Chinese Herbal Mixture “Tien-Hsien Liquid”

Directory of Open Access Journals (Sweden)

Chih-Jung Yao

2012-01-01

Full Text Available There are increasing pieces of evidence suggesting that the recurrence of cancer may result from a small subpopulation of cancer stem cells, which are resistant to the conventional chemotherapy and radiotherapy. We investigated the effects of Chinese herbal mixture Tien-Hsien Liquid (THL on the cancer stem-like side population (SP cells isolated from human hepatoma cells. After sorting and subsequent culture, the SP cells from Huh7 hepatoma cells appear to have higher clonogenicity and mRNA expressions of stemness genes such as SMO, ABCG2, CD133, β-catenin, and Oct-4 than those of non-SP cells. At dose of 2 mg/mL, THL reduced the proportion of SP cells in HepG2, Hep3B, and Huh7 cells from 1.33% to 0.49%, 1.55% to 0.43%, and 1.69% to 0.27%, respectively. The viability and colony formation of Huh7 SP cells were effectively suppressed by THL dose-dependently, accompanied with the inhibition of stemness genes, e.g., ABCG2, CD133, and SMO. The tumorigenicity of THL-treated Huh7 SP cells in NOD/SCID mice was also diminished. Moreover, combination with THL could synergize the effect of doxorubicin against Huh7 SP cells. Our data indicate that THL may act as a cancer stem cell targeting therapeutics and be regarded as complementary and integrative medicine in the treatment of hepatoma.

Trace Element Abundances in an Unusual Hibonite-Perovskite Refractory Inclusion from Allende

Science.gov (United States)

Mane, Prajkta; Wadhwa, M.; Keller, L. P.

2013-01-01

Calcium-aluminum-rich refractory inclusions (CAIs) are thought to be the first-formed solids in the Solar protoplanetary disk and can provide information about the earliest Solar System processes (e.g., [1]). A hibonite-perovskitebearing CAI from the Allende CV3 chondrite (SHAL, [2]) contains a single of 500 micrometers hibonite grain and coarse-grained perovskite. The mineralogy and oxygen isotopic composition of this CAI shows similarities with FUN inclusions, especially HAL [2]. Here we present trace element abundances in SHAL.

PCR nuclear composition at 1-20 PeV according to lateral distributions of all EAS and EAS accompanied high-energy-gamma rays and hadrons in EC at Tien-Shan level

International Nuclear Information System (INIS)

Nesterova, N.M.; Pavlyuchenko, V.P.; Chubenko, A.P.; Shaulov, S.B.

2003-01-01

The Tien-Shan array Adron data are presented on electron-photon component lateral distributions (age parameter S) of extensive air showers of cosmic rays. The data are given as a dependence on the electron size N e for all showers and for showers accompanied by high-energy gamma rays and hadrons in X-ray films. N e characterizes the energy of primary-cosmic-ray nuclei E 0 . Later events are generated by primary photons chiefly. That allows judging on the proton role with E 0 change. S distributions point to the considerable part of light nuclei, protons mainly, at the region above knee of the spectrum at N e > 10 6 up to N e = 5 x 10 6 (E 0 ∼ 10 PeV) at least [ru

Differences in lateral ankle laxity measured via stress ultrasonography in individuals with chronic ankle instability, ankle sprain copers, and healthy individuals.

Science.gov (United States)

Croy, Theodore; Saliba, Susan A; Saliba, Ethan; Anderson, Mark W; Hertel, Jay

2012-07-01

Cross-sectional. To use stress ultrasonography to measure the change in anterior talofibular ligament length during the simulated anterior drawer and ankle inversion stress tests. In approximately 30% of individuals, ankle sprains may eventually develop into chronic ankle instability (CAI) with recurrent symptoms. Individuals with CAI and those who have a history of ankle sprain (greater than 1 year prior) without chronic instability (copers) may or may not have mechanical laxity. Sixty subjects (n=60 ankles) were divided into 3 groups: 1) Control subjects without ankle injury history (n=20; mean ± SD age; 24.8 ± 4.8 years; height, 173.7 ± 9.4 cm; weight, 77.2 ± 19.5 kg), ankle sprain copers (n=20; 22.3 ± 2.9 years; 172.8 ± 11.3 cm; 72.4 ± 14.3 kg), and subjects with CAI (n=20; 23.5 ± 4.2 years; 174.6 ± 9.6 cm; 74.8 ± 17.3 kg). Ligament length change with the anterior drawer and end range ankle inversion was calculated from ultrasound images. The Foot and Ankle Ability Measure (FAAM) was used to quantify self-reported function on activities-of-daily living (ADL) and sports. The anterior drawer test resulted in length changes that were greater (F₂,₅₇=6.2, P=.004) in the CAI (mean ± SD length change, 15.6 ± 15.1%, P=.006) and the coper groups (14.0 ± 15.9%, P=.016) compared to the control group (1.3 ± 10.7%); however the length change for the CAI and coper groups were not different (P=.93). Ankle inversion similarly resulted in greater ligament length change (F₂,₅₇=6.5, P=.003) in the CAI (25.3 ± 15.5%, P=.003) and coper groups (20.2 ± 19.6%, P=.039) compared to the control group (7.4 ± 12.9%); with no difference in length change between the copers and CAI groups (P=.59). The CAI group had a lower score on the FAAM-ADL (87.4 ± 13.4%) and FAAM-Sports (74.2 ± 17.8%) when compared to the control (98.8 ± 2.9% and 98.9 ± 3.1%, P<.0001) and coper groups (99.4 ± 1.8% and 94.6 ± 8.8%, P<.0001). Stress ultrasonography identified greater

Selected Topics on Advanced Information Systems Engineering: Editorial Introduction to the Issue 5 of CSIMQ

Directory of Open Access Journals (Sweden)

Janis Grabis

2015-12-01

Full Text Available The 5th issue of the journal on Complex Systems Informatics and Modeling (CSIMQ presents extended versions of five papers selected from the CAiSE Forum 2015. The forum was part of the 27th edition of international Conference on Advanced Information Systems engineering (CAiSE 2015, which took place in June 2015 in Stockholm, Sweden. Information systems engineering draws its foundation from various interrelated disciplines including, e.g., conceptual modeling, database systems, business process management, requirements engineering, human computer interaction, and enterprise computing to address various practical challenges in development and application of information systems. The guiding subjects of CAiSE 2015 were Creativity, Ability, and Integrity. The CAiSE Forum aimed at presenting and discussing new ideas and tools related to information systems Engineering.

Hiina kunstnikud kaebavad Veneetsia biennaali kohtusse / Maria-Kristiina Soomre

Index Scriptorium Estoniae

Soomre, Maria-Kristiina, 1978-

2000-01-01

1999. a. Veneetsia biennaalil auhinna võitnud hiina kunstniku Cai Guo Qiangi teos "Veneetsia maksukoguja hoov" on Hiinas tekitanud diskussiooni autoriõiguste teemal. Kaalutakse kohtuasja algatamist Cai Guo Qiangi, Harald Szeemanni ja Veneetsia biennaali vastu

Effect of Fibre Level and Fibre Source on Gut Morphology and Micro-environment in Local (Mong Cai and Exotic (Landrace×Yorkshire Pigs

Directory of Open Access Journals (Sweden)

T. T. B. Ngoc

2012-12-01

Full Text Available The effect of genotype, fibre level and fibre source on gut morphology, environment and microflora was studied using 18 Mong Cai (MC and 18 Landrace×Yorkshire (LY pigs, aged around 60 d. The diets were based on maize, rice bran, soybean meal, fish meal and soybean oil, and cassava residue (CR or brewer’s grain (BG as fibrous ingredient sources in the high-fibre diets (HF. A low-fibre diet (LF, containing around 200 g NDF/kg dry matter (DM, was formulated without CR and BG as feed ingredients. The HF diets (HF-CR and HF-BG were formulated to contain around 270 g NDF/kg DM. The experiment was arranged according to a 2×3 factorial completely randomized design with six replications, and lasted 30 d. Crypt density in ileum was lowest (p<0.05 and villus height in jejunum and ileum were the greatest (p<0.05 in pigs fed diet HF-BG. Villus width in ileum was greatest in pigs fed diets HF-CR and HF-BG (p<0.05. Lactic acid bacteria (LAB counts in stomach were greatest (p<0.05 and E. coli counts in ileum and colon were lowest (p<0.05 in pigs fed diet HF-CR. The concentration of total organic acids in ileum, caecum and colon were greatest (p<0.05, and pH in ileum and colon were lowest (p<0.05 in pigs fed diet HF-CR. Crypt density in ileum was lowest, and villus height in ileum and villus width in jejunum and ileum was greatest in LY pigs (p<0.05. LAB counts in stomach and ileum were greatest, and E. coli counts in ileum were lowest in MC pigs (p<0.05. The concentration of total organic acids in ileum, caecum and colon were greatest (p<0.05 and pH lowest (p<0.05 in MC pigs.

Scientific Performance Analysis of the SYZ Telescope Design versus the RC Telescope Design

Science.gov (United States)

Ma, Donglin; Cai, Zheng

2018-02-01

Recently, Su et al. propose an innovative design, referred as the “SYZ” design, for China’s new project of a 12 m optical-infrared telescope. The SYZ telescope design consists of three aspheric mirrors with non-zero power, including a relay mirror below the primary mirror. SYZ design yields a good imaging quality and has a relatively flat field curvature at Nasmyth focus. To evaluate the science-compatibility of this three-mirror telescope, in this paper, we thoroughly compare the performance of SYZ design with that of Ritchey–Chrétien (RC) design, a conventional two-mirror telescope design. Further, we propose the Observing Information Throughput (OIT) as a metric for quantitatively evaluating the telescopes’ science performance. We find that although a SYZ telescope yields a superb imaging quality over a large field of view, a two-mirror (RC) telescope design holds a higher overall throughput, a better diffraction-limited imaging quality in the central field of view (FOV < 5‧) which is better for the performance of extreme Adaptive Optics (AO), and a generally better scientific performance with a higher OIT value. D. Ma & Z. Cai contributed equally to this paper.

Developing a Framework for Ankle Function: A Delphi Study

Science.gov (United States)

Snyder, Kelli R.; Evans, Todd A.; Neibert, Peter J.

2014-01-01

Context: Addressing clinical outcomes is paramount to providing effective health care, yet there is no consensus regarding the appropriate outcomes to address after ankle injuries. Compounding the problem is the repetitive nature of lateral ankle sprains, referred to as functional (FAI) or chronic (CAI) ankle instability. Although they are commonly used terms in practice and research, FAI and CAI are inconsistently defined and assessed. Objective: To establish definitions of a healthy/normal/noninjured ankle, FAI, and CAI, as well as their characteristics and assessment techniques. Design: Delphi study. Setting: Telephone interviews and electronic surveys. Patients or Other Participants: Sixteen experts representing the fields of ankle function and treatment, ankle research, and outcomes assessment and research were selected as panelists. Data Collection and Analysis: A telephone interview produced feedback regarding the definition of, functional characteristics of, and assessment techniques for a healthy/normal/noninjured ankle, an unhealthy/acutely injured ankle, and FAI/CAI. Those data were compiled, reduced, and returned through electronic surveys and were either included by reaching consensus (80% agreement) or excluded. Results: The definitions of a healthy/normal/noninjured ankle and FAI reached consensus. Experts did not agree on a definition of CAI. Eleven functional characteristics of a healthy/normal/noninjured ankle, 32 functional characteristics of an unhealthy/acutely injured ankle, and 13 characteristics of FAI were agreed upon. Conclusions: Although a consensus was reached regarding the definitions and functional characteristics of a healthy/normal/noninjured ankle and FAI, the experts could only agree on 1 characteristic to include in the FAI definition. Several experts did, however, provide additional comments that reinforced the differences in the interpretation of those concepts. Although the experts could not agree on the definition of CAI, its

An evaluation of factors associated with sexual risk taking among Black men who have sex with men: A comparison of younger and older populations

Science.gov (United States)

Maksut, Jessica L.; Eaton, Lisa A.; Siembida, Elizabeth J.; Driffin, Daniel D.; Baldwin, Robert

2016-01-01

Background In the United States, rates of human immunodeficiency virus (HIV) infection are highest among Black men who have sex with men (BMSM). Prior research indicates that younger BMSM in particular (i.e., BMSM 29 years of age and younger) are most at risk for HIV infection and that HIV incidence in this subpopulation has risen in recent years. It remains unclear, however, why younger BMSM, relative to BMSM 30 years of age and older, are at increased risk for HIV infection. Methods For the current study, we surveyed 450 BMSM located in the Atlanta, GA metropolitan and surrounding areas. We assessed BMSM’s depressive symptoms, substance use during sex, psychosocial risk factors (i.e., HIV risk perceptions, condom use self-efficacy, internalized homophobia, and perceived HIV stigmatization), and sexual risk taking (i.e., condomless anal intercourse [CAI]). Results We found that younger BMSM (YBMSM) and older BMSM (OBMSM) differed with respect to factors associated with CAI. In multivariable models, alcohol use before or during sex, lower educational attainment, and sexual orientation (i.e., bisexual sexual orientation) were significantly associated with increased CAI for YBMSM, while HIV risk perceptions and internalized homophobia were significantly, negatively associated with CAI among OBMSM. Discussion Rates of engaging in CAI were similar across the two age cohorts; however, factors related to CAI varied by these two groups. Findings emphasize the need to consider targeted interventions for different generational cohorts of BMSM. PMID:27001255

Hip strength and star excursion balance test deficits of patients with chronic ankle instability.

Science.gov (United States)

McCann, Ryan S; Crossett, Ian D; Terada, Masafumi; Kosik, Kyle B; Bolding, Brenn A; Gribble, Phillip A

2017-11-01

To examine isometric hip strength in those with and without CAI, and determine the degree of Star Excursion Balance Test (SEBT) variance explained by isometric hip strength. Single-blinded, cross-sectional, case-control study. Thirty individuals with CAI, 29 lateral ankle sprain (LAS) copers, and 26 healthy controls participated. We assessed dynamic postural control with the SEBT anterior (SEBT-ANT), posteromedial (SEBT-PM), and posterolateral (SEBT-PL) reaches, and isometric hip extension (EXT), abduction (ABD) and external rotation (ER) strength with hand-held dynamometry. The CAI and LAS coper groups' involved limbs and randomly selected limbs in controls were tested. Separate Kruskal-Wallis tests compared SEBT scores and isometric hip strength between groups. Backwards linear regression models determined the degree of SEBT variance explained by isometric hip strength. Statistical significance was set a priori at Phip strength compared to LAS copers and controls. Additionally, the CAI group's isometric hip strength significantly influenced dynamic postural control performance. Future CAI rehabilitation strategies should consider hip muscular strengthening to facilitate improvements in dynamic postural control. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

Evolution of Ca-Al-rich bodies in the earliest solar system: growth by incorporation

International Nuclear Information System (INIS)

Wark, D.A.; Lovering, J.F.

1982-01-01

Many Type B Ca-Al-rich inclusions (CAI's) in the Allende carbonaceous chondrite contain two types of spinel structures, 'framboids' and 'palisades'. Framboids are clumps of spinel grains generally < 100 μm across. Experimental studies show that they probably formed in situ by solid state growth processes. Palisades are texturally different and consist of ovoid shells of spinel grains that appear in thin sections as long arcs or rings with diameters ranging from approx. 50 μm up to 2 cm. No in situ formation process seems able to explain the variety of sizes and morphologies of palisades nor the different compositions and textures of the enclosed and enclosing materials. We therefore suggest that palisades are the spinel rims of smaller, earlier-formed Type B CAI's that were incorporated into other CAI material in various ways - by capture into liquid drops, by solid condensate overgrowths and by the partial melting or welding of agglomerates containing the bodies. As some Type B bodies have been found inside Type A host material it appears that in at least some regions, and probably generally, Type A CAI's formed after Type B. Proposals are made concerning the origin of the CAI material. (author)

Normalization of Impact Energy by Laminate Thickness for Compression After Impact Testing

Science.gov (United States)

Nettles, A. T.; Hromisin, S. M.

2013-01-01

The amount of impact energy used to damage a composite laminate is a critical parameter when assessing residual strength properties. The compression after impact (CAI) strength of impacted laminates is dependent upon how thick the laminate is and this has traditionally been accounted for by normalizing (dividing) the impact energy by the laminate's thickness. However, when comparing CAI strength values for a given lay-up sequence and fiber/resin system, dividing the impact energy by the specimen thickness has been noted by the author to give higher CAI strength values for thicker laminates. A study was thus undertaken to assess the comparability of CAI strength data by normalizing the impact energy by the specimen thickness raised to a power to account for the higher strength of thicker laminates. One set of data from the literature and two generated in this study were analyzed by dividing the impact energy by the specimen thickness to the 1, 1.5, 2, and 2.5 powers. Results show that as laminate thickness and damage severity decreased, the value which the laminate thickness needs to be raised to in order to yield more comparable CAI data increases.

Effectiveness of Using Computer-Assisted Supplementary Instruction for Teaching the Mole Concept

Science.gov (United States)

Yalçinalp, Serpil; Geban, Ömer; Özkan, Ilker

This study examined the effect of computer-assisted instruction (CAI), used as a problem-solving supplement to classroom instruction, on students' understanding of chemical formulas and mole concept, their attitudes toward chemistry subjects, and CAI. The objective was to assess the effectiveness of CAI over recitation hours when both teaching methods were used as a supplement to the traditional chemistry instruction. We randomly selected two classes in a secondary school. Each teaching strategy was randomly assigned to one class. The experimental group received supplementary instruction delivered via CAI, while the control group received similar instruction through recitation hours. The data were analyzed using two-way analysis of variance and t-test. It was found that the students who used the CAI accompanied with lectures scored significantly higher than those who attended recitation hours, in terms of school subject achievement in chemistry and attitudes toward chemistry subjects. In addition, there was a significant improvement in the attitudes of students in the experimental group toward the use of computers in a chemistry course. There was no significant difference between the performances of females versus males in each treatment group.Received: 26 April 1994; Revised: 6 April 1995;

CORRELATION OF 48Ca, 50Ti, AND 138La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

International Nuclear Information System (INIS)

Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang

2015-01-01

Precise determinations of 48 Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive 48 Ca/ 44 Ca anomalies in all analyzed CAIs after normalization to 42 Ca/ 44 Ca, and it is clearly shown that there is no simple correlation between 48 Ca/ 44 Ca and 50 Ti/ 48 Ti anomalies, in agreement with Jungck et al. Compared to the 48 Ca/ 44 Ca versus 50 Ti/ 48 Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated 50 Ti/ 48 Ti. Assuming the 48 Ca/ 44 Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess 50 Ti anomalies in CAIs can be calculated by subtracting the part associated with 48 Ca/ 44 Ca. These excesses show a linear correlation with 138 La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system 48 Ca, 50 Ti, and 138 La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II

Psychological outcomes and gender-related development in complete androgen insensitivity syndrome.

Science.gov (United States)

Hines, Melissa; Ahmed, S Faisal; Hughes, Ieuan A

2003-04-01

We evaluated psychological outcomes and gender development in 22 women with complete androgen insensitivity syndrome (CAIS). Participants were recruited through a medical database (n = 10) or through a patient support group (n = 12). Controls included 14 males and 33 females, of whom 22 were matched to women with CAIS for age, race, and sex-of-rearing. Outcome measures included quality of life (self-esteem and psychological general well-being), gender-related psychological characteristics (gender identity, sexual orientation, and gender role behavior in childhood and adulthood), marital status, personality traits that show sex differences, and hand preferences. Women recruited through the database versus the support group did not differ systematically, and there were no statistically significant differences between the 22 women with CAIS and the matched controls for any psychological outcome. These findings argue against the need for two X chromosomes or ovaries to determine feminine-typical psychological development in humans and reinforce the important role of the androgen receptor in influencing masculine-typical psychological development. They also suggest that psychological outcomes in women with CAIS are similar to those in other women. However, additional attention to more detailed aspects of psychological well-being in CAIS is needed.

NCBI nr-aa BLAST: CBRC-FCAT-01-1153 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 76% ...

NCBI nr-aa BLAST: CBRC-CJAC-01-1207 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| polycystic kidney and hepatic disease 1 [Homo sapiens] emb|CAH73867.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAH72781.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI16676.1| polycystic kidney and hepatic disease 1 (autos...omal recessive) [Homo sapiens] emb|CAI20324.1| polycystic kidney and hepatic disease 1 (autosomal r...ecessive) [Homo sapiens] emb|CAI20233.1| polycystic kidney and hepatic disease 1 (autosomal recessive) [Homo sapiens] NP_619639.3 0.0 87% ...

Intracellular calcium modulation of voltage-gated sodium channels in ventricular myocytes

NARCIS (Netherlands)

Casini, Simona; Verkerk, Arie O.; van Borren, Marcel M. G. J.; van Ginneken, Antoni C. G.; Veldkamp, Marieke W.; de Bakker, Jacques M. T.; Tan, Hanno L.

2009-01-01

AIMS: Cardiac voltage-gated sodium channels control action potential (AP) upstroke and cell excitability. Intracellular calcium (Ca(i)(2+)) regulates AP properties by modulating various ion channels. Whether Ca(i)(2+) modulates sodium channels in ventricular myocytes, is unresolved. We studied

An Evaluation of Computer-Aided Instruction in an Introductory Biostatistics Course.

Science.gov (United States)

Forsythe, Alan B.; Freed, James R.

1979-01-01

Evaluates the effectiveness of computer assisted instruction for teaching biostatistics to first year students at the UCLA School of Dentistry. Results do not demonstrate the superiority of CAI but do suggest that CAI compares favorably to conventional lecture and programed instruction methods. (RAO)

Computer-assisted instruction: a library service for the community teaching hospital.

Science.gov (United States)

McCorkel, J; Cook, V

1986-04-01

This paper reports on five years of experience with computer-assisted instruction (CAI) at Winthrop-University Hospital, a major affiliate of the SUNY at Stony Brook School of Medicine. It compares CAI programs available from Ohio State University and Massachusetts General Hospital (accessed by telephone and modem), and software packages purchased from the Health Sciences Consortium (MED-CAPS) and Scientific American (DISCOTEST). The comparison documents one library's experience of the cost of these programs and the use made of them by medical students, house staff, and attending physicians. It describes the space allocated for necessary equipment, as well as the marketing of CAI. Finally, in view of the decision of the National Board of Medical Examiners to administer the Part III examination on computer (the so-called CBX) starting in 1988, the paper speculates on the future importance of CAI in the community teaching hospital.

Evidence for supernova injection into the solar nebula and the decoupling of r-process nucleosynthesis.

Science.gov (United States)

Brennecka, Gregory A; Borg, Lars E; Wadhwa, Meenakshi

2013-10-22

The isotopic composition of our Solar System reflects the blending of materials derived from numerous past nucleosynthetic events, each characterized by a distinct isotopic signature. We show that the isotopic compositions of elements spanning a large mass range in the earliest formed solids in our Solar System, calcium-aluminum-rich inclusions (CAIs), are uniform, and yet distinct from the average Solar System composition. Relative to younger objects in the Solar System, CAIs contain positive r-process anomalies in isotopes A 140. This fundamental difference in the isotopic character of CAIs around mass 140 necessitates (i) the existence of multiple sources for r-process nucleosynthesis and (ii) the injection of supernova material into a reservoir untapped by CAIs. A scenario of late supernova injection into the protoplanetary disk is consistent with formation of our Solar System in an active star-forming region of the galaxy.

Sexual orientation and medical history among Iranian people with Complete Androgen Insensitivity Syndrome and Congenital Adrenal Hyperplasia.

Science.gov (United States)

Khorashad, Behzad S; Roshan, Ghasem M; Reid, Alistair G; Aghili, Zahra; Hiradfar, Mehran; Afkhamizadeh, Mozhgan; Talaei, Ali; Aarabi, Azadeh; Ghaemi, Nosrat; Taghehchian, Negin; Saberi, Hedieh; Farahi, Nazanin; Abbaszadegan, Mohammad Reza

2017-01-01

To report sexual orientation, relationship status and medical history of Iranian people with Differences of Sex Development (DSD) who were raised female. Our participants consisted of nineteen 46,XY individuals with Complete Androgen Insensitivity Syndrome (CAIS) and eighteen 46,XX individuals with Congenital Adrenal Hyperplasia (CAH) who were raised as females and older than 13years. As well as their relationship status and detailed medical history, an expert psychiatrist assessed their sexual orientation by a semi-structured psychiatric interview with them and, where applicable, their parents. Five percent of CAH participants and 42% of CAIS participants were in a relationship, which was significantly different. All CAH individuals had been diagnosed at birth; 89% of CAIS had been diagnosed after puberty and due to primary amenorrhea and 11% were diagnosed in childhood due to inguinal hernia. Genital reconstructive surgery had been performed in 100% of CAH participants and 37% of CAIS. Regarding sexual contact experiences and sexual fantasies (androphilic, gynephilic or both), no significant differences were found. However, CAH females had significantly more gynephilic dreams (P=0.045). This study, notable as one of the rare from a non-western culture, described sexual, medical and socioeconomic status of 46,XX CAH and 46,XY CAIS individuals living in Iran. Although broadly in line with previous findings from Western cultures, Iranian CAH individuals had fewer romantic relationships, but in contrast to previous studies their sexual orientation was only different from CAIS in the contents of sexual dreams. Copyright © 2016 Elsevier Inc. All rights reserved.

Role of sarcoplasmic reticulum calcium in development of secondary calcium rise and early afterdepolarizations in long QT syndrome rabbit model.

Directory of Open Access Journals (Sweden)

Po-Cheng Chang

Full Text Available L-type calcium current reactivation plays an important role in development of early afterdepolarizations (EADs and torsades de pointes (TdP. Secondary intracellular calcium (Cai rise is associated with initiation of EADs.To test whether inhibition of sarcoplasmic reticulum (SR Ca2+ cycling suppresses secondary Cai rise and genesis of EADs.Langendorff perfusion and dual voltage and Cai optical mapping were conducted in 10 rabbit hearts. Atrioventricular block (AVB was created by radiofrequency ablation. After baseline studies, E4031, SR Ca2+ cycling inhibitors (ryanodine plus thapsigargin and nifedipine were then administrated subsequently, and the protocols were repeated.At baseline, there was no spontaneous or pacing-induced TdP. After E4031 administration, action potential duration (APD was significantly prolonged and the amplitude of secondary Cai rise was enhanced, and 7 (70% rabbits developed spontaneous or pacing-induced TdP. In the presence of ryanodine plus thapsigargin, TdP inducibility was significantly reduced (2 hearts, 20%, p = 0.03. Although APD was significantly prolonged (from 298 ± 30 ms to 457 ± 75 ms at pacing cycle length of 1000 m, p = 0.007 by ryanodine plus thapsigargin, the secondary Cai rise was suppressed (from 8.8 ± 2.6% to 1.2 ± 0.9%, p = 0.02. Nifedipine inhibited TdP inducibility in all rabbit hearts.In this AVB and long QT rabbit model, inhibition of SR Ca2+ cycyling reduces the inducibility of TdP. The mechanism might be suppression of secondary Cai rise and genesis of EADs.

Internet marketing directed at children on food and restaurant websites in two policy environments.

Science.gov (United States)

Kent, M Potvin; Dubois, L; Kent, E A; Wanless, A J

2013-04-01

Food and beverage marketing has been associated with childhood obesity yet little research has examined the influence of advertising policy on children's exposure to food/beverage marketing on the Internet. The purpose of this study was to assess the influence of Quebec's Consumer Protection Act and the self-regulatory Canadian Children's Food and Beverage Advertising Initiative (CAI) on food manufacturer and restaurant websites in Canada. A content analysis of 147 French and English language food and restaurant websites was undertaken. The presence of child-directed content was assessed and an analysis of marketing features, games and activities, child protection features, and the promotion of healthy lifestyle messages was then examined on those sites with child-directed content. There were statistically no fewer French language websites (n = 22) with child-directed content compared to English language websites (n = 27). There were no statistically significant differences in the number of the various marketing features, or in the average number of marketing features between the English and French websites. There were no fewer CAI websites (n = 14) with child-directed content compared to non-CAI websites (n = 13). The CAI sites had more healthy lifestyle messages and child protection features compared to the non-CAI sites. Systematic surveillance of the Consumer Protection Act in Quebec is recommended. In the rest of Canada, the CAI needs to be significantly expanded or replaced by regulatory measures to adequately protect children from the marketing of foods/beverages high in fat, sugar, and sodium on the Internet. Copyright © 2012 The Obesity Society.

[The application of new technologies to solving maths problems for students with learning disabilities: the 'underwater school'].

Science.gov (United States)

Miranda-Casas, A; Marco-Taverner, R; Soriano-Ferrer, M; Melià de Alba, A; Simó-Casañ, P

2008-01-01

Different procedures have demonstrated efficacy to teach cognitive and metacognitive strategies to problem solving in mathematics. Some studies have used computer-based problem solving instructional programs. To analyze in students with learning disabilities the efficacy of a cognitive strategies training for problem solving, with three instructional delivery formats: a teacher-directed program (T-D), a computer-assisted instructional (CAI) program, and a combined program (T-D + CAI). Forty-four children with mathematics learning disabilities, between 8 and 10 years old participated in this study. The children were randomly assigned to one of the three instructional formats and a control group without cognitive strategies training. In the three instructional conditions which were compared all the students learnt problems solving linguistic and visual cognitive strategies trough the self-instructional procedure. Several types of measurements were used for analysing the possible differential efficacy of the three instructional methods implemented: solving problems tests, marks in mathematics, internal achievement responsibility scale, and school behaviours teacher ratings. Our findings show that the T-D training group and the T-D + CAI group improved significantly on math word problem solving and on marks in Maths from pre- to post-testing. In addition, the results indicated that the students of the T-D + CAI group solved more real-life problems and developed more internal attributions compared to both control and CAI groups. Finally, with regard to school behaviours, improvements in school adjustment and learning problems were observed in the students of the group with a combined instructional format (T-D + CAI).

¿El sentido del humor, tiene sentido en el aula? / Does Sense of the Humor Make Sense in the Classroom?

Directory of Open Access Journals (Sweden)

Freddy Antonio González Ynfante

2011-11-01

Full Text Available Recibido 09 de junio de 2011 • Aceptado 24 de octubre de 2011 • Corregido 27 de setiembre de 2011 Resumen. El presente ensayo tiene como finalidad reflexionar sobre la importancia del humor pedagógico como estrategia de enseñanza aprendizaje en el aula; esto, tomando en cuenta la problemática de desmotivación y aburrimiento que sucede normalmente en la clase. Para plantear si “el enseñar contento y el aprender con alegría” pueden aumentar la eficacia en el proceso de enseñanza-aprendizaje, se abordará cómo, a pesar de las múltiples ventajas que puede aportar el humor en las aulas, se omite su empleo por la existencia de ciertos prejuicios y temores. La idea no es que los docentes hagan el papel de comediantes o payasos, sino la de mediar y acercar la clase de manera pedagógica y didáctica a través del uso del humor, y sobre esto reflexionaba Platón (1992, cuando planteaba que muchas veces ayudaba una broma, en donde la seriedad oponía resistencia. Abstract. This paper studies the importance of humor as a teaching strategy in the classroom, considering the usual lack of motivation and boredom. To analyze whether the “happy teaching and happy learning” may increase effectiveness in the teaching-learning process, the author will discuss how, despite the many benefits it may bring, humor is not used in the classroom due to prejudices and fears. The idea is not for teachers to play the role of a comedian or a clown, but to intervene and get closer to the group with a teaching, didactic purpose through humor. Plato (1992 thought about this; he used to say that sometimes a joke may help, where seriousness put up resistance.

The absolute chronology and thermal processing of solids in the solar protoplanetary disk

DEFF Research Database (Denmark)

Connelly, James; Bizzarro, Martin; Krot, Alexander N.

2012-01-01

Transient heating events that formed calcium-aluminum - rich inclusions (CAIs) and chondrules are fundamental processes in the evolution of the solar protoplanetary disk, but their chronology is not understood. Using U-corrected Pb-Pb dating, we determined absolute ages of individual CAIs and cho...

The effects of computer-assisted instruction on the mathematics performance and classroom behavior of children with ADHD.

Science.gov (United States)

Mautone, Jennifer A; DuPaul, George J; Jitendra, Asha K

2005-08-01

The present study examines the effects of computer-assisted instruction (CAI) on the mathematics performance and classroom behavior of three second-through fourth-grade students with ADHD. A controlled case study is used to evaluate the effects of the computer software on participants' mathematics performance and on-task behavior. Participants' mathematics achievement improve and their on-task behavior increase during the CAI sessions relative to independent seatwork conditions. In addition, students and teachers consider CAI to be an acceptable intervention for some students with ADHD who are having difficulty with mathematics. Implications of these results for practice and research are discussed.

SOLAR WIND IMPLANTATION MODEL FOR 10Be IN CALCIUM-ALUMINUM INCLUSIONS

International Nuclear Information System (INIS)

Bricker, Glynn E.; Caffee, Marc W.

2010-01-01

We propose a model for the incorporation of 10 Be within calcium-aluminum inclusions (CAIs) in primitive carbonaceous meteorites. In this model, 10 Be is produced by energetic particle reactions in the proto-solar atmosphere of a more active proto-Sun characterized by energetic particle fluxes higher than contemporary particle fluxes. This 10 Be is incorporated into the solar wind that is then implanted into CAI precursor material. This production mechanism is operational in the contemporary solar system implanting 10 Be in lunar materials. The contemporary production rate of 10 Be at the surface of the Sun is ∼0.1 10 Be cm -2 s -1 . Scaling up the contemporary 10 Be production in the proto-Sun by a factor of 10 5 would increase the production rate to 10 410 Be cm -2 s -1 . Using this enhanced production value in conjunction with refractory mass inflow rates at 0.06 AU from the proto-Sun we model 10 Be concentrations in CAI precursors. We calculate the content of solar-wind-implanted 10 Be would have been of the order of 10 1210 Be g -1 in CAIs, consistent with initial 10 Be content found from boron-beryllium isotopic systematics in CAIs.

Modulation of the Fibularis Longus Hoffmann Reflex and Postural Instability Associated With Chronic Ankle Instability

Science.gov (United States)

Kim, Kyung-Min; Hart, Joseph M.; Saliba, Susan A.; Hertel, Jay

2016-01-01

Context: Individuals with chronic ankle instability (CAI) present with decreased modulation of the Hoffmann reflex (H-reflex) from a simple to a more challenging task. The neural alteration is associated with impaired postural control, but the relationship has not been investigated in individuals with CAI. Objective: To determine differences in H-reflex modulation and postural control between individuals with or without CAI and to identify if they are correlated in individuals with CAI. Design: Descriptive laboratory study. Setting: Laboratory. Patients or Other Participants: A total of 15 volunteers with CAI (9 males, 6 females; age = 22.6 ± 5.8 years, height = 174.7 ± 8.1 cm, mass = 74.9 ± 12.8 kg) and 15 healthy sex-matched volunteers serving as controls (9 males, 6 females; age = 23.8 ± 5.8 years, height = 171.9 ± 9.9 cm, mass = 68.9 ± 15.5 kg) participated. Intervention(s): Maximum H-reflex (Hmax) and motor wave (Mmax) from the soleus and fibularis longus were recorded while participants lay prone and then stood in unipedal stance. We assessed postural tasks of unipedal stance with participants' eyes closed for 10 seconds using a forceplate. Main Outcome Measure(s): We normalized Hmax to Mmax to obtain Hmax : Mmax ratios for the 2 positions. For each muscle, H-reflex modulation was quantified using the percentage change scores in Hmax : Mmax ratios calculated from prone position to unipedal stance. Center-of-pressure data were used to compute 4 time-to-boundary variables. Separate independent-samples t tests were performed to determine group differences. Pearson product moment correlation coefficients were calculated between the modulation and balance measures in the CAI group. Results: The CAI group presented less H-reflex modulation in the soleus (t26 = −3.77, P = .001) and fibularis longus (t25 = −2.59, P = .02). The mean of the time-to-boundary minima in the anteroposterior direction was lower in the CAI group (t28 = −2.06, P = .048

Intelligent Computer-Assisted Instruction: A Review and Assessment of ICAI Research and Its Potential for Education.

Science.gov (United States)

Dede, Christopher J.; And Others

The first of five sections in this report places intelligent computer-assisted instruction (ICAI) in its historical context through discussions of traditional computer-assisted instruction (CAI) linear and branching programs; TICCIT and PLATO IV, two CAI demonstration projects funded by the National Science Foundation; generative programs, the…

Ionized calcium measurements are influenced by albumin - should ionized calcium be corrected?

DEFF Research Database (Denmark)

Larsen, Trine R; Galthen-Sørensen, Mathias; Antonsen, Steen

2014-01-01

Abstract Measurement of ionized calcium (CaI) has been reported to be dependent on albumin concentration. We examined the correlation between albumin and CaI measured on different ion selective electrode analyzers and in different groups of patients in a large dataset, extracted from the laboratory...

A companion agent for automated training systems

NARCIS (Netherlands)

Buiël, E.F.T.; Lubbers, J.

2007-01-01

TNO Defence, Security & Safety has a long history of applied research in the area of automated simulator-based training by means of Computer-Assisted Instruction (CAI). Traditionally, a CAI system does not enable a true dialogue between the learner and the virtual instructor. Most frequently, the

Corporate Involvement in C AI

Science.gov (United States)

Baker, Justine C.

1978-01-01

Historic perspective of computer manufacturers and their contribution to CAI. Corporate CAI products and services are mentioned, as is a forecast for educational involvement by computer corporations. A chart of major computer corporations shows gross sales, net earnings, products and services offered, and other corporate information. (RAO)

Depolarization by K+ and glutamate activates different neurotransmitter release mechanisms in GABAergic neurons: vesicular versus non-vesicular release of GABA

DEFF Research Database (Denmark)

Belhage, B; Hansen, Gert Helge; Schousboe, A

1993-01-01

differences in the mode of action of the two depolarizing stimuli were reflected in the properties of the increase in [Ca++]i elicited by 55 mM K+ and 100 microM glutamate, respectively. The K(+)-induced increase in [Ca++]i was reduced by both verapamil and Ca(++)-free media whereas the corresponding...... neurotransmitter glutamate (100 microM). Both depolarizing stimuli exerted prompt increases in the release of preloaded [3H]GABA as well as in [Ca++]i. However, the basic properties of transmitter release and the increase in [Ca++]i under a variety of conditions were different during stimulation with K...... was also reduced by organic (verapamil) and inorganic (Co++) Ca++ channel blockers but was insensitive to the GABA transport inhibitor SKF 89976A. In contrast, the second phase was less sensitive to nocodazole and Ca++ channel antagonists but could be inhibited by SKF 89976A. The glutamate-induced [3H...

Receipt and Perpetration of Intimate Partner Violence and Condomless Anal Intercourse Among Gay and Bisexual Men in Atlanta.

Science.gov (United States)

Stephenson, Rob; Finneran, Catherine

2017-08-01

Intimate partner violence (IPV) rates are disproportionately high among sexual minority populations, with increasing evident that gay men experience IPV at the same rates as heterosexual women. This study examines the relationship between self-reported condomless anal intercourse (CAI) and IPV among a sample of 750 gay and bisexual men. Participants answered questions regarding recent receipt and perpetration of IPV using the IPV-GBM Scale (Cronbach Alpha 0.90). Of the sample, 46.1% reported recent receipt of any type of IPV and 33.6% reported recent perpetration of any type of IPV. Overall, 55.1% of participants reported CAI at last sex. Significant associations were determined between several forms of IPV and increased odds of reporting CAI at last sex. These findings suggest that IPV may be a risk factor for CAI among men who have sex with men, and highlight the need to understand the IPV prevention and care needs of this population.

Predicting Manual Therapy Treatment Success in Patients With Chronic Ankle Instability: Improving Self-Reported Function.

Science.gov (United States)

Wikstrom, Erik A; McKeon, Patrick O

2017-04-01

  Therapeutic modalities that stimulate sensory receptors around the foot-ankle complex improve chronic ankle instability (CAI)-associated impairments. However, not all patients have equal responses to these modalities. Identifying predictors of treatment success could improve clinician efficiency when treating patients with CAI.   To conduct a response analysis on existing data to identify predictors of improved self-reported function in patients with CAI.   Secondary analysis of a randomized controlled clinical trial.   Sports medicine research laboratories.   Fifty-nine patients with CAI, which was defined in accordance with the International Ankle Consortium recommendations.   Participants were randomized into 3 treatment groups (plantar massage [PM], ankle-joint mobilization [AJM], or calf stretching [CS]) that received six 5-minute treatments over 2 weeks.   Treatment success, defined as a patient exceeding the minimally clinically important difference of the Foot and Ankle Ability Measure-Sport (FAAM-S).   Patients with ≤5 recurrent sprains and ≤82.73% on the Foot and Ankle Ability Measure had a 98% probability of having a meaningful FAAM-S improvement after AJM. As well, ≥5 balance errors demonstrated 98% probability of meaningful FAAM-S improvements from AJM. Patients <22 years old and with ≤9.9 cm of dorsiflexion had a 99% probability of a meaningful FAAM-S improvement after PM. Also, those who made ≥2 single-limb-stance errors had a 98% probability of a meaningful FAAM-S improvement from PM. Patients with ≤53.1% on the FAAM-S had an 83% probability of a meaningful FAAM-S improvement after CS.   Each sensory-targeted ankle-rehabilitation strategy resulted in a unique combination of predictors of success for patients with CAI. Specific indicators of success with AJM were deficits in self-reported function, single-limb balance, and <5 previous sprains. Age, weight-bearing-dorsiflexion restrictions, and single-limb balance

Hydroxylamine-O-sulfonamide is a versatile lead compound for the development of carbonic anhydrase inhibitors.

Science.gov (United States)

Di Fiore, Anna; Vergara, Alessandro; Caterino, Marco; Alterio, Vincenzo; Monti, Simona M; Ombouma, Joanna; Dumy, Pascal; Vullo, Daniela; Supuran, Claudiu T; Winum, Jean-Yves; De Simone, Giuseppina

2015-07-21

Hydroxylamine-O-sulfonamide, a molecule incorporating two zinc-binding groups (ZBGs), has been investigated as a carbonic anhydrase inhibitor (CAI) by means of kinetic, crystallographic and Raman spectroscopy studies, highlighting interesting results on its mechanism of action. These data can be exploited to design new, effective and selective CAIs.

Computer-Assisted Instruction: A Case Study of Two Charter Schools

Science.gov (United States)

Keengwe, Jared; Hussein, Farhan

2013-01-01

The purpose of this study was to examine the relationship in achievement gap between English language learners (ELLs) utilizing computer-assisted instruction (CAI) in the classroom, and ELLs relying solely on traditional classroom instruction. The study findings showed that students using CAI to supplement traditional lectures performed better…

The Use of Modular Computer-Based Lessons in a Modification of the Classical Introductory Course in Organic Chemistry.

Science.gov (United States)

Stotter, Philip L.; Culp, George H.

An experimental course in organic chemistry utilized computer-assisted instructional (CAI) techniques. The CAI lessons provided tutorial drill and practice and simulated experiments and reactions. The Conversational Language for Instruction and Computing was used, along with a CDC 6400-6600 system; students scheduled and completed the lessons at…

Intracellular calcium and the mechanism of anodal supernormal excitability in langendorff perfused rabbit ventricles.

Science.gov (United States)

Joung, Boyoung; Park, Hyung-Wook; Maruyama, Mitsunori; Tang, Liang; Song, Juan; Han, Seongwook; Piccirillo, Gianfranco; Weiss, James N; Lin, Shien-Fong; Chen, Peng-Sheng

2011-01-01

Anodal stimulation hyperpolarizes the cell membrane and increases the intracellular Ca(2+) (Ca(i)) transient. This study tested the hypothesis that the maximum slope of the Ca(i) decline (-(dCa(i)/dt)(max)) corresponds to the timing of anodal dip on the strength-interval curve and the initiation of repetitive responses and ventricular fibrillation (VF) after a premature stimulus (S(2)). We simultaneously mapped the membrane potential (V(m)) and Ca(i) in 23 rabbit ventricles. A dip in the anodal strength-interval curve was observed. During the anodal dip, ventricles were captured by anodal break excitation directly under the S(2) electrode. The Ca(i) following anodal stimuli is larger than that following cathodal stimuli. The S(1)-S(2) intervals of the anodal dip (203±10 ms) coincided with the -(dCa(i)/dt)(max) (199±10 ms, P=NS). BAPTA-AM (n=3), inhibition of the electrogenic Na(+)-Ca(2+) exchanger current (I(NCX)) by low extracellular Na(+) (n=3), and combined ryanodine and thapsigargin infusion (n=2) eliminated the anodal supernormality. Strong S(2) during the relative refractory period (n=5) induced 29 repetitive responses and 10 VF episodes. The interval between S(2) and the first non-driven beat was coincidental with the time of -(dCa(i)/dt)(max). Larger Ca(i) transient and I(NCX) activation induced by anodal stimulation produces anodal supernormality. The time of maximum I(NCX) activation is coincidental to the induction of non-driven beats from the Ca(i) sinkhole after a strong premature stimulation. All rights are reserved to the Japanese Circulation Society.

Kinetic Compensations due to Chronic Ankle Instability during Landing and Jumping.

Science.gov (United States)

Kim, Hyunsoo; Son, S Jun; Seeley, Matthew K; Hopkins, J Ty

2018-02-01

Skeletal muscles absorb and transfer kinetic energy during landing and jumping, which are common requirements of various forms of physical activity. Chronic ankle instability (CAI) is associated with impaired neuromuscular control and dynamic stability of the lower extremity. Little is known regarding an intralimb, lower-extremity joint coordination of kinetics during landing and jumping for CAI patients. We investigated the effect of CAI on lower-extremity joint stiffness and kinetic and energetic patterns across the ground contact phase of landing and jumping. One hundred CAI patients and 100 matched able-bodied controls performed five trials of a landing and jumping task (a maximal vertical forward jump, landing on a force plate with the test leg only, and immediate lateral jump toward the contralateral side). Functional analyses of variance and independent t-tests were used to evaluate between-group differences for lower-extremity net internal joint moment, power, and stiffness throughout the entire ground contact phase of landing and jumping. Relative to the control group, the CAI group revealed (i) reduced plantarflexion and knee extension and increased hip extension moments; (ii) reduced ankle and knee eccentric and concentric power, and increased hip eccentric and concentric power, and (iii) reduced ankle and knee joint stiffness and increased hip joint stiffness during the task. CAI patients seemed to use a hip-dominant strategy by increasing the hip extension moment, stiffness, and eccentric and concentric power during landing and jumping. This apparent compensation may be due to decreased capabilities to produce sufficient joint moment, stiffness, and power at the ankle and knee. These differences might have injury risk and performance implications.

Gait kinematics of subjects with ankle instability using a multisegmented foot model.

Science.gov (United States)

De Ridder, Roel; Willems, Tine; Vanrenterghem, Jos; Robinson, Mark; Pataky, Todd; Roosen, Philip

2013-11-01

Many patients who sustain an acute lateral ankle sprain develop chronic ankle instability (CAI). Altered ankle kinematics have been reported to play a role in the underlying mechanisms of CAI. In previous studies, however, the foot was modeled as one rigid segment, ignoring the complexity of the ankle and foot anatomy and kinematics. The purpose of this study was to evaluate stance phase kinematics of subjects with CAI, copers, and controls during walking and running using both a rigid and a multisegmented foot model. Foot and ankle kinematics of 77 subjects (29 subjects with self-reported CAI, 24 copers, and 24 controls) were measured during barefoot walking and running using a rigid foot model and a six-segment Ghent Foot Model. Data were collected on a 20-m-long instrumented runway embedded with a force plate and a six-camera optoelectronic system. Groups were compared using statistical parametric mapping. Both the CAI and the coper group showed similar differences during midstance and late stance compared with the control group (P foot segment showed a more everted position during walking compared with the control group. Based on the Ghent Foot Model, the rear foot also showed a more everted position during running. The medial forefoot showed a more inverted position for both running and walking compared with the control group. Our study revealed significant midstance and late stance differences in rigid foot, rear foot, and medial forefoot kinematics The multisegmented foot model demonstrated intricate behavior of the foot that is not detectable with rigid foot modeling. Further research using these models is necessary to expand knowledge of foot kinematics in subjects with CAI.

Hypopituitarism: growth hormone and corticotropin deficiency.

Science.gov (United States)

Capatina, Cristina; Wass, John A H

2015-03-01

This article presents an overview of adult growth hormone deficiency (AGHD) and corticotropin deficiency (central adrenal failure, CAI). Both conditions can result from various ailments affecting the hypothalamus or pituitary gland (most frequently a tumor in the area or its treatment). Clinical manifestations are subtle in AGHD but potentially life-threatening in CAI. The diagnosis needs dynamic testing in most cases. Treatment of AGHD is recommended in patients with documented severe deficiency, and treatment of CAI is mandatory in all cases. Despite significant progress in replacement hormonal therapy, more physiologic treatments and more reliable indicators of treatment adequacy are still needed. Copyright © 2015 Elsevier Inc. All rights reserved.

Computer-Assisted Mathematics Instruction for Students with Specific Learning Disability: A Review of the Literature

Science.gov (United States)

Stultz, Sherry L.

2017-01-01

This review was conducted to evaluate the current body of scholarly research regarding the use of computer-assisted instruction (CAI) to teach mathematics to students with specific learning disability (SLD). For many years, computers are utilized for educational purposes. However, the effectiveness of CAI for teaching mathematics to this specific…

A Method for Evaluating Competency in Assessment and Management of Suicide Risk

Science.gov (United States)

Hung, Erick K.; Binder, Renee L.; Fordwood, Samantha R.; Hall, Stephen E.; Cramer, Robert J.; McNiel, Dale E.

2012-01-01

Objective: Although health professionals increasingly are expected to be able to assess and manage patients' risk for suicide, few methods are available to evaluate this competency. This report describes development of a competency-assessment instrument for suicide risk-assessment (CAI-S), and evaluates its use in an objective structured clinical…

A Comparison of Computer-Assisted Instruction and Tutorials in Hematology and Oncology.

Science.gov (United States)

Garrett, T. J.; And Others

1987-01-01

A study comparing the effectiveness of computer-assisted instruction (CAI) and small group instruction found no significant difference in medical student achievement in oncology but higher achievement through small-group instruction in hematology. Students did not view CAI as more effective, but saw it as a supplement to traditional methods. (MSE)

The Impact of Computer Assisted Instruction As It Relates to Learning Disabled Adults in California Community Colleges.

Science.gov (United States)

Brower, Mary Jo

A study was conducted to determine the advantages and disadvantages of using computer-assisted instruction (CAI) with learning disabled (LD) adults attending California community colleges. A questionnaire survey of the directors of the LD programs solicited information on the availability of CAI for LD adults, methods of course advertisement,…

Adaptive Machine Aids to Learning.

Science.gov (United States)

Starkweather, John A.

With emphasis on man-machine relationships and on machine evolution, computer-assisted instruction (CAI) is examined in this paper. The discussion includes the background of machine assistance to learning, the current status of CAI, directions of development, the development of criteria for successful instruction, meeting the needs of users,…

Inventory and state of activity of rockglaciers in the Ile and Kungöy Ranges of Northern Tien Shan from satellite SAR interferometry

Science.gov (United States)

Strozzi, Tazio; Caduff, Rafael; Kääb, Andreas; Bolch, Tobias

2017-04-01

The best visual expression of mountain permafrost are rockglaciers, which, in contrast to the permafrost itself, can be mapped and monitored directly using remotely sensed data. Studies carried out in various parts of the European Alps have shown surface acceleration of rockglaciers and even destabilization of several such landforms over the two last decades, potentially related to the changing permafrost creep conditions. Changes in rockglacier motion are therefore believed to be the most indicative short- to medium-term response of rockglaciers to environmental changes and thus an indicator of mountain permafrost conditions in general. The ESA DUE GlobPermafrost project develops, validates and implements EO products to support research communities and international organizations in their work on better understanding permafrost characteristics and dynamics. Within this project we are building up a worldwide long-term monitoring network of active rockglacier motion investigated using remote sensing techniques. All sites are analysed through a uniform set of data and methods, and results are thus comparable. In order to quantify the rate of movement and the relative changes over time we consider two remote sensing methods: (i) matching of repeat optical data and (ii) satellite radar interferometry. In this contribution, we focus on the potential of recent high spatial resolution SAR data for the analysis of periglacial processes in mountain environments with special attention to the Ile and Kungöy Ranges of Northern Tien Shan at the border between Kazakhstan and Kyrgyzstan, an area which contains a high number of large and comparably fast (> 1m/yr) rockglaciers and is of interest as dry-season water resource and source of natural hazards. As demonstrated in the past with investigations conducted in the Swiss Alps, the visual analysis of differential SAR interferograms can be employed for the rough estimation of the surface deformation rates of rockglaciers and

Effects of reduced plantar cutaneous sensation on static postural control in individuals with and without chronic ankle instability.

Science.gov (United States)

Song, Kyeongtak; Kang, Tae Kyu; Wikstrom, Erik A; Jun, Hyung-Pil; Lee, Sae Yong

2017-10-01

The purpose of this study was to determine how reduced plantar cutaneous sensation influences static postural control in individuals with and without CAI. A case-control study design. Twenty-six individuals with self-reported CAI and 26 matched healthy controls participated in this study. The plantar aspect of the participants' foot was then submersed in ice water (0°C) for 10min to reduce plantar sensation. Before and after the cooling procedure, plantar cutaneous sensation thresholds and single leg balance with eyes open and closed were assessed. Significantly, higher scores were observed in both groups after ice water submersion (ppostural control improvement in both groups post-cooling. In single limb balance with eyes closed, Group×Intervention interactions were observed for the TTB AP mean (p=0.003) and TTB AP SD (p=0.017); indicating postural control deficits in CAI group post-cooling, but no changes in the control group. The main finding of this study was that reduced plantar cutaneous sensation induced by an ice submersion procedure caused eyes closed postural control impairments in those with CAI but not healthy controls. The present investigation demonstrated that the ability to dynamically reweight among sensory inputs to maintain postural stability appears to be diminished in CAI patients compared to healthy controls. Copyright © 2016. Published by Elsevier Ltd.

CORRELATION OF {sup 48}Ca, {sup 50}Ti, AND {sup 138}La HETEROGENEITY IN THE ALLENDE REFRACTORY INCLUSIONS

Energy Technology Data Exchange (ETDEWEB)

Chen, Hsin-Wei; Lee, Typhoon; Lee, Der-Chuen; Chen, Jiang-Chang, E-mail: hart.chen@bristol.ac.uk [Institute of Earth Sciences, Academia Sinica, Taipei, Taiwan, ROC (China)

2015-06-10

Precise determinations of {sup 48}Ca anomalies in Allende calcium–aluminum-rich inclusions (CAIs) are reported in this work. There are endemic positive {sup 48}Ca/{sup 44}Ca anomalies in all analyzed CAIs after normalization to {sup 42}Ca/{sup 44}Ca, and it is clearly shown that there is no simple correlation between {sup 48}Ca/{sup 44}Ca and {sup 50}Ti/{sup 48}Ti anomalies, in agreement with Jungck et al. Compared to the {sup 48}Ca/{sup 44}Ca versus {sup 50}Ti/{sup 48}Ti correlation line defined by differentiated meteorites, reported by Chen et al., the CAIs plot to elevated {sup 50}Ti/{sup 48}Ti. Assuming the {sup 48}Ca/{sup 44}Ca anomalies of both CAIs and differentiated meteorites came from the same source, excess {sup 50}Ti anomalies in CAIs can be calculated by subtracting the part associated with {sup 48}Ca/{sup 44}Ca. These excesses show a linear correlation with {sup 138}La anomalies, a neutrino-process nuclide. According to current stellar nucleosynthetic models, we therefore suggest that the solar system {sup 48}Ca, {sup 50}Ti, and {sup 138}La isotopic variations are made of mixtures between grains condensed from ejecta of neutron-rich accretion-induced SNe Ia and the O/Ne–O/C zone of core-collapse SNe II.

Controlled air incineration of hazardous chemical and mixed waste at Los Alamos

International Nuclear Information System (INIS)

Borduin, L.C.; Hutchins, D.A.; Vavruska, J.J.; Warner, C.L.

1987-01-01

The Los Alamos National Laboratory (LANL) Controlled Air Incineration (CAI) system, originally developed for transuranic (TRU) waste volume reduction studies, is currently being qualified for hazardous chemical and mixed waste treatment under provisions of the Resource Conservation and Recovery Act (RCRA). The objective is to obtain a permanent RCRA Part B permit for thermal disposal of hazardous and mixed wastes generated by LANL. Constructed in the mid-1970s as a demonstration project for incineration of TRU solid wastes, the CAI process was substantially modified and tested in 1980-1983 for acceptance of both liquid and solid hazardous chemicals. Successful demonstration of TRU solid waste processing objectives in 1979 and later chemical waste incineration studies have been documented in several publications. In 1984, the LANL CAI became the first US Dept. of Energy (DOE) incinerator to be permitted for polychlorinated biphenyl disposal under the Toxic Substances Control Act. Following establishment of Environmental Protection Agency (EPA) jurisdiction over DOE chemical waste management in 1984, LANL sought and was granted interim status for the CAI and applied for a trial burn permit in the overall laboratory RCRA Part B application. A trial burn and final report have been completed; results have been submitted to EPA and the New Mexico Environmental Improvement Division. This paper provides an overview of trial burn planning and results together with the operational status of LANL's CAI

Holocene River Dynamics, Climate Change and Floodwater Farming in the Watersheds of the Pamir and Tien Shan Mountains of Inner Asia

Science.gov (United States)

Macklin, M. G.; Panyushkina, I. P.; Toonen, W. H. J.

2014-12-01

The Ili, Syr Dayra and Amu Dayra rivers of Inner Asia are emerging as critical areas for the development of irrigation-based agriculture in the ancient world. Following research by Russian archaeologists in the 1970s it is evident that these watersheds had flourishing riverine civilizations comparable to those in Mesopotamia and the Indus Valley. But unlike these areas where the relationship between Holocene river dynamics, climate change and floodwater farming is increasingly underpinned by radiometric dating, the alluvial archaeology of Inner Asia is significantly under researched. To address this, a major multi-disciplinary research program was begun in 2011 centred on the Talgar catchment, a south-bank tributary of the Ili river, southeast Kazakhstan. Building on archaeological excavations and surveys conducted over the past 20 years, we have undertaken one of the most detailed investigations of Holocene people-river environment interactions in Inner Asia. River development has been reconstructed over the last 20,000 years and human settlement histories from the Eneolithic to the Medieval period documented. Periods of Holocene river aggradation and high water levels in Lake Balkhash and Aral Sea correspond with cooler and wetter neoglacial episodes while river entrenchment and floodplain soil development are associated with warmer and drier conditions. Floodwater farming in the Talgar river reached its acme in the late Iron Age (400-200 cal. BC) with more than 60 settlement sites and 550 burial mounds. This corresponds to a period of reduced flood flows, river stability and glacier retreat in the Tien Shan headwaters. A new hydroclimatic-based model for the spatial and temporal dynamics of floodwater farming in the Ili, Syr Dayra and Amu Dayra watersheds is proposed, which explains the large scale expansion (down-river) and contraction (up-river) of settlements since the first use of irrigation in the Neolithic through to the late Medieval period.

Devonian paleomagnetism of the North Tien Shan: Implications for the middle-Late Paleozoic paleogeography of Eurasia

Science.gov (United States)

Levashova, Natalia M.; Mikolaichuk, Alexander V.; McCausland, Philip J. A.; Bazhenov, Mikhail L.; Van der Voo, Rob

2007-05-01

The Ural-Mongol belt (UMB), between Siberia, Baltica and Tarim, is widely recognized as the locus of Asia's main growth during the Paleozoic, but its evolution remains highly controversial, as illustrated by the disparate paleogeographic models published in the last decade. One of the largest tectonic units of the UMB is the Kokchetav-North Tien Shan Domain (KNTD) that stretches from Tarim in the south nearly to the West Siberian Basin. The KNTD comprises several Precambrian microcontinents and numerous remnants of Early Paleozoic island arcs, marginal basins and accretionary complexes. In Late Ordovician time, all these structures had amalgamated into a single contiguous domain. Its paleogeographic position is of crucial importance for elucidating the Paleozoic evolution of the UMB in general and of the Urals in particular. The Aral Formation, located in Kyrgyzstan in the southern part of the KNTD, consists of a thick Upper Devonian (Frasnian) basalt-andesite sequence. Paleomagnetic data show a dual-polarity characteristic component (Dec/Inc = 286° / + 56°, α95 = 9°, k = 21, N = 15 sites). The primary origin of this magnetization is confirmed by a positive test on intraformational conglomerates. We combine this result with other Paleozoic data from the KNTD and show its latitudinal motion from the Late Ordovician to the end of the Paleozoic. The observed paleolatitudes are found to agree well with the values extrapolated from Baltica to a common reference point (42.5°N, 73°E) in our sampling area for the entire interval; hence coherent motion of the KNTD and Baltica is strongly indicated for most of the Paleozoic. This finding contradicts most published models of the UMB evolution, where the KNTD is separated from Baltica by a rather wide Ural Ocean containing one or more major plate boundaries. An exception is the model of Şengör and Natal'in [A.M.C. Şengör, B.A. Natal'in, Paleotectonics of Asia: fragments of a synthesis, in: A. Yin and M. Harrison (eds

Origins of mass-dependent and mass-independent Ca isotope variations in meteoritic components and meteorites

Science.gov (United States)

Bermingham, K. R.; Gussone, N.; Mezger, K.; Krause, J.

2018-04-01

The Ca isotope composition of meteorites and their components may vary due to mass-dependent and/or -independent isotope effects. In order to evaluate the origin of these effects, five amoeboid olivine aggregates (AOAs), three calcium aluminum inclusions (CAIs), five chondrules (C), a dark inclusion from Allende (CV3), two dark fragments from North West Africa 753 (NWA 753; R3.9), and a whole rock sample of Orgueil (CI1) were analyzed. This is the first coupled mass-dependent and -independent Ca isotope dataset to include AOAs, a dark inclusion, and dark fragments. Where sample masses permit, Ca isotope data are reported with corresponding petrographic analyses and rare earth element (REE) relative abundance patterns. The CAIs and AOAs are enriched in light Ca isotopes (δ44/40Ca -5.32 to +0.72, where δ44/40Ca is reported relative to SRM 915a). Samples CAI 5 and AOA 1 have anomalous Group II REE patterns. These REE and δ44/40Ca data suggest that the CAI 5 and AOA 1 compositions were set via kinetic isotope fractionation during condensation and evaporation. The remaining samples show mass-dependent Ca isotope variations which cluster between δ44/40Ca +0.53 and +1.59, some of which are coupled with unfractionated REE abundance patterns. These meteoritic components likely formed through the coaccretion of the evaporative residue and condensate following Group II CAI formation or their chemical and isotopic signatures were decoupled (e.g., via nebular or parent-body alteration). The whole rock sample of Orgueil has a δ44/40Ca +0.67 ± 0.18 which is in agreement with most published data. Parent-body alteration, terrestrial alteration, and variable sampling of Ca-rich meteoritic components can have an effect on δ44/40Ca compositions in whole rock meteorites. Samples AOA 1, CAI 5, C 2, and C 4 display mass-independent 48/44Ca anomalies (ε48/44Ca +6 to +12) which are resolved from the standard composition. Other samples measured for these effects (AOA 5, CAI 1, CAI 2

The First Expert CAI System

Science.gov (United States)

Feurzeig, Wallace

1984-01-01

The first expert instructional system, the Socratic System, was developed in 1964. One of the earliest applications of this system was in the area of differential diagnosis in clinical medicine. The power of the underlying instructional paradigm was demonstrated and the potential of the approach for valuably supplementing medical instruction was recognized. Twenty years later, despite further educationally significant advances in expert systems technology and enormous reductions in the cost of computers, expert instructional methods have found very little application in medical schools.

Secondary School Students' Attitudes towards Mathematics Computer--Assisted Instruction Environment in Kenya

Science.gov (United States)

Mwei, Philip K.; Wando, Dave; Too, Jackson K.

2012-01-01

This paper reports the results of research conducted in six classes (Form IV) with 205 students with a sample of 94 respondents. Data represent students' statements that describe (a) the role of Mathematics teachers in a computer-assisted instruction (CAI) environment and (b) effectiveness of CAI in Mathematics instruction. The results indicated…

Keeping the Focus on Underserved Students, Privilege, and Power: A Reaction to Clements and Sarama

Science.gov (United States)

Kitchen, Richard; Berk, Sarabeth

2017-01-01

In our response to Clements and Sarama (2017), we address the 5 issues that they identify as criticisms of our Research Commentary (Kitchen & Berk, 2016). As in our original commentary, we highlight concerns we have regarding the delivery of [computer-assisted instruction] CAI programs and potential misuses of CAI, particularly at Title I…

Computer-Assisted Instruction to Teach DOS Commands: A Pilot Study.

Science.gov (United States)

McWeeney, Mark G.

1992-01-01

Describes a computer-assisted instruction (CAI) program used to teach DOS commands. Pretest and posttest results for 65 graduate students using the program are reported, and it is concluded that the CAI program significantly aided the students. Sample screen displays for the program and several questions from the pre/posttest are included. (nine…

Computer-Assisted Instruction: Authoring Languages. ERIC Digest.

Science.gov (United States)

Reeves, Thomas C.

One of the most perplexing tasks in producing computer-assisted instruction (CAI) is the authoring process. Authoring is generally defined as the process of turning the flowcharts, control algorithms, format sheets, and other documentation of a CAI program's design into computer code that will operationalize the simulation on the delivery system.…

Concepto y aplicación práctica que dan los profesores de química a la evaluación final, análisis de falencias y potencialidades que tiene en el proceso de enseñanza y de aprendizaje

Directory of Open Access Journals (Sweden)

Diana Martínez

2009-10-01

Full Text Available Con el objetivo de analizar qué imagen, concepto y aplicación práctica respecto a la evaluación final tienen los profesores de nivel universitario, se realiza una pequeña indagación en la UPN, con docentes del departamento de química. Se busca entonces evidenciar algunas de las falencias y potencialidades que tiene la evaluación final en el proceso de enseñanza y de aprendizaje, con relación a tal visión, cuando finalmente esta, es el resultado de la planeación previa del profesor.

Corrective Action Investigation Plan for Corrective Action Unit 98: Frenchman Flat, Nevada Test Site, Nevada (Revision 1)

Energy Technology Data Exchange (ETDEWEB)

USDOE/NV

1999-07-01

This Corrective Action Investigation Plan (CAIP) has been developed for Frenchman Flat Corrective Action Unit (CAU) 98. The Frenchman Flat CAU is located along the eastern border of the Nevada Test Site (NTS) and includes portions of Areas 5 and 11. The Frenchman Flat CAU constitutes one of several areas of the Nevada Test Site used for underground nuclear testing in the past. The nuclear tests resulted in groundwater contamination in the vicinity as well as downgradient of the underground test areas. The CAIP describes the Corrective Action Investigation (CAI) to be conducted at the Frenchman Flat CAU to evaluate the extent of contamination in groundwater due to the underground nuclear testing. The Frenchman Flat CAI will be conducted by the Underground Test Area (UGTA) Project which is a part of the U.S. Department of Energy, Nevada Operations Office (DOE/NV) Environmental Restoration Project. The CAIP is a requirement of the Federal Facility Agreement and Consent Order (FFACO) (1996 ) agreed to by the U.S. Department of Energy (DOE), the Nevada Division of Environmental Protection (NDEP), and the U.S. Department of Defense (DoD). Based on the general definition of a CAI from Section IV.14 of the FFACO, the purpose of the CAI is ''...to gather data sufficient to characterize the nature, extent, and rate of migration or potential rate of migration from releases or discharges of pollutants or contaminants and/or potential releases or discharges from corrective action units identified at the facilities...'' (FFACO, 1996). However, for the Underground Test Area (UGTA) CAUs, ''...the objective of the CAI process is to define boundaries around each UGTA CAU that establish areas that contain water that may be unsafe for domestic and municipal use.'', as stated in Appendix VI of the FFACO (1996). According to the UGTA strategy (Appendix VI of the FFACO), the CAI of a given CAU starts with the evaluation of the existing data. New

Using symptom and interference questionnaires to identify recovery among children with anxiety disorders.

Science.gov (United States)

Evans, Rachel; Thirlwall, Kerstin; Cooper, Peter; Creswell, Cathy

2017-07-01

Questionnaires are widely used in routine clinical practice to assess treatment outcomes for children with anxiety disorders. This study was conducted to determine whether 2 widely used child and parent report questionnaires of child anxiety symptoms and interference (Spence Child Anxiety Scale [SCAS-C/P] and Child Anxiety Impact Scale [CAIS-C/P]) accurately identify recovery from common child anxiety disorder diagnoses as measured by a 'gold-standard' diagnostic interview. Three hundred thirty-seven children (7-12 years, 51% female) and their parents completed the ADIS-IV-C/P diagnostic interview and questionnaire measures (SCAS-C/P and CAIS-C/P) before (Time 1) and after (Time 2) treatment or wait-list. Time 2 parent reported interference (CAIS-P) was found to be a good predictor of absence of any diagnoses (area under the curve [AUC] = .81). In terms of specific diagnoses, Time 2 SCAS-C/P separation anxiety subscale (SCAS-C/P-SA) identified recovery from separation anxiety disorder well (SCAS-C-SA, AUC = .80; SCAS-P-SA, AUC = .82) as did the CAIS-P (AUC = .79). The CAIS-P also successfully identified recovery from social phobia (AUC = .78) and generalized anxiety disorder (AUC = .76). These AUC values were supported by moderate to good sensitivity (.70-.78) and specificity (.70-.73) at the best identified cut-off scores. None of the measures successfully identified recovery from specific phobia. The results suggest that questionnaire measures, particularly the CAIS-P, can be used to identify whether children have recovered from common anxiety disorders, with the exception of specific phobias. Cut-off scores have been identified that can guide the use of routine outcome measures in clinical practice. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

Prevalence of chronic ankle instability and associated symptoms in university dance majors: an exploratory study.

Science.gov (United States)

Simon, Janet; Hall, Emily; Docherty, Carrie

2014-01-01

Previous investigations have established that dancers suffer a large number of injuries to the lower leg, foot, and ankle, with a portion of these being significant time loss injuries or in some cases career ending. Lateral ankle sprain is a common injury in dancers and can often lead to recurrent instability and repetitive injuries. Research in other active populations has linked ankle sprains to the development of chronic ankle instability (CAI). Therefore, the purpose of this study was to identify the prevalence of CAI and related symptoms of ankle sprain in a student dance population. Individuals were included if they were currently a modern or ballet dance major at the investigators' university (exclusion criterion: a history of fracture or surgery in the lower extremities). A self-reported demographic questionnaire and the Identification of Functional Ankle Instability survey were used to identify the presence and characteristics of CAI. A total of 83 questionnaires were collected, and after exclusions, 77 participants remained: 43 modern dancers and 34 ballet dancers (10 males and 67 females, mean age 19.61 ± 2.53 years, mean dance experience 13.61 ± 3.16 years). Of all dancers surveyed, 41 (53.2%) had CAI, and of those 24 (58.5%) were modern dancers, and 17 (41.5%) were ballet dancers. When looking only at those dancers who had a previous lateral ankle sprain, 75.9% were identified as having CAI. Chronic Ankle Instability can create long-term problems for anyone but especially female dancers, who place extreme stress on their feet and ankles from being en pointe or demi-pointe. It is important to educate dancers, instructors, and medical staff of the importance of recognizing CAI and seeking medical care for ankle sprains and their residual symptoms.

Paradoxical effects of KB-R7943 on arrhythmogenicity in a chronic myocardial infarction rabbit model.

Science.gov (United States)

Chang, Po-Cheng; Wo, Hung-Ta; Lee, Hui-Ling; Wen, Ming-Shien; Chou, Chung-Chuan

2015-07-01

Na(+)/Ca(2+) exchanger blockade has been reported to be anti-arrhythmic in different models. The effects of KB-R7943, a Na(+)/Ca(2+) exchanger blocker, on arrhythmogenesis in hearts with chronic myocardial infarction (MI) remain unclear. Dual voltage and intracellular Ca(2+) (Cai) optical mapping was performed in nine rabbit hearts with chronic MI and four control hearts. Electrophysiology studies including inducibility of ventricular tachyarrhythmias, ventricular fibrillation dominant frequency, action potential, Cai alternans, Cai decay, and conduction velocity were performed. The same protocol was repeated in the presence of KB-R7943 (0.5, 1, and 5μM) after the baseline studies. KB-R7943 was effective in suppressing afterdepolarizations and spontaneous ventricular tachyarrhythmias in hearts with chronic MI. Surprisingly, KB-R7943 increased the inducibility of ventricular tachyarrhythmias in a dose-dependent manner (11%, 11%, 22%, and 56% at baseline and with 0.5, 1, and 5μM KB-R7943, respectively, p=0.02). Optical mapping analysis revealed that the underlying mechanisms of the induced ventricular tachyarrhythmias were probably spatially discordant alternans with wave breaks and rotors. Further analysis showed that KB-R7943 significantly enhanced both action potential (p=0.033) and Cai (p=0.001) alternans, prolonged Cai decay (tau value) in a dose-dependent manner (p=0.004), and caused heterogeneous conduction delay especially at peri-infarct zones during rapid burst pacing. In contrast, KB-R7943 had insignificant effects in control hearts. In this chronic MI rabbit model, KB-R7943 has contrasting effects on arrhythmogenesis, suppressing afterdepolarizations and spontaneous ventricular tachyarrhythmias, but enhancing the inducibility of tachyarrhythmias. The mechanism is probably the enhanced spatially discordant alternans because of prolonged Cai decay and heterogeneous conduction delay. Copyright © 2014 Japanese College of Cardiology. Published by Elsevier

Computer-Assisted Instruction in the N.W.T.

Science.gov (United States)

Garraway, Tom

For the past seven years, the Division of Educational Research Services at the University of Alberta has been operating an IBM 1500 CAI system. This paper describes demonstration projects set up in anticipation of the establishment of remote CAI in the North West Territories. These include a moon landing simulation program; a diagnostic program in…

Lessons learned from a community-academic initiative: the development of a core competency-based training for community-academic initiative community health workers.

Science.gov (United States)

Ruiz, Yumary; Matos, Sergio; Kapadia, Smiti; Islam, Nadia; Cusack, Arthur; Kwong, Sylvia; Trinh-Shevrin, Chau

2012-12-01

Despite the importance of community health workers (CHWs) in strategies to reduce health disparities and the call to enhance their roles in research, little information exists on how to prepare CHWs involved in community-academic initiatives (CAIs). Therefore, the New York University Prevention Research Center piloted a CAI-CHW training program. We applied a core competency framework to an existing CHW curriculum and bolstered the curriculum to include research-specific sessions. We employed diverse training methods, guided by adult learning principles and popular education philosophy. Evaluation instruments assessed changes related to confidence, intention to use learned skills, usefulness of sessions, and satisfaction with the training. Results demonstrated that a core competency-based training can successfully affect CHWs' perceived confidence and intentions to apply learned content, and can provide a larger social justice context of their role and work. This program demonstrates that a core competency-based framework coupled with CAI-research-specific skill sessions (1) provides skills that CAI-CHWs intend to use, (2) builds confidence, and (3) provides participants with a more contextualized view of client needs and CHW roles.

Cryptanalysis on a modified Baptista-type cryptosystem with chaotic masking algorithm

International Nuclear Information System (INIS)

Chen Yong; Liao Xiaofeng

2005-01-01

Based on chaotic masking algorithm, an enhanced Baptista-type cryptosystem is proposed by Li et al. to resist all known attacks [S. Li, X. Mou, Z. Ji, J. Zhang, Y. Cai, Phys. Lett. A 307 (2003) 22; S. Li, G. Chen, K.-W. Wong, X. Mou, Y. Cai, Phys. Lett. A 332 (2004) 368]. In this Letter, we show that the second class bit extracting function in [S. Li, X. Mou, Z. Ji, J. Zhang, Y. Cai, Phys. Lett. A 307 (2003) 22] still leak partial information on the current chaotic state and reduce the security of cryptosystem. So, this type bit extracting function is not a good candidate for the masking algorithm

Assessment of Relationships Between Joint Motion Quality and Postural Control in Patients With Chronic Ankle Joint Instability.

Science.gov (United States)

Bączkowicz, Dawid; Falkowski, Krzysztof; Majorczyk, Edyta

2017-08-01

Study Design Controlled laboratory study, cross-sectional. Background Lateral ankle sprains are among the most common injuries encountered during athletic participation. Following the initial injury, there is an alarmingly high risk of reinjury and development of chronic ankle instability (CAI), which is dependent on a combination of factors, including sensorimotor deficits and changes in the biomechanical environment of the ankle joint. Objective To evaluate CAI-related disturbances in arthrokinematic motion quality and postural control and the relationships between them. Methods Sixty-three male subjects (31 with CAI and 32 healthy controls) were enrolled in the study. For arthrokinematic motion quality analysis, the vibroarthrographic signals were collected during ankle flexion/extension motion using an acceleration sensor and described by variability (variance of mean squares [VMS]), amplitude (mean of 4 maximal and 4 minimal values [R4]), and frequency (vibroarthrographic signal bands of 50 to 250 Hz [P1] and 250 to 450 Hz [P2]) parameters. Using the Biodex Balance System, single-leg dynamic balance was measured by overall, anteroposterior, and mediolateral stability indices. Results Values of vibroarthrographic parameters (VMS, R4, P1 and P2) were significantly higher in the CAI group than those in the control group (Pankle arthrokinematic motion and postural control were present. Therefore, physical therapy interventions focused on improving ankle neuromuscular control and arthrokinematic function are necessary in CAI patient care. J Orthop Sports Phys Ther 2017;47(8):570-577. Epub 4 Nov 2016. doi:10.2519/jospt.2017.6836.

A new approach of the Star Excursion Balance Test to assess dynamic postural control in people complaining from chronic ankle instability.

Science.gov (United States)

Pionnier, Raphaël; Découfour, Nicolas; Barbier, Franck; Popineau, Christophe; Simoneau-Buessinger, Emilie

2016-03-01

The purpose of this study was to quantitatively and qualitatively assess dynamic balance with accuracy in individuals with chronic ankle instability (CAI). To this aim, a motion capture system was used while participants performed the Star Excursion Balance Test (SEBT). Reached distances for the 8 points of the star were automatically computed, thereby excluding any dependence to the experimenter. In addition, new relevant variables were also computed, such as absolute time needed to reach each distance, lower limb ranges of motion during unipodal stance, as well as absolute error of pointing. Velocity of the center of pressure and range of variation of ground reaction forces have also been assessed during the unipodal phase of the SEBT thanks to force plates. CAI group exhibited smaller reached distances and greater absolute error of pointing than the control group (p<0.05). Moreover, the ranges of motion of lower limbs joints, the velocity of the center of pressure and the range of variation of the ground reaction forces were all significantly smaller in the CAI group (p<0.05). These reduced quantitative and qualitative performances highlighted a lower dynamic postural control. The limited body movements and accelerations during the unipodal stance in the CAI group could highlight a protective strategy. The present findings could help clinicians to better understand the motor strategies used by CAI patients during dynamic balance and may guide the rehabilitation process. Copyright © 2016 Elsevier B.V. All rights reserved.

Carotid Artery Injury in Anterior Cervical Spine Surgery: Multicenter Cohort Study and Literature Review.

Science.gov (United States)

Härtl, Roger; Alimi, Marjan; Abdelatif Boukebir, Mohamed; Berlin, Connor D; Navarro-Ramirez, Rodrigo; Arnold, Paul M; Fehlings, Michael G; Mroz, Thomas E; Riew, K Daniel

2017-04-01

Retrospective study and literature review. To provide more comprehensive data about carotid artery injury (CAI) or cerebrovascular accident (CVA) related to anterior cervical spine surgery. We conducted a retrospective, multicenter, case series study involving 21 high-volume surgical centers from the AOSpine North America Clinical Research Network. Medical records of 17 625 patients who went through cervical spine surgery (levels from C2 to C7) between January 1, 2005, and December 31, 2011, were analyzed. Also, we performed a literature review using Medline and PubMed databases. The following terms were used alone, and in combination, to search for relevant articles: cervical, spine, surgery, complication, iatrogenic, carotid artery, injury, cerebrovascular accident, CVA, and carotid stenosis. Among 17 625 patients that were analyzed, no cases were reported to experienced CAI or CVA after cervical spine surgery. Nevertheless, in our PubMed search we found 157 articles, but only 5 articles matched our study objective criteria; 2 cases were reported to present CAI and 3 cases presented CVA. CAI and CVA related to anterior cervical spine surgeries are extremely rare. We were not able to find neither in our retrospective study nor in our literature research a correlation between the type or length of anterior cervical spine procedure with CVA or CAI complications. However, surgeons should be aware of the possibility of vascular complications and minimize intraoperative direct vascular manipulations or retraction. Preoperative screening for underlying vascular pathology and risk factors is also important.

Cortisol-dependent stress effects on cell distribution in healthy individuals and individuals suffering from chronic adrenal insufficiency.

Science.gov (United States)

Geiger, Ashley M; Pitts, Kenneth P; Feldkamp, Joachim; Kirschbaum, Clemens; Wolf, Jutta M

2015-11-01

Chronic adrenal insufficiency (CAI) is characterized by a lack of glucocorticoid and mineralocorticoid production due to destroyed adrenal cortex cells. However, elevated cortisol secretion is thought to be a central part in a well-orchestrated immune response to stress. This raises the question to what extent lack of cortisol in CAI affects stress-related changes in immune processes. To address this question, 28 CAI patients (20 females) and 18 healthy individuals (11 females) (age: 44.3 ± 8.4 years) were exposed to a psychosocial stress test (Trier Social Stress Test: TSST). Half the patients received a 0.03 mg/kg body weight injection of hydrocortisone (HC) post-TSST to mimic a healthy cortisol stress response. Catecholamines and immune cell composition were assessed in peripheral blood and free cortisol measured in saliva collected before and repeatedly after TSST. CAI patients showed norepinephrine (NE) stress responses similar to healthy participants, however, epinephrine (E) as well as cortisol levels were significantly lower. HC treatment post-TSST resulted in cortisol increases comparable to those observed in healthy participants (interaction effects--NE: F=1.05, p=.41; E: F=2.56, p=.045; cortisol: F=13.28, pcortisol's central involvement in post-stress lymphocyte migration from blood into immune-relevant body compartments. As such, future studies should investigate whether psychosocial stress exposure may put CAI patients at an increased health risk due to attenuated immune responses to pathogens. Copyright © 2015. Published by Elsevier Inc.

Analysis of meteorological data and the surface energy balance of Keqicar Glacier, Tien Shan, China

Science.gov (United States)

Zhang, Y.; Liu, S.; Fujita, K.; Han, H.; Li, J.

2009-04-01

Northwestern China currently experiences a climate change with fundamental consequences for the hydrological cycle. In the strongly arid region where water resources are essential for agriculture and food production, glaciers represent important water resources, contributing significantly to streamflow. The debris is an important glaciological feature of the region and has major impact on melt rates. It is essential to understand and quantify the interaction of climate and sub-debris melt in order to assess the current situation and to predict future water yield. Note that the surface energy balance determines glacier melt. However, little is known about the variability characteristics of the surface energy fluxes in this region. For this reason, we set up two automatic weather stuation (AWSs) in the ablation area of Keqicar Glacier. Keqicar Glacier is located in the Tarim River basin (largest inland river basin in China), southwestern Tien Shan, China. It is a representative debris-covered glacier with a length of 26.0 km and a total surface area of 83.6 km2. The thickness of the debris layer varies from 0.0 to 2.50 m in general. In some places large rocks are piled up to several meters. In this study, we report on analysis of meteorological data for the period 1 July-13 September 2003, from two automatic weather stations, aimed at studying the relationship between climate and ablation. One station is located on the lower part of the ablation area where the glacier is covered by debris layer, and the other near the equilibrium line altitude (ELA). All sensors were sampled every 10 seconds, and data were stored as hourly averages. The stations were visited regularly for maintenance at two weeks intervals depending on the weather conditions and location of the AWS. A total of 17 ablation stakes were drilled into the glacier at different elevations to monitor glacier melt during the study period. Readings were taken regularly in connection with AWS maintenance. The

Vehicle/Guideway Interaction in Maglev Systems

Science.gov (United States)

1992-03-01

Technology Division Materials and Components in Maglev Systems Technology Division Materials and Components Technology Division byY. Cai, S. S. Chen, and D. M...Transportation Systems Reports (UC-330, Vehicle/Guideway Interaction in Maglev Systems by Y. Cai and S. S. Chen Materials and Components Technology Division D. M...Surface Irregularities ...................................... 32 4 Vehicle/Guideway Interaction in Transrapid Maglev System .................. 34 4.1

Mirror Neurons, Embodied Cognitive Agents and Imitation Learning

Czech Academy of Sciences Publication Activity Database

Wiedermann, Jiří

2003-01-01

Roč. 22, č. 6 (2003), s. 545-559 ISSN 1335-9150 R&D Projects: GA ČR GA201/02/1456 Institutional research plan: CEZ:AV0Z1030915 Keywords : complete agents * mirror neurons * embodied cognition * imitation learning * sensorimotor control Subject RIV: BA - General Mathematics Impact factor: 0.254, year: 2003 http://www.cai.sk/ojs/index.php/cai/article/view/468

Existence of an 16O-rich gaseous reservoir in the solar nebula.

Science.gov (United States)

Krot, Alexander N; McKeegan, Kevin D; Leshin, Laurie A; MacPherson, Glenn J; Scott, Edward R D

2002-02-08

Carbonaceous chondrite condensate olivine grains from two distinct petrographic settings, calcium-aluminum-rich inclusion (CAI) accretionary rims and amoeboid olivine aggregates (AOAs), are oxygen-16 (16O) enriched at the level previously observed inside CAIs. This requires that the gas in the nebular region where these grains condensed was 16O-rich. This contrasts with an 16O-poor gas present during the formation of chondrules, suggesting that CAIs and AOAs formed in a spatially restricted region of the solar nebula containing 16O-rich gas. The 16O-rich gas composition may have resulted either from mass-independent isotopic chemistry or from evaporation of regions with enhanced dust/gas ratios, possibly in an X-wind environment near the young Sun.

Een speld in tien miljoen hooibergen

CERN Multimedia

Minkema, Martin

2008-01-01

Deeply under the ground in Geneva, thousands of scientists work with a giant particle accelerator. A discovery machine which will brew particles as from this summer and perhaps even create mini black holes.

Using dynamic software in mathematics: the case of reflection symmetry

Science.gov (United States)

Tatar, Enver; Akkaya, Adnan; Berrin Kağizmanli, Türkan

2014-10-01

This study was carried out to examine the effects of computer-assisted instruction (CAI) using dynamic software on the achievement of students in mathematics in the topic of reflection symmetry. The study also aimed to ascertain the pre-service mathematics teachers' opinions on the use of CAI in mathematics lessons. In the study, a mixed research method was used. The study group of this research consists of 30 pre-service mathematics teachers. The data collection tools used include a reflection knowledge test, a survey and observations. Based on the analysis of the data obtained from the study, the use of CAI had a positive effect on achievement in the topic of reflection symmetry of the pre-service mathematics teachers. The pre-service mathematics teachers were found to largely consider that a mathematics education which is carried out utilizing CAI will be more beneficial in terms of 'visualization', 'saving of time' and 'increasing interest/attention in the lesson'. In addition, it was found that the vast majority of them considered using computers in their teaching on the condition that the learning environment in which they would be operating has the appropriate technological equipment.

Refractory Inclusion Size Distribution and Fabric Measured in a Large Slab of the Allende CV3 Chondrite

Science.gov (United States)

Srinivasan, P.; Simon, Justin I.; Cuzzi, J. N.

2013-01-01

Aggregate textures of chondrites reflect accretion of early-formed particles in the solar nebula. Explanations for the size and density variations of particle populations found among chondrites are debated. Differences could have risen out of formation in different locations in the nebula, and/or they could have been caused by a sorting process [1]. Many ideas on the cause of chondrule sorting have been proposed; some including sorting by mass [2,3], by X-winds [4], turbulent concentration [5], and by photophoresis [6]. However, few similar studies have been conducted for Ca-, Al-rich inclusions (CAIs). These particles are known to have formed early, and their distribution could attest to the early stages of Solar System (ESS) history. Unfortunately, CAIs are not as common in chondrites as chondrules are, reducing the usefulness of studies restricted to a few thin sections. Furthermore, the largest sizes of CAIs are generally much larger than chondrules, and therefore rarely present in most studied chondrite thin sections. This study attempts to perform a more representative sampling of the CAI population in the Allende chondrite by investigating a two decimeter-sized slab.

Validity of the lower extremity functional movement screen in patients with chronic ankle instability.

Science.gov (United States)

Choi, Ho-Suk; Shin, Won-Seob

2015-06-01

[Purpose] The purpose of this study was to provide evidence of construct validity for the lower extremity functional movement screen (LE-FMS) based on hypothesis testing in patients with chronic ankle instability (CAI). [Subjects] The subjects were 20 healthy subjects and 20 patients with CAI who had a history of ankle sprain with pain for more than 1 day. [Methods] All participants were measured using the Foot and Ankle Disability Index (FADI) and evaluated with the LE-FMS. The screen included the deep squat, the hurdle step (HS) and the in-line lunge (ILL). The symmetry ratios (RS) were accurately measured during the deep squat trial. [Results] Between the two groups, there were significant differences in scores on the LE-FMS, HS, ILL, RS, FADI, and FADI-sport. The FADI was strongly correlated with both LE-FMS score (r=0.807) and ILL score (r=0.896). There was a strong relationship (r=0.818) between LE-FMS score and FADI-sport. [Conclusion] These results suggest that the LE-FMS may be used to detect deficits related to CAI. Additionally, this instrument is reliable in detecting functional limitations in patients with CAI.

Single-leg drop landing movement strategies in participants with chronic ankle instability compared with lateral ankle sprain 'copers'.

Science.gov (United States)

Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Delahunt, Eamonn

2016-04-01

To compare the movement patterns and underlying energetics of individuals with chronic ankle instability (CAI) to ankle sprain 'copers' during a landing task. Twenty-eight (age 23.2 ± 4.9 years; body mass 75.5 ± 13.9 kg; height 1.7 ± 0.1 m) participants with CAI and 42 (age 22.7 ± 1.7 years; body mass 73.4 ± 11.3 kg; height 1.7 ± 0.1 m) ankle sprain 'copers' were evaluated 1 year after incurring a first-time lateral ankle sprain injury. Kinematics and kinetics of the hip, knee and ankle joints from 200 ms pre-initial contact (IC) to 200 ms post-IC, in addition to the vertical component of the landing ground reaction force, were acquired during performance of a drop land task. The CAI group adopted a position of increased hip flexion during the landing descent on their involved limb. This coincided with a reduced post-IC flexor pattern at the hip and increased overall hip joint stiffness compared to copers (-0.01 ± 0.05 vs. 0.02 ± 0.05°/Nm kg(-1), p = 0.03). Individuals with CAI display alterations in hip joint kinematics and energetics during a unipodal landing task compared to LAS 'copers'. These alterations may be responsible for the increased risk of injury experienced by individuals with CAI during landing manoeuvres. Thus, clinicians must recognise the potential for joints proximal to the affected ankle to contribute to impaired function following an acute lateral ankle sprain injury and to develop rehabilitation protocols accordingly. Level III.

GIS coupled Multiple Criteria based Decision Support for Classification of Urban Coastal Areas in India

Science.gov (United States)

Dhiman, R.; Kalbar, P.; Inamdar, A. B.

2017-12-01

Coastal area classification in India is a challenge for federal and state government agencies due to fragile institutional framework, unclear directions in implementation of costal regulations and violations happening at private and government level. This work is an attempt to improvise the objectivity of existing classification methods to synergies the ecological systems and socioeconomic development in coastal cities. We developed a Geographic information system coupled Multi-criteria Decision Making (GIS-MCDM) approach to classify urban coastal areas where utility functions are used to transform the costal features into quantitative membership values after assessing the sensitivity of urban coastal ecosystem. Furthermore, these membership values for costal features are applied in different weighting schemes to derive Coastal Area Index (CAI) which classifies the coastal areas in four distinct categories viz. 1) No Development Zone, 2) Highly Sensitive Zone, 3) Moderately Sensitive Zone and 4) Low Sensitive Zone based on the sensitivity of urban coastal ecosystem. Mumbai, a coastal megacity in India is used as case study for demonstration of proposed method. Finally, uncertainty analysis using Monte Carlo approach to validate the sensitivity of CAI under specific multiple scenarios is carried out. Results of CAI method shows the clear demarcation of coastal areas in GIS environment based on the ecological sensitivity. CAI provides better decision support for federal and state level agencies to classify urban coastal areas according to the regional requirement of coastal resources considering resilience and sustainable development. CAI method will strengthen the existing institutional framework for decision making in classification of urban coastal areas where most effective coastal management options can be proposed.

Prenatal testosterone and theory of mind development: Findings from disorders of sex development.

Science.gov (United States)

Khorashad, Behzad S; Khazai, Behnaz; Roshan, Ghasem M; Hiradfar, Mehran; Afkhamizadeh, Mozhgan; van de Grift, Tim C

2018-03-01

Women on average perform better than men on the "Reading the Mind in the Eyes" test (RMET) which is a measure of Theory of Mind (ToM). The aim of this study was to assess whether these sex differences are influenced by differences in prenatal testosterone levels through a study on individuals with Disorders of Sex Development and matched controls. ToM performance was examined using the RMET in female-assigned-at-birth individuals with increased prenatal testosterone exposure (Congenital Adrenal Hyperplasia (CAH) and 5-alpha Reductase type-2 Deficiency (5α-RD-2)), female-assigned-at-birth individuals with testosterone insensitivity (Complete Androgen Insensitivity Syndrome (CAIS)), and their age-matched unaffected male and female relatives. A total number of 158 individuals participated in the study; 19 with 5α-RD-2, 17 with CAH, 18 women with CAIS, 52 matched unaffected men and 52 matched unaffected women. All subgroups were around 20 years of age. Women with CAH scored significantly lower on RMET than control women and CAIS individuals. CAIS individuals scored significantly higher than control men and participants with 5α-RD. Statistically, CAIS individuals' performance on RMET was similar to control women's, women with CAH did not differ significantly from control men and 5α-RD-2 individuals scored significantly lower than control men. These results, which are in line with previous theories, illustrate that performance on the RMET, as an index of ToM, may be influenced by variations in prenatal androgens levels. Copyright © 2017 Elsevier Ltd. All rights reserved.

Profilaxis con antibióticos en fracturas de base de cráneo: ¿tiene justificación esa conducta?

Directory of Open Access Journals (Sweden)

Justo Luis González González

1998-08-01

Full Text Available Se realizó un estudio de 380 pacientes con fractura de la base del cráneo y a 71 de ellos (18,7 % se les administraron antibióticos como profilaxis de la meningoencefalitis y a 309 (81,3 % no se les suministraron estos agentes. Se evaluó la relación entre uso profiláctico o terapéutico de antimicrobianos, localización de la fractura, lesiones asociadas, complicaciones sépticas, edad y sexo, con la aparición de meningoencefalitis. Desarrollaron infección del sistema nervioso central 7 pacientes (1,8 %, 3 de ellos (4,2 % entre los que recibieron profilaxis y 4 (1,3 % entre los que no la recibieron. Se probó que la presencia de meningoencefalitis estaba asociada con el tipo de complicaciones sépticas que además pudieron tener los pacientes, así como al uso de antibióticos como terapéutica de éstas en análisis bivariado, lo que no se corroboró en el multivariado. Se concluye que el empleo de antibióticos profilácticos en estos pacientes no tiene justificación, lo que convierte a esta conducta en una práctica negativa desde el punto de vista médico y económicoA study of 380 patients with basilar skull fracture was performed. 71 (18.7 % of these patients were given antibiotic prophylaxis for meningoencephalitis and 309 (81.3 % were not. The relation of prophylactic or therapeutical use of antimicrobial agents, fracture location, associated injures, septic complications, age and sex to the meningoencephalitis coming out was evaluated. 7 patients (1.8 % developed infections of the central nervous system, 3 (4.2 % had been treated with antibiotics and 4 (1.3 % had not. The bivariate analysis proved that the meningoencephalitis was linked to the type of septic complications that might affect patients as well as the therapeutical use of antibiotics to eliminate them but the multivariate analysis did not demonstrate so. It is concluded that the use of the antibiotic prophylaxis in these patients is not substantiated which turns

On the Unsteady-Motion Theory of Magnetic Forces for Maglev

Science.gov (United States)

1993-11-01

DivisionEnergy Technology Division Forces for Maglev Energy Technology DivisionEnergy Technology Division by S. S. Chen, S. Zhu, and Y. Cai APQ 4 袲...On the Unsteady-Motion Theory of Magnetic Forces for Maglev by S. S. Chen, S. Zhu, and Y. Cai Energy Technology Division November 1993 Work supported...vi On The Unsteady-Motion Theory of Magnetic Forces for Maglev by S. S

Untitled

Indian Academy of Sciences (India)

Cao Ceo.BalaCuO showed a drop in T. to 43K while the Ca-excess compound. Cai BaLaCuO showed an improvement in T. to 72K. The decrease of T. in Ce- doped compound may be due to the tetravalent nature of Ce-ion. Substitution of tetravalent Ce for divalent Cais likely to bring down considerably the number of holes.

IP Infrastructure Geolocation

Science.gov (United States)

2015-03-01

by non-commercial enti- ties. HostiP is a community-driven geolocation service. It provides an Application Pro- gramming Interface ( API ) for...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS IP INFRASTRUCTURE GEOLOCATION Thesis Advisor: Second Reader: by Guan Yan Cai March...FUNDING NUMBERS IP INFRASTRUCfURE GEOLOCATION N66001-2250-59231 6. AUTHOR(S) Guan Yan Cai 7. PERFORMING ORGANIZATION NAME(S) AND AOORESS(ES) 9

Changes in Postural Control After a Ball-Kicking Balance Exercise in Individuals With Chronic Ankle Instability

Science.gov (United States)

Conceição, Josilene Souza; Schaefer de Araújo, Felipe Gustavo; Santos, Gilmar Moraes; Keighley, John

2016-01-01

Context:  Rehabilitation programs for patients with chronic ankle instability (CAI) generally involve balance-perturbation training (BPT). Anticipatory postural adjustments (APAs) and compensatory postural adjustments (CPAs) are the primary strategies used to maintain equilibrium during body perturbations. Little is known, however, about how APAs and CPAs are modified to promote better postural control for individuals with CAI after BPT. Objective:  To investigate the effect of BPT that involves kicking a ball on postural-control strategies in individuals with CAI. Design:  Randomized controlled clinical trial. Setting:  Laboratory. Patients or Other Participants:  We randomly assigned 44 volunteers with CAI to either a training group (TG; 11 women, 11 men; age = 24 ± 4 years, height = 173.0 ± 9.8 cm, mass = 72.64 ± 11.98 kg) or control group (CG; 11 women, 11 men; age = 22 ± 3 years, height = 171.0 ± 9.7 cm, mass = 70.00 ± 11.03 kg). Intervention(s):  The TG performed a single 30-minute training session that involved kicking a ball while standing on 1 foot. The CG received no intervention. Main Outcome Measure(s):  The primary outcome was the sum of the integrated electromyographic activity (∑∫EMG) of the lower extremity muscles in the supporting limb that were calculated during typical intervals for APAs and CPAs. A secondary outcome was center-of-pressure displacement during similar intervals. Results:  In the TG after training, the ∑∫EMG decreased in both dorsal and ventral muscles during compensatory adjustment (ie, the time interval that followed lower limb movement). During this interval, muscle activity (∑∫EMG) was less in the TG than in the CG. Consequently, center-of-pressure displacement increased during the task after training. Conclusions:  A single session of ball-kicking BPT promoted changes in postural-control strategies in individuals with CAI. These results should stimulate new and more comprehensive studies to

Los Alamos Controlled Air Incinerator for hazardous chemical and mixed radioactive wastes

International Nuclear Information System (INIS)

Vavruska, J.S.; Borduin, L.C.; Hutchins, D.A.; Koenig, R.A.; Warner, C.L.

1986-01-01

The Los Alamos Controlled Air Incinerator (CAI) is currently the only radioactive waste incineration facility in the US permitted to treat polychlorinated biphenyls (PCBs). The CAI was developed in the mid-1970's as a demonstration system for volume reduction of transuranic (TRU) contaminated combustible solid wastes. It has since undergone additions and modifications to accommodate hazardous chemical wastes in response to a need within the Department of Energy (DOE) to treat mixed radioactive/chemical wastes. An overview of these additions which include a liquid feed system, a high intensity liquid injection burner, and an activated carbon adsorption unit is presented here. Also included is a discussion of the procedures required for Toxic Substances Control Act (TSCA) and Resource Conservation and Recovery Act (RCRA) permitting of the CAI

Experimental Investigation on Low-velocity Impact and Compression After Impact Properties of Three-dimensional Five-directional Braided Composites

Directory of Open Access Journals (Sweden)

YAN Shi

2017-12-01

Full Text Available The low-velocity impact and compression after impact (CAI properties of three-dimensional (3D five-directional carbon fiber/epoxy resin braided composites were experimentally investigated. Specimens prepared with different braiding angles were tested at the same impact energy level. Residual post-impact mechanical properties of the different configurations were characterized by compression after impact tests. Results show that the specimens with bigger braiding angle sustain higher peak loads, and smaller impact damage area, mainly attributes to a more compact space construction. The CAI strength and damage mechanism are found to be mainly dependent on the axial support of the braiding fiber tows. With the increase of braiding angle, the CAI strength decreases, and the damage mode of the composites is changed from transverse fracture to shear failure.

The Discriminant Validity Of The Culture Assessment Instrument: A Comparison Of Company Cultures

Directory of Open Access Journals (Sweden)

Willie Du Toit

2003-11-01

Die doel van die studie was om die diskriminante geldigheid van die ‘Culture Assessment Instrument’ (CAI te beoordeel; dit is om tussen gemiddelde kultuurtellings van verskillende ondernemings te onderskei. Die geleentheidsteekproef het bestaan uit 4066 respondente uit vyf verskillende ondernemings afkomstig uit verskeie industrieë. CAI-tellings van 56 items is op twee vlakke gefaktoranaliseer, gevolg deur iteratiewe itemontledings. Beduidende verskille tussen ondernemings se gemiddelde kultuurtellings is gevind, maar slegs ’n klein proporsie van die variansie in die tellings kon aan kultuurverskille toegeskryf word. Gebaseer op hierdie bevindinge, is daar tot die slotsom gekom dat die CAI in sy huidige vorm nie oor diskriminante geldigheid beskik nie. Daar is aanbeveel dat items gerig op dieper kultuurvlakke, gebaseer op Schein se drievlaktipologie, tot die instrument gevoeg word.

Lower Limb Interjoint Postural Coordination One Year after First-Time Lateral Ankle Sprain.

Science.gov (United States)

Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Patterson, Matthew R; Delahunt, Eamonn

2015-11-01

Longitudinal analyses of participants with a history of lateral ankle sprain are lacking. This investigation combined measures of lower limb interjoint coordination and stabilometry to evaluate static unipedal stance with the eyes open (condition 1) and closed (condition 2) in a group of participants with chronic ankle instability (CAI) compared to lateral ankle sprain "copers" (both recruited 12 months after sustaining an acute first-time lateral ankle sprain) and a group of noninjured controls. Twenty-eight participants with CAI, 42 lateral ankle sprain "copers," and 20 noninjured controls completed three 20-s single-limb stance trials in conditions 1 and 2. An adjusted coefficient of multiple determination statistic was used to compare stance limb three-dimensional kinematic data for similarity to establish patterns of interjoint coordination. The fractal dimension of the stance limb center of pressure path was also calculated. Between-group analyses revealed that participants with CAI displayed notable increases in ankle-hip linked coordination compared with both lateral ankle sprain "copers" (-0.52 (1.05) vs 0.28 (0.9), P = 0.007) and controls (-0.52 (1.05) vs 0.63 (0.64), P = 0.006) in condition 1 and compared with controls only (0.62 (1.92) vs 0.1 (1.0) P = 0.002) in condition 2. Participants with CAI also exhibited a decrease in the fractal dimension of the center-of-pressure path during condition 2 compared with both controls and lateral ankle sprain "copers." Participants with CAI present with a hip-dominant strategy of eyes-open and eyes-closed static unipedal stance. This coincided with reduced complexity of the stance limb center of pressure path in the eyes-closed condition.

Movement Strategies among Groups of Chronic Ankle Instability, Coper, and Control.

Science.gov (United States)

Son, S Jun; Kim, Hyunsoo; Seeley, Matthew K; Hopkins, J Ty

2017-08-01

Comprehensive evaluation of movement strategies during functional movement is a difficult undertaking. Because of this challenge, studied movements have been oversimplified. Furthermore, evaluating movement strategies at only a discrete time point(s) provide limited insight into how movement strategies may change or adapt in chronic ankle instability (CAI) patients. This study aimed to identify abnormal movement strategies in individuals with a history of ankle sprain injury during a sports maneuver compared with healthy controls. Sixty-six participants, consisting of 22 CAI patients, 22 ankle sprain copers, and 22 healthy controls, participated in this study. Functional profiles of lower extremity kinematics, kinetics, and EMG activation from initial contact (0% of stance) to toe-off (100% of stance) were collected and analyzed during a jump landing/cutting task using a functional data analysis approach. Compared with copers, CAI patients displayed landing positions of less plantarflexion, less inversion, more knee flexion, more hip flexion, and less hip abduction during the first 25% of stance. However, restricted dorsiflexion angle was observed in both CAI patients and copers relative to controls during the midlanding to mid-side-cutting phase when the ankle and knee reached its peak range of motion (e.g., dorsiflexion and knee flexion). Reduced EMG activation of tibialis anterior, peroneus longus, medial gastrocnemius, and gluteus medius may be due to altered kinematics that reduce muscular demands on the involved muscles. CAI patients displayed altered movement strategies, perhaps in an attempt to avoid perceived positions of risk. Although sagittal joint positions seemed to increase the external torque on the knee and hip extensors, frontal joint positions appeared to reduce the muscular demands on evertor and hip abductor muscles.

ZIRCONIUM—HAFNIUM ISOTOPE EVIDENCE FROM METEORITES FOR THE DECOUPLED SYNTHESIS OF LIGHT AND HEAVY NEUTRON-RICH NUCLEI

Energy Technology Data Exchange (ETDEWEB)

Akram, W.; Schönbächler, M. [School of Earth, Atmospheric and Environmental Sciences, The University of Manchester, Oxford Road, Manchester, M13 9PL (United Kingdom); Sprung, P. [Institut für Planetologie, Universität Münster, Wilhelm-Klemm-Strasse 10, D-48149 Münster (Germany); Vogel, N. [Institute for Geochemistry and Petrology, ETH, Clausiusstrasse 25, 8092 Zürich (Switzerland)

2013-11-10

Recent work based on analyses of meteorite and terrestrial whole-rock samples showed that the r- and s- process isotopes of Hf were homogeneously distributed throughout the inner solar system. We report new Hf isotope data for Calcium-Aluminum-rich inclusions (CAIs) of the CV3 carbonaceous chondrite Allende, and novel high-precision Zr isotope data for these CAIs and three carbonaceous chondrites (CM, CO, CK). Our Zr data reveal enrichments in the neutron-rich isotope {sup 96}Zr (≤1ε in {sup 96}Zr/{sup 90}Zr) for bulk chondrites and CAIs (∼2ε). Potential isotope effects due to incomplete sample dissolution, galactic and cosmic ray spallation, and the nuclear field shift are assessed and excluded, leading to the conclusion that the {sup 96}Zr isotope variations are of nucleosynthetic origin. The {sup 96}Zr enrichments are coupled with {sup 50}Ti excesses suggesting that both nuclides were produced in the same astrophysical environment. The same CAIs also exhibit deficits in r-process Hf isotopes, which provides strong evidence for a decoupling between the nucleosynthetic processes that produce the light (A ≤ 130) and heavy (A > 130) neutron-rich isotopes. We propose that the light neutron-capture isotopes largely formed in Type II supernovae (SNeII) with higher mass progenitors than the supernovae that produced the heavy r-process isotopes. In the context of our model, the light isotopes (e.g. {sup 96}Zr) are predominantly synthesized via charged-particle reactions in a high entropy wind environment, in which Hf isotopes are not produced. Collectively, our data indicates that CAIs sampled an excess of materials produced in a normal mass (12-25 M{sub ☉}) SNII.

Impact of alcohol use on sexual behavior among men who have sex with men and transgender women in Lima, Peru.

Science.gov (United States)

Herrera, M C; Konda, K A; Leon, S R; Deiss, R; Brown, B; Calvo, G M; Salvatierra, H J; Caceres, C F; Klausner, J D

2016-04-01

Alcohol use disorders (AUDs) may enhance the likelihood of risky sexual behaviors and the acquisition of sexually transmitted infections (STIs). Associations between AUDs with condomless anal intercourse (CAI) and STI/HIV prevalence were assessed among men who have sex with men (MSM) and transgender women (TW) in Lima, Peru. MSM and TW were eligible to participate based on a set of inclusion criteria which characterized them as high-risk. Participants completed a bio-behavioral survey. An AUDIT score ≥8 determined AUD presence. Recent STI diagnosis included rectal gonorrhea/chlamydia, syphilis, and/or new HIV infection within 6 months. Prevalence ratios (PR) were calculated using Poisson regression. Among 312 MSM and 89 TW, 45% (181/401) had an AUD. Among those with an AUD, 164 (91%) were hazardous/harmful drinkers, and 17 (9%) had alcohol dependence. Higher CAI was reported by participants with an AUD vs. without, (82% vs. 72% albeit not significant). Reporting anal sex in two or more risky venues was associated with screening AUD positive vs. not (24% vs. 15%, p=0.001). There was no difference in recent STI/HIV prevalence by AUD status (32% overall). In multivariable analysis, screening AUD positive was not associated with CAI or recent STI/HIV infection. In our sample AUDs were not associated with CAI or new HIV infection/recent STI. However higher prevalence of CAI, alcohol use at last sex, and anal sex in risky venues among those with AUDs suggests that interventions to reduce the harms of alcohol should be aimed toward specific contexts. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

Los Alamos controlled air incinerator upgrade for TRU/mixed waste operations

International Nuclear Information System (INIS)

Vavruska, J.S.; Borduin, L.C.; Hutchins, D.A.; Warner, C.L.; Thompson, T.K.

1989-01-01

The Los Alamos Controlled Air Incinerator (CAI) is undergoing a major process upgrade to accept Laboratory-generated transuranic (TRU) and TRU mixed wastes on a production basis. In the interim,prior to the scheduled 1992 operation of a new on-site LLW/mixed waste incinerator, the CAI will also be accepting solid and liquid low-level mixed wastes. This paper describes major modifications that have been made to the process to enhance safety and ensure reliability for long-term, routine waste incineration operations. The regulatory requirements leading to operational status of the system are also briefly described. The CAI was developed in the mid-1970s as a demonstration system for volume reduction of TRU combustible solid wastes. It continues as a successful R and D system well into the 1980s during which incineration tests on a wide variety of radioactive and chemical waste forms were performed. In 1985, a DOE directive required Los Alamos to reduce the volume of its TRU waste prior to ultimate placement in the geological repository at the Waste Isolation Pilot Project (WIPP). With only minor modifications to the original process flowsheet, the Los Alamos CAI was judged capable of conversion to a TRU waste operations mode. 9 refs., 1 fig

Lower limb joint motion during a cross cutting movement differs in individuals with and without chronic ankle instability.

Science.gov (United States)

Koshino, Yuta; Yamanaka, Masanori; Ezawa, Yuya; Ishida, Tomoya; Kobayashi, Takumi; Samukawa, Mina; Saito, Hiroshi; Takeda, Naoki

2014-11-01

To compare the kinematics of lower limb joints between individuals with and without chronic ankle instability (CAI) during cross-turn and -cutting movements. Cross-sectional study. Motion analysis laboratory. Twelve subjects with CAI and twelve healthy controls. Hip flexion, adduction, and internal rotation, knee flexion, and ankle dorsiflexion and inversion angles were calculated in the 200 ms before initial ground contact and from initial ground contact to toe-off (stance phase) in a cross-turn movement during gait and a cross-cutting movement from a forward jump, and compared across the two groups. In the cross-cutting movement, the CAI group exhibited greater hip and knee flexion than the control group during the stance phase, and more hip abduction during the period before initial contact and the stance phase. In the cross-turn movement the joint kinematics were similar in the two groups. CAI subjects exhibited an altered pattern of the proximal joint kinematics during a cross-cutting movement. It is important for clinicians to assess the function of the hip and knee as well as the ankle, and to incorporate coordination training for the entire lower limb into rehabilitation after lateral ankle sprains. Copyright © 2013 Elsevier Ltd. All rights reserved.

Statistical analysis to assess automated level of suspicion scoring methods in breast ultrasound

Science.gov (United States)

Galperin, Michael

2003-05-01

A well-defined rule-based system has been developed for scoring 0-5 the Level of Suspicion (LOS) based on qualitative lexicon describing the ultrasound appearance of breast lesion. The purposes of the research are to asses and select one of the automated LOS scoring quantitative methods developed during preliminary studies in benign biopsies reduction. The study has used Computer Aided Imaging System (CAIS) to improve the uniformity and accuracy of applying the LOS scheme by automatically detecting, analyzing and comparing breast masses. The overall goal is to reduce biopsies on the masses with lower levels of suspicion, rather that increasing the accuracy of diagnosis of cancers (will require biopsy anyway). On complex cysts and fibroadenoma cases experienced radiologists were up to 50% less certain in true negatives than CAIS. Full correlation analysis was applied to determine which of the proposed LOS quantification methods serves CAIS accuracy the best. This paper presents current results of applying statistical analysis for automated LOS scoring quantification for breast masses with known biopsy results. It was found that First Order Ranking method yielded most the accurate results. The CAIS system (Image Companion, Data Companion software) is developed by Almen Laboratories and was used to achieve the results.

Influence of psychological stress on headache in patients with systemic lupus erythematosus.

Science.gov (United States)

Vargas-Hitos, José Antonio; Sabio, José Mario; Martínez-Egea, Isabel; Jiménez-Jáimez, Enrique; Rodríguez-Guzmán, Manuel; Navarrete-Navarrete, Nuria; López-Lozano, Esther; Romero-Alegría, Ángela; de la Calle, Cristina; Jáimez-Gámiz, Laura; Baños-Piñero, Pilar; Nebrera-Navarro, Fernando; Fidalgo, Alba; Caminal, Luis; de Ramón Garrido, Enrique; Ortego-Centeno, Norberto; Expósito, Manuela; Zamora-Pasadas, Mónica; Jiménez-Alonso, Juan

2014-03-01

To compare the prevalence and disability of headache in patients with systemic lupus erythematosus (SLE) with the general population and to assess the role of chronic psychological stress (CPS) in headache development. One hundred seventy patients with SLE and 102 control subjects matched for age, sex, and level of education were included in this multicenter, cross-sectional study. CPS, headache-related disability, and chronic analgesic intake (CAI) were evaluated in all participants. No statistical differences in the prevalence of headache between both groups were observed but headache disability was significantly higher in patients with SLE. In addition, a higher average score in the Cohen Perceived Stress Scale (CPSS) and a higher prevalence of patients with CAI were observed in patients with SLE. In multivariate analysis, CPSS score was positively (OR 1.09; 95% CI: 1.03-1.14; p = 0.001) and CAI negatively (OR 0.43; 95% CI: 0.19-0.99; p = 0.049) associated with headache in patients with SLE. Despite the prevalence of headache in patients with SLE and the general population being similar, headache-related disability may be higher in patients with SLE. Moreover, CPS might play a role in the pathogenesis of SLE headache, whereas CAI might have a protective effect against it.

A First Look at Harm Toward Animals by Bahamians in Childhood

Directory of Open Access Journals (Sweden)

William J. Fielding

2011-05-01

Full Text Available This paper reports the first known study on childhood cruelty towards animals in The Bahamas. An internet survey involving 1,558 respondents allowed childhood cruelty, using the Children and Animals Inventory (CAI, to be investigated in the context of other violent behaviours in the child’s home. The homes of children who did no harm animals were less violent than the homes of children who harmed animals. Consistent with other studies, males were more likely to harm animals than females. Males were more likely than females to harm sentient animals. While the use of violence to train children was not associated with a higher CAI score, domestic violence and the presence of a gun in the home were associated with a higher CAI score. The implications of these findings as they relate to the treatment of living creatures are discussed.

A First Look at Harm Toward Animals by Bahamians in Childhood

Directory of Open Access Journals (Sweden)

Fielding, William J.

2011-10-01

Full Text Available This paper reports the first known study on childhood cruelty towards animals in The Bahamas. An internet survey involving 1,558 respondents allowed childhood cruelty, using the Children and Animals Inventory (CAI, to be investigated in the context of other violent behaviours in the child’s home. The homes of children who did no harm animals were less violent than the homes of children who harmed animals. Consistent with other studies, males were more likely to harm animals than females. Males were more likely than females to harm sentient animals. While the use of violence to train children was not associated with a higher CAI score, domestic violence and the presence of a gun in the home were associated with a higher CAI score. The implications of these findings as they relate to the treatment of living creatures are discussed.

A finite element study on the effects of toughness and permanent out-of-plane deformation on post-impact compressive strength

OpenAIRE

Bull, Daniel; Spearing, Simon; Sinclair, Ian

2015-01-01

This study applies mechanisms observed from previous work (the undamaged cone, toughness and extent of permanent out-of-plane deformation) to parametrically study their effects on residual compression after impact (CAI) strength using finite element models. Based on previous experimental work, tougher material systems exhibited up to 30% greater CAI strength for a given damage area. Based on this, it is necessary to understand what other parameters, beyond damage area, contribute to a loss in...

Lessons Learned from the ECML/PKDD Discovery Challenge on the Atherosclerosis Risk Factors Data

Czech Academy of Sciences Publication Activity Database

Berka, Petr; Rauch, Jan; Tomečková, Marie

2007-01-01

Roč. 26, č. 3 (2007), s. 329-344 ISSN 1335-9150 R&D Projects: GA MŠk(CZ) 1M06014; GA ČR GA201/05/0325 Grant - others:GA VŠE(CZ) 25/05 Institutional research plan: CEZ:AV0Z10300504 Keywords : atherosclerosis risk * data mining * discovery challenge Subject RIV: IN - Informatics, Computer Science Impact factor: 0.349, year: 2007 http://www.cai.sk/ojs/index.php/cai/article/view/313

Student Study Choices in the Principles of Economics: A Case Study of Computer Usage

OpenAIRE

Grimes, Paul W.; Sanderson, Patricia L.; Ching, Geok H.

1996-01-01

Principles of Economics students at Mississippi State University were provided the opportunity to use computer assisted instruction (CAI) as a supplemental study activity. Students were free to choose the extent of their computer work. Throughout the course, weekly surveys were conducted to monitor the time each student spent with their textbook, computerized tutorials, workbook, class notes, and study groups. The surveys indicated that only a minority of the students actively pursued CAI....

The Amazon hydrometeorology: Climatology, variability and links to changes in weather patterns

Science.gov (United States)

Fernandes, Katia De Avila

My thesis focuses on improving the quantification of the hydrological cycle and understanding the atmospheric processes that link weather to climate in the Amazon River basin. By using ERA40 and independent observations, I assess how well we can estimate the surface water budget in the Amazon River basin. I find that ERA40 basin wide annual precipitation (P) overall agrees with observations showing a slight underestimation of 10% in average, whereas runoff (R) is underestimated by a larger margin (˜25%). Observed residual of precipitation and runoff (denoted as P-R) is better estimated by ERA40 P-R than actual ET which includes soil moisture nudging. The causes for said discrepancies were found to partly relate to soil moisture nudging that needs to be applied during the dry season to produce realistic ET and compensate for the low soil moisture recharge during the previous wet season. Insufficient recharge may in part be caused by underestimation of rainfall amount and intensity; moreover the shallow root layer in the model does not represent the deep soil water reservoir characteristic of the Amazonian forest. Whether the hydrological cycle and weather patterns in the Amazon have changed during the past few decades is a highly debatable but central question for detecting climate change in the region. The second part of my thesis focus on the physical links between rainfall changes detected in observations, and changes of synoptic scale systems as represented by ERA40. My results suggest that an observed delayed wet season onset is consistent with a decreasing number of cold air incursion (CAI) days in southern Amazon for the period 1979--2001. The variability of CAI into southern Amazon is related to the variability of SST upstream of South America in the tropical Pacific and Indian Oceans. A Singular Value Decomposition Analysis (SVD) between CAI days and global SST reveal three main modes of co-variability. The first mode describes the effect of the El Nino

Muscle Activation During Landing Before and After Fatigue in Individuals With or Without Chronic Ankle Instability

Science.gov (United States)

Webster, Kathryn A.; Pietrosimone, Brian G.; Gribble, Phillip A.

2016-01-01

Context: Ankle instability is a common condition in physically active individuals. It often occurs during a jump landing or lateral motion, particularly when participants are fatigued. Objective: To compare muscle activation during a lateral hop prefatigue and postfatigue in individuals with or without chronic ankle instability (CAI). Design: Cross-sectional study. Setting: Sports medicine research laboratory. Patients or Other Participants: A total of 32 physically active participants volunteered for the study. Sixteen participants with CAI (8 men, 8 women; age = 20.50 ± 2.00 years, height = 172.25 ± 10.87 cm, mass = 69.13 ± 13.31 kg) were matched with 16 control participants without CAI (8 men, 8 women; age = 22.00 ± 3.30 years, height = 170.50 ± 9.94 cm, mass = 69.63 ± 14.82 kg) by age, height, mass, sex, and affected side. Intervention(s): Electromyography of the tibialis anterior, peroneus longus, gluteus medius, and gluteus maximus was measured before and after a functional fatigue protocol. Main Outcome Measure(s): Activation of 4 lower extremity muscles was measured 200 milliseconds before and after landing from a lateral hop. Results: We observed no interactions. The group main effects for the peroneus longus demonstrated higher muscle activation in the CAI group (52.89% ± 11.36%) than in the control group (41.12% ± 11.36%) just before landing the lateral hop (F1,30 = 8.58, P = .01), with a strong effect size (d = 1.01). The gluteus maximus also demonstrated higher muscle activation in the CAI group (45.55% ± 12.08%) than in the control group (36.81% ± 12.08%) just before landing the lateral hop (F1,30 = 4.19, P = .049), with a moderate effect size (d = 0.71). We observed a main effect for fatigue for the tibialis anterior, with postfatigue activation higher than prefatigue activation (F1,30 = 7.45, P = .01). No differences were present between groups for the gluteus medius. Conclusions: Our results support the presence of a centralized feed

Major and trace element geochemistry of S-type cosmic spherules

Digital Repository Service at National Institute of Oceanography (India)

Rudraswami, N.G.; ShyamPrasad, M.; Babu, E.V.S.S.K.; VijayaKumar, T.

that pass through the Earth’s atmosphere undergo changes in their chemical compositions thereby making it difficult to understand if they are sourced from the matrix, chondrules or calcium aluminium rich inclusions (CAIs). These components have..., the nature of their precursors, their thermal history while they were a part of parent bodies, and their relation to the chondrites or components such as calcium aluminium rich inclusions (CAIs), chondrules and matrix is masked by ambiguity. There is ample...

Novel matrix resins for composites for aircraft primary structures, phase 1

Science.gov (United States)

Woo, Edmund P.; Puckett, P. M.; Maynard, S.; Bishop, M. T.; Bruza, K. J.; Godschalx, J. P.; Mullins, M. J.

1992-01-01

The objective of the contract is the development of matrix resins with improved processability and properties for composites for primarily aircraft structures. To this end, several resins/systems were identified for subsonic and supersonic applications. For subsonic aircraft, a series of epoxy resins suitable for RTM and powder prepreg was shown to give composites with about 40 ksi compressive strength after impact (CAI) and 200 F/wet mechanical performance. For supersonic applications, a thermoplastic toughened cyanate prepreg system has demonstrated excellent resistance to heat aging at 360 F for 4000 hours, 40 ksi CAI and useful mechanical properties at greater than or equal to 310 F. An AB-BCB-maleimide resin was identified as a leading candidate for the HSCT. Composite panels fabricated by RTM show CAI of approximately 50 ksi, 350 F/wet performance and excellent retention of mechanical properties after aging at 400 F for 4000 hours.

Coordination and Symmetry Patterns During the Drop Vertical Jump in People With Chronic Ankle Instability and Lateral Ankle Sprain Copers.

Science.gov (United States)

Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Sweeney, Kevin; Patterson, Matthew R; Delahunt, Eamonn

2016-08-01

The drop vertical jump (DVJ) task has previously been used to identify movement patterns associated with a number of injury types. However, no current research exists evaluating people with chronic ankle instability (CAI) compared with people coping with lateral ankle sprain (LAS) (referred to as "LAS copers") during this task. The aim of this study was to identify the coping movement and motor control patterns of LAS copers in comparison with individuals with CAI during the DVJ task. This was a case-control study. Seventy individuals were recruited at convenience within 2-weeks of sustaining a first-time acute LAS injury. One year following recruitment, these individuals were stratified into 2 groups: 28 with CAI and 42 LAS copers. They attended the testing laboratory to complete a DVJ task. Three-dimensional kinematic and sagittal-plane kinetic profiles were plotted for the lower extremity joints of both limbs for the drop jump phase (phase 1) and drop landing phase (phase 2) of the DVJ. The rate of impact modulation relative to body weight during both phases of the DVJ also was determined. Compared with LAS copers, participants with CAI displayed significant increases in hip flexion on their "involved" limb during phase 1 of the DVJ (23° vs 18°) and bilaterally during phase 2 (15° vs 10°). These movement patterns coincided with altered moment-of-force patterns at the hip on the "uninvolved" limb. It is unknown whether these movement and motor control patterns preceded or occurred as a result of the initial LAS injury. Participants with CAI displayed hip-centered changes in movement and motor control patterns during a DVJ task compared with LAS copers. The findings of this study may give an indication of the coping mechanism underlying outcome following initial LAS injury. © 2016 American Physical Therapy Association.

Gastronomia, Sustentabilidade e Turismo na Praia de Caçandoca, Ubatuba (São Paulo-Brasil

Directory of Open Access Journals (Sweden)

Marielys Siqueira Bueno

2012-12-01

Ubatuba, tiene uma comunidad de pesca artesanal que es también remanesciente de um “quilombo”. Después de la apertura de rodovias permitiendo acceso al litoral norte de São Paulo, em los años setenta, la comunidade sufrió muchas pressiones de la especulación inmobiliaria para su desahucio o transferência, por causa de la belleza del lugar y sus possibilidades de uso turístico. Mas ella obtuvo el reconocimiento de su propriedade territorial, como “tierra de quilombo”, y hoy busca mantener su identidade y su cultura material. Una parte importante de esa cultura es su culinaria de peces, investigada por el A. en entrevistas abiertas com antiguos moradores de Caçandoca. Y hoy, proyectos comunitários y de gobierno ofrecen alternativas de aprovechamiento de esa cocina tradicional en uma actividad de turismo sustentable. Palabras-clave: turismo sustentable; pesca artesanal; quilombo ; culinária caiçara; ; Ubatuba-SP.

Serum deprivation induces glucose response and intercellular coupling in human pancreatic adenocarcinoma PANC-1 cells.

Science.gov (United States)

Hiram-Bab, Sahar; Shapira, Yuval; Gershengorn, Marvin C; Oron, Yoram

2012-03-01

This study aimed to investigate whether the previously described differentiating islet-like aggregates of human pancreatic adenocarcinoma cells (PANC-1) develop glucose response and exhibit intercellular communication. Fura 2-loaded PANC-1 cells in serum-free medium were assayed for changes in cytosolic free calcium ([Ca]i) induced by depolarization, tolbutamide inhibition of K(ATP) channels, or glucose. Dye transfer, assayed by confocal microscopy or by FACS, was used to detect intercellular communication. Changes in messenger RNA (mRNA) expression of genes of interest were assessed by quantitative real-time polymerase chain reaction. Proliferation was assayed by the MTT method. Serum-deprived PANC-1 cell aggregates developed [Ca]i response to KCl, tolbutamide, or glucose. These responses were accompanied by 5-fold increase in glucokinase mRNA level and, to a lesser extent, of mRNAs for K(ATP) and L-type calcium channels, as well as increase in mRNA levels of glucagon and somatostatin. Trypsin, a proteinase-activated receptor 2 agonist previously shown to enhance aggregation, modestly improved [Ca]i response to glucose. Glucose-induced coordinated [Ca]i oscillations and dye transfer demonstrated the emergence of intercellular communication. These findings suggest that PANC-1 cells, a pancreatic adenocarcinoma cell line, can be induced to express a differentiated phenotype in which cells exhibit response to glucose and form a functional syncytium similar to those observed in pancreatic islets.

The effectiveness of self-regulation in limiting the advertising of unhealthy foods and beverages on children's preferred websites in Canada.

Science.gov (United States)

Potvin Kent, Monique; Pauzé, Elise

2018-06-01

To assess the effectiveness of the self-regulatory Canadian Children's Food and Beverage Advertising Initiative (CAI) in limiting advertising of unhealthy foods and beverages on children's preferred websites in Canada.Design/Setting/SubjectsSyndicated Internet advertising exposure data were used to identify the ten most popular websites for children (aged 2-11 years) and determine the frequency of food/beverage banner and pop-up ads on these websites from June 2015 to May 2016. Nutrition information for advertised products was collected and their nutrient content per 100 g was calculated. Nutritional quality of all food/beverage ads was assessed using the Pan American Health Organization (PAHO) and UK Nutrient Profile Models (NPM). Nutritional quality of CAI and non-CAI company ads was compared using χ 2 analyses and independent t tests. About 54 million food/beverage ads were viewed on children's preferred websites from June 2015 to May 2016. Most (93·4 %) product ads were categorized as excessive in fat, Na or free sugars as per the PAHO NPM and 73·8 % were deemed less healthy according to the UK NPM. CAI-company ads were 2·2 times more likely (OR; 99 % CI) to be excessive in at least one nutrient (2·2; 2·1, 2·2, Pfood and beverage advertising on children's preferred websites in Canada. Mandatory regulations are needed.

Circuito elétrico auxiliar para intubação das vias lacrimais Auxiliary electrical device for lacrimal system intubation

Directory of Open Access Journals (Sweden)

José Byron Vicente Dias Fernandes

2000-10-01

Full Text Available Objetivo: Apresentam num circuito elétrico auxiliar para a intubação de vias lacrimais. Método: Descreve-se o dispositivo e sua utilização em 40 pacientes com obstrução congênita ou traumática das vias lacrimais. Resultados: O estudo das características elétricas do aparelho mostrou suas vantagens em relação a outros dispositivos citados na literatura. O uso do aparelho facilitou a recuperação das sondas de Crawford em todos os pacientes. Conclusão: O CAI mostrou-se eficiente e seguro sendo que seu emprego permitiu uma rápida localização e apreensão da sonda de Crawford na cavidade nasal.Purpose: To present an auxiliary electrical circuit (CAI for lacrimal system intubation. Method: The device is described as well as its application to 40 patients with congenital and traumatic lacrimal obstruction. Results: An electrical characteristics study of CAI was performed and compared to other instruments reported in the literature, showing its advantages. Its use helped the retrieval of Crawford probes in all patients. Conclusions: CAI is safe and effective. Its use allows a quick localization and retrieval of Crawford probe even when performed by trainee physicians not familiar with lacrimal anatomy.

Validity of the lower extremity functional movement screen in patients with chronic ankle instability

OpenAIRE

Choi, Ho-Suk; Shin, Won-Seob

2015-01-01

[Purpose] The purpose of this study was to provide evidence of construct validity for the lower extremity functional movement screen (LE-FMS) based on hypothesis testing in patients with chronic ankle instability (CAI). [Subjects] The subjects were 20 healthy subjects and 20 patients with CAI who had a history of ankle sprain with pain for more than 1 day. [Methods] All participants were measured using the Foot and Ankle Disability Index (FADI) and evaluated with the LE-FMS. The screen includ...

Impact Characteristics of Candidate Materials for Single-Stage-to-Orbit (SSTO) Technology

Science.gov (United States)

Nettles, Alan

1995-01-01

Four fiber/resin systems were compared for resistance to damage and damage tolerance. One toughened epoxy and three toughened bismaleimide (BMI) resins were used., all with IM7 carbon fiber reinforcement. A statistical design of experiments technique was used to evaluate the effects of impact energy, specimen thickness and tup diameter on the damage area and residual compression-after-impact (CAI) strength. Results showed that two of the BMI systems sustained relatively large damage areas yet had an excellent retention of CAI strength.

MENSWAARDIGHEID NA TIEN JAAR VAN REGSTAATLIKHEID IN ...

African Journals Online (AJOL)

Administrator

rasionele mens daarvoor moet hê. Outonomie is gevolglik die grondslag van die waardigheid van die menslike natuur en van iedere rasionele skepsel. 11. Bekende Angelsaksiese regsfilosowe onderskryf 'n soortgelyke benadering. Volgens Ronald. Dworkin, wat deels vir John Rawls aanhaal, is die gelyke respek wat aan ...

Tien jaar Duurzaam Veilig : verkeersveiligheidsbalans 1998-2007.

NARCIS (Netherlands)

Weijermars, W.A.M. & Schagen, I.N.L.G. van (red.)

2009-01-01

Ten years of Sustainable Safety; Road safety assessment 1998-2007. The road safety vision Sustainable Safety was introduced at the beginning of the Nineties. The concrete implementation of Sustainable Safety began in 1998 after the Covenant for the Start-up Programme had been signed. This road

Pharmacovigilance: Tiens Slimming Tea Causes Increased Blood ...

African Journals Online (AJOL)

... possible link between the constituents of the slimming tea and increased blood pressure and also provide evidence of other possible harmful effects that may occur with the use of the slimming tea. Keywords: Pharmacovigilance, hypertension, slimming tea. West African Journal of Pharmacology and Drug Research Vol.

Accounting Information Systems in Healthcare: A Review of the Literature.

Science.gov (United States)

Hammour, Hadal; Househ, Mowafa; Razzak, Hira Abdul

2017-01-01

As information technology progresses in Saudi Arabia, the manual accounting systems have become graduallyinadequate for decision needs. Subsequently, private and public healthcare divisions in Saudi Arabia perceive Computerized accounting information system (CAIS) as a vehicle to safeguard efficient and effective flow of information during the analysis, processes, and recording of financial data. Efficient and effective flow of information improvesthe decision making of staff, thereby improving the capability of health care sectors to reduce cost of the medical services.In this paper, we define computerized accounting systems from the point of view of health informatics. Also, the challenges and benefits of supporting CAIS applications in hospitals of Saudi Arabia. With these elements, we conclude that CAIS in Saudi Arabia can serve as a valuable tool for evaluating and controlling the cost of medical services in healthcare sectors. Supplementary education on the significance of having systems of computerized accounting within hospitals for nurses, doctors, and accountants with other health care staff is warranted in future.

Stacking Defects in Synthetic and Meteoritic Hibonites: Implications for High-Temperature Processes in the Solar Nebula

Science.gov (United States)

Han, J.; Keller, L. P.; Brearley, A. J.; Danielson, L. R.

2016-01-01

Hibonite (CaAl12O19) is a primary, highly refractory phase occurring in many Ca-Al-rich inclusions (CAIs) from different chondrite groups, except CI chondrites. Hibonite is predicted to be one of the earliest minerals to condense during cooling of the solar nebula at higher temperatures than any other major CAI mineral. Therefore, hibonite has great potential to reveal the processes and conditions of the very early, high-temperature stages of the solar nebular evolution. Previous microstructural studies of hibonite in CAIs and their Wark-Lovering (WL) rims showed the presence of numerous stacking defects in hibonite. These defects are interpreted as the modification of the stacking sequences of spinel and Ca-containing blocks within the ideal hexagonal hibonite structure, as shown by experimental studies of reaction-sintered ceramic CaO-Al2O3 compounds. We performed preliminary experiments in the CaO-Al2O3-MgO system to understand the formation processes and conditions of defect-structured hibonite found in meteorites.

Climate Change Awareness among the High School Students: Case Study from a Climate Vulnerable Country

Directory of Open Access Journals (Sweden)

S.M.A. Rahman

2014-11-01

Full Text Available Bangladesh is one the worst sufferers of climate change. Climate change awareness creation is pivotal to adaptation and mitigation strategies. Effective dissemination of knowledge among the citizens during high school years is crucial to that end. In Bangladesh, secondary school students follow common curricula which include entries on climate change. This paper investigates the role of the diverse demographic profiles and inherent scholastic background of students on their informedness. The research is based on responses from secondary schools students in Chittagong, Bangladesh. Based on their understanding of climate change, we have constructed the Climate Awareness Index (CAI. Then the relative roles of demographic determinants of the awareness have been compared using the CAI. The quality of schools, and grade, major and merit position of students have affected the CAI values. Besides, the study concluded that the religion, gender, parental education, occupation and income, etc. could affect students’ climate change informedness in Bangladesh.

Early Permian intrusions of the Alai range: Understanding tectonic settings of Hercynian post-collisional magmatism in the South Tien Shan, Kyrgyzstan

Science.gov (United States)

Konopelko, D.; Wilde, S. A.; Seltmann, R.; Romer, R. L.; Biske, Yu. S.

2018-03-01

We present geochemical and Sr-Nd-Pb-Hf isotope data as well as the results of single grain U-Pb zircon dating for ten granitoid and alkaline intrusions of the Alai segment of Kyrgyz South Tien Shan (STS). The intrusions comprise four geochemically contrasting series or suites, including (1) I-type and (2) shoshonitic granitoids, (3) peraluminous granitoids including S-type leucogranites and (4) alkaline rocks and carbonatites, closely associated in space. New geochronological data indicate that these diverse magmatic series of the Alai segment formed in a post-collisional setting. Five single grain U-Pb zircon ages in the range 287-281 Ma, in combination with published ages, define the main post-collisional magmatic pulse at 290-280 Ma, which is similar to ages of post-collisional intrusions elsewhere in the STS. An age of 287 ± 4 Ma, obtained for peraluminous graniodiorite of the Liayliak massif, emplaced in amphibolite-facies metamorphic rocks of the Zeravshan-Alai block, is indistinguishable from ca. 290 Ma age of peraluminous granitoids emplaced coevally with Barrovian-type metamorphism in the Garm block, located ca. 40 km south-west of the research area. The Sr-Nd-Pb-Hf isotopic compositions of the studied intrusions are consistent with the reworking of crustal material with 1.6-1.1 Ga average crustal residence times, indicating the formation of the Alai segment on a continental basement with Mesoproterozoic or older crust. The pattern of post-collisional magmatism in the Alai segment, characterized by emplacement of I-type and shoshoninitic granitoids in combination with coeval Barrovian-type metamorphism, is markedly different from the pattern of post-collisional magmatism in the adjacent Kokshaal segment of the STS with predominant A-type granitoids that formed on a former passive margin of the Tarim Craton. We suggest that during the middle-late Carboniferous the Alai segment probably comprised a microcontinent with Precambrian basement located between

Incidencia que tiene la participación de los jóvenes en los grupos juveniles respecto a su formación integral, calidad de vida y compromiso social, en la Universidad Nacional, Universidad de Medellín, Universidad de Antioquia tres instituciones de educación superior, de Medellín.

OpenAIRE

Martínez Arroyave, Olga Luz; Ocampo Mejía, Martha Cecilia; Arango Ríos, Silvia

2014-01-01

En la Universidad de Medellín, se planteó por parte de un grupo interdisciplinario de investigadores, la posibilidad de mirar la Incidencia que tiene la participación de los jóvenes, en los grupos juveniles, respecto a la Formación Integral, Calidad de Vida y Compromiso Social. El estudio fue realizado en tres Instituciones de Educación Superior de Medellín, escogiéndose: la Universidad Nacional, la Universidad de Medellín, y la Universidad de Antioquia. El grupo de investigadores ident...

Recent developments on models and inclusion criteria for chronic ankle instability

Institute of Scientific and Technical Information of China (English)

Songning; Zhang

2012-01-01

<正>In the most recent report of injury data on 15 sports from the U.S.National Collegiate Athletic Association(NCAA) Injury Surveillance System over a span of 16 years (1988-2004),ankle ligament sprains were the most common injury.Residual symptoms such as recurrent sprains,pain, instability,and giving way are common after an initial,acute ligament sprain.Chronic ankle instability(CAI) is one of these common problems,and has enjoyed increased interest in the recent literature.However,CAI remains a poorly-defined and understood condition.

Mineralogy and geochemistry of triassic carbonatites in the Matcha alkaline intrusive complex (Turkestan-Alai Ridge, Kyrgyz Southern Tien Shan), SW Central Asian orogenic belt

Science.gov (United States)

Vrublevskii, V. V.; Morova, A. A.; Bukharova, O. V.; Konovalenko, S. I.

2018-03-01

Postorogenic intrusions of essexites and alkaline and nepheline syenites in the Turkestan-Alai segment of the Kyrgyz Southern Tien Shan coexist with dikes and veins of carbonatites dated at ∼220 Ma by the Ar-Ar and Rb-Sr age methods. They are mainly composed of calcite and dolomite (60-85%), as well as sodic amphibole, phlogopite, clinopyroxene, microcline, albite, apatite, and magnetite, with accessory niobate, ilmenite, Nb-rutile, titanite, zircon, baddeleyite, monazite-(Ce), barite, and sulfides. The rocks share mineralogical and geochemical similarity with carbonatites that originated by liquid immiscibility at high temperatures above 500 °C. Alkaline silicate and salt-carbonate melts are derived from sources with mainly negative bulk εNd(t) ∼ from -11 to 0 and high initial 87Sr/86Sr ratios (∼0.7061-0.7095) which may be due to mixing of PREMA and EM-type mantle material. Pb isotopic ratios in accessory pyrrhotite (206Pb/204Pb = 18.38; 207Pb/204Pb = 15.64; 208Pb/204Pb = 38.41) exhibit an EM2 trend. The intrusions bear signatures of significant crustal contamination as a result of magma genesis by syntexis and hybridism. Concordant isotope composition changes of δ13C (-6.5 to -1.9‰), δ18O (9.2-23‰), δD (-58 to -41‰), and δ34S (12.6-12.8‰) in minerals and rocks indicate inputs of crustal material at the stage of melting and effect of hot fluids released during dehydration of metamorphosed oceanic basalts or sediments. The observed HFSE patterns of the oldest alkaline gabbro may be due to interaction of the primary mafic magma with IAB-type material. The isotope similarity of alkaline rocks with spatially proximal basalts of the Tarim large igneous province does not contradict the evolution of the Turkestan-Alai Triassic magmatism as the "last echo" of the Tarim mantle plume.

De la dédiasporisation des jeunes Haïtiens à New-York On De-diasporization of Second-generation Haitians in New York City

Directory of Open Access Journals (Sweden)

Stéphanie Melyon-Reinette

2012-05-01

Full Text Available Les facteurs répulsifs de l’émigration haïtienne ont complètement changé depuis les années 1950 qui marquèrent le début de ce mouvement avec le régime duvaliériste. Les entités géopolitiques et sociopolitiques qui en résultent évoluent, elles aussi, proportionnellement et rationnellement aux motivations des individus en partance. Ainsi, les exilés forcés rêvaient de retrouver leur chère Haïti, les nouveaux primo-arrivants sont des individus qui cherchent à se ré-enraciner dans un terreau aux airs d’ailleurs. Le diasporique est-il un individu dont l’identité est figée ? Dans cet article, une étude statistique simple cherche à démontrer l’évolution des mentalités des jeunes Haïtiens à travers un questionnement des identités et des orientations culturelles. Des dynamiques se font jour montrant que la diaspora est fluctuante comme les identités et les cultures qui la composent.The Push factors of Haitian emigration have completely changed since the late 1950s which marked the beginning of this movement with the Duvalier regime. The geopolitical and sociopolitical entities which result from it are changing as well, in proportion and accordance with the motivations of the people who leave. Thus, the forced exiles dreamt of going back to their dearest Haiti, the latest newly-arrived immigrants are individuals who desire to re-root into a land that sounds like “elsewhere”. Must the diasporic individual’s identity be stable? In this article, a simple survey seeks to shed light on the changing mentalities of young Haitians, examining their identities and cultural choices.  Emerging trends show that diaspora is a flow, not unlike the identities and the cultures of which it is composed.

Corrective Action Investigation Plan for the CNTA Subsurface Sites (CAU Number 443), Revision 1; FINAL

International Nuclear Information System (INIS)

1999-01-01

This Corrective Action Investigation Plan (CAIP) describes the U.S. Department of Energy's (DOE's) planned environmental investigation of the subsurface Central Nevada Test Area (CNTA) Corrective Action Unit (CAU) No. 443. The CNTA is located in Hot Creek Valley in Nye County, Nevada, adjacent to U.S. Highway 6, about 48 kilometers (km) (30 miles[mi]) north of Warm Springs, Nevada. The CNTA was the site of Project Faultless, a nuclear device detonated in the subsurface by the U.S. Atomic Energy Commission (AEC) in January 1968. The purposes of this test were to gauge the seismic effects of a relatively large, high-yield detonation completed in Hot Creek Valley (outside the Nevada Test Site) and to determine the suitability of the site for future large detonations. The yield of the Faultless test was between 200 kilotons and 1 megaton. Two similar tests were planned for the CNTA, but neither of them was completed. Based on the general definition of a corrective action investigation (CAI) from Section IV.14 of the Federal Facility Agreement and Consent Order (FFACO), the purpose of the CAI is ''to gather data sufficient to characterize the nature, extent, and rate of migration or potential rate of migration from releases or discharges of pollutants or contaminants and/or potential releases or discharges from corrective action units identified at the facilities''. For CNTA CAU 443 the concepts developed for the Underground Test Area (UGTA) CAUs will be applied on a limited scale. For the UGTA CAUs, ''the objective of the CAI process is to define boundaries around each UGTA CAU that establish areas that contain water that may be unsafe for domestic and municipal use,'' as stated in Appendix VI of the FFACO (1996). Based on this strategy the CAI for CAU 443 will start with modeling using existing data. New data collection activities are generally contingent upon the results of the modeling and may or may not be part of the CAI. Specific objectives of the CAI ar e as

The ability of modified star excursion balance test to differentiate between women athletes with and without chronic ankle instability

Directory of Open Access Journals (Sweden)

Asma Razeghi

2016-05-01

Full Text Available The Star Excursion Balance Test (SEBT is one functional clinical test that widely used to assess dynamic balance in patients with ankle injuries. Since the ability of this test to detect impairments between athletes with and without chronic ankle instability(CAI is not clear, the aim of present study was to determine if the modified SEBT could detect reach deficits in patients with unilateral CAI. A convenience sample of thirty elite and sub elite women athletes were selected and assigned into two groups: CAI group (Mean ± SD: age: 25±3.5 years; height: 1.68±0.09 m; weight: 62.7±7.3kg, and healthy controls (Mean ± SD: age: 26±4.2 years; height: 1.69±0.05 m; weigh t: 62.7±7.3 kg.The dynamic balance test was obtained using modified SEBT from both limbs of each participant. The independent sample t-test was used for both between group and within group inter-limb comparisons. There was no significant difference in any directions of modified SEBT between two groups in both limbs. No significant interlimb differences were also observed within both groups. The modified SEBT may not enough sensitive to differentiate between athletes with and without CAI. Other factors such as ankle range of motion, muscle strength and pain intensity should be considered for better interpretation of the SEBT results.

Effective methods of teaching and learning in anatomy as a basic science: A BEME systematic review: BEME guide no. 44.

Science.gov (United States)

Losco, C Dominique; Grant, William D; Armson, Anthony; Meyer, Amanda J; Walker, Bruce F

2017-03-01

Anatomy is a subject essential to medical practice, yet time committed to teaching is on the decline, and resources required to teach anatomy is costly, particularly dissection. Advances in technology are a potential solution to the problem, while maintaining the quality of teaching required for eventual clinical application. To identify methods used to teach anatomy, including those demonstrated to enhance knowledge acquisition and retention. PubMed, CINAHL, ERIC, Academic OneFile, ProQuest, SAGE journals and Scopus were search from the earliest entry of each database to 31 August 2015. All included articles were assessed for methodological quality and low quality articles were excluded from the study. Studies were evaluated by assessment scores, qualitative outcomes where included as well as a modified Kirkpatrick model. A total of 17,820 articles were initially identified, with 29 included in the review. The review found a wide variety of teaching interventions represented in the range of studies, with CAI/CAL studies predominating in terms of teaching interventions, followed by simulation. In addition to this, CAI/CAL and simulation studies demonstrated better results overall compared to traditional teaching methods and there is evidence to support CAI/CAL as a partial replacement for dissection or a valuable tool in conjunction with dissection. This review provides evidence in support of the use of alternatives to traditional teaching methods in anatomy, in particular, the use of CAI/CAL with a number of high quality, low risk of bias studies supporting this.

Triggered Firing and Atrial Fibrillation in Transgenic Mice With Selective Atrial Fibrosis Induced by Overexpression of TGF-β1

Science.gov (United States)

Choi, Eue-Keun; Chang, Po-Cheng; Lee, Young-Soo; Lin, Shien-Fong; Zhu, Wuqiang; Maruyama, Mitsunori; Fishbein, Michael C.; Chen, Zhenhui; der Lohe, Michael Rubart-von; Field, Loren J.; Chen, Peng-Sheng

2013-01-01

Background Calcium transient triggered firing (CTTF) is induced by large intracellular calcium (Cai) transient and short action potential duration (APD). We hypothesized that CTTF underlies the mechanisms of early afterdepolarization (EAD) and spontaneous recurrent atrial fibrillation (AF) in transgenic (Tx) mice with overexpression of transforming growth factor β1 (TGF-β1). Methods and Results MHC-TGFcys33ser Tx mice develop atrial fibrosis because of elevated levels of TGF-β1. We studied membrane potential and Cai transients of isolated superfused atria from Tx and wild-type (Wt) littermates. Short APD and persistently elevated Cai transients promoted spontaneous repetitive EADs, triggered activity and spontaneous AF after cessation of burst pacing in Tx but not Wt atria (39% vs. 0%, P=0.008). We were able to map optically 4 episodes of spontaneous AF re-initiation. All first and second beats of spontaneous AF originated from the right atrium (4/4, 100%), which is more severely fibrotic than the left atrium. Ryanodine and thapsigargin inhibited spontaneous re-initiation of AF in all 7 Tx atria tested. Western blotting showed no significant changes of calsequestrin or sarco/endoplasmic reticulum Ca2+-ATPase 2a. Conclusions Spontaneous AF may occur in the Tx atrium because of CTTF, characterized by APD shortening, prolonged Cai transient, EAD and triggered activity. Inhibition of Ca2+ release from the sarcoplasmic reticulum suppressed spontaneous AF. Our results indicate that CTTF is an important arrhythmogenic mechanism in TGF-β1 Tx atria. PMID:22447020

Managing ankle ligament sprains and tears: current opinion

Science.gov (United States)

McGovern, Ryan P; Martin, RobRoy L

2016-01-01

The purpose of this paper is to present a current review of pathoanatomical features, differential diagnosis, objective assessment, intervention, and clinical course associated with managing lateral ankle ligament sprains. Proper diagnosis and identification of affected structures should be obtained through history and objective assessment. From this information, an individualized evidence-based intervention plan can be developed to enable recovery while decreasing the risk of reinjury. An appropriate evaluation is needed not only to determine the correct diagnosis but also to allow for grading and determining the prognosis of the injury in those with an acute lateral ankle sprain. Examination should include an assessment of impairments as well as a measure of activity and participation. Evidence-based interventions for those with an acute lateral ankle sprain should include weight bearing with bracing, manual therapy, progressive therapeutic exercises, and cryotherapy. For those with chronic ankle instability (CAI), interventions should include manual therapy and a comprehensive rehabilitation program. It is essential to understand the normal clinical course for athletes who sustain a lateral ankle sprain as well as risk factors for an acute injury and CAI. Risk factors for both an acute lateral ankle sprain and CAI include not using an external support and not participating in an appropriate exercise program. Incorporating the latest evidence-based rehabilitation techniques provides the best course of treatment for athletes with an acute ankle sprain or CAI. PMID:27042147

CO self-shielding as the origin of oxygen isotope anomalies in the early solar nebula.

Science.gov (United States)

Lyons, J R; Young, E D

2005-05-19

The abundances of oxygen isotopes in the most refractory mineral phases (calcium-aluminium-rich inclusions, CAIs) in meteorites have hitherto defied explanation. Most processes fractionate isotopes by nuclear mass; that is, 18O is twice as fractionated as 17O, relative to 16O. In CAIs 17O and 18O are nearly equally fractionated, implying a fundamentally different mechanism. The CAI data were originally interpreted as evidence for supernova input of pure 16O into the solar nebula, but the lack of a similar isotope trend in other elements argues against this explanation. A symmetry-dependent fractionation mechanism may have occurred in the inner solar nebula, but experimental evidence is lacking. Isotope-selective photodissociation of CO in the innermost solar nebula might explain the CAI data, but the high temperatures in this region would have rapidly erased the signature. Here we report time-dependent calculations of CO photodissociation in the cooler surface region of a turbulent nebula. If the surface were irradiated by a far-ultraviolet flux approximately 10(3) times that of the local interstellar medium (for example, owing to an O or B star within approximately 1 pc of the protosun), then substantial fractionation of the oxygen isotopes was possible on a timescale of approximately 10(5) years. We predict that similarly irradiated protoplanetary disks will have H2O enriched in 17O and 18O by several tens of per cent relative to CO.

Soil water dynamics and evapotranspiration of forage cactus clones under rainfed conditions

Directory of Open Access Journals (Sweden)

Thieres George Freire da Silva

2015-07-01

Full Text Available Abstract: The objective of this work was to evaluate soil water dynamics in areas cultivated with forage cactus clones and to determine how environmental conditions and crop growth affect evapotranspiration. The study was conducted in the municipality of Serra Talhada, in the state of Pernambuco, Brazil. Crop growth was monitored through changes in the cladode area index (CAI and through the soil cover fraction, calculated at the end of the cycle. Real evapotranspiration (ET of the three evaluated clones was obtained as the residual term in the soil water balance method. No difference was observed between soil water balance components, even though the evaluated clones were of different genus and had different CAI increments. Accumulated ET was of 1,173 mm during the 499 days of the experiment, resulting in daily average of 2.35 mm. The CAI increases the water consumption of the Orelha de Elefante Mexicana clone. In dry conditions, the water consumption of the Miúda clone responds more slowly to variation in soil water availability. The lower evolution of the CAI of the IPA Sertânia clone, during the rainy season, leads to a higher contribution of the evaporation component in ET. The atmospheric demand controls the ET of clones only when there is higher soil water availability; in this condition, the water consumption of the Miúda clone decreases more rapidly with the increase of atmospheric demand.

The computer aided education and training system for accident management

International Nuclear Information System (INIS)

Yoneyama, Mitsuru; Kubota, Ryuji; Fujiwara, Tadashi; Sakuma, Hitoshi

1999-01-01

The education and training system for Accident Management was developed by the Japanese BWR group and Hitachi Ltd. The education and training system is composed of two systems. One is computer aided instruction (CAI) education system and the education and training system with computer simulations. Both systems are designed to be executed on personal computers. The outlines of the CAI education system and the education and training system with simulator are reported below. These systems provides plant operators and technical support center staff with the effective education and training for accident management. (author)

NCBI nr-aa BLAST: CBRC-PHAM-01-0677 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PHAM-01-0677 ref|NP_055456.2| mediator of DNA-damage checkpoint 1 [Homo sapien...tor with BRCT domains 1 emb|CAI17440.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAI18195.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] gb|EAX03321.1| mediator of DNA ...damage checkpoint 1 [Homo sapiens] emb|CAQ06814.1| mediator of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ06770.1| mediator... of DNA damage checkpoint 1 [Homo sapiens] emb|CAQ07572.1| mediator of DNA damage checkpoi

Controlled air incinerator for radioactive waste. Volume II. Engineering design references manual

International Nuclear Information System (INIS)

Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.

1982-11-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities

Controlled air incinerator for radioactive waste. Volume I. Rationale, process, equipment, performance, and recommendations

International Nuclear Information System (INIS)

Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.

1982-11-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings specifications, calculations, and costs. It aids duplication of the process at other facilities

Los Alamos Controlled Air Incinerator for radioactive waste. Volume I. Rationale, process, equipment, performance, and recommendations

International Nuclear Information System (INIS)

Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.

1982-08-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawing, specifications, calculations, and costs. It aids duplication of the process at other facilities

Los Alamos Controlled Air Incinerator for radioactive waste. Volume II. Engineering design reference manual

Energy Technology Data Exchange (ETDEWEB)

Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.

1982-10-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities.

Los Alamos Controlled Air Incinerator for radioactive waste. Volume I. Rationale, process, equipment, performance, and recommendations

Energy Technology Data Exchange (ETDEWEB)

Neuls, A.S.; Draper, W.E.; Koenig, R.A.; Newmyer, J.M.; Warner, C.L.

1982-08-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawing, specifications, calculations, and costs. It aids duplication of the process at other facilities.

Los Alamos Controlled Air Incinerator for radioactive waste. Volume II. Engineering design reference manual

International Nuclear Information System (INIS)

Koenig, R.A.; Draper, W.E.; Newmyer, J.M.; Warner, C.L.

1982-10-01

This two-volume report is a detailed design and operating documentation of the Los Alamos National Laboratory Controlled Air Incinerator (CAI) and is an aid to technology transfer to other Department of Energy contractor sites and the commercial sector. Volume I describes the CAI process, equipment, and performance, and it recommends modifications based on Los Alamos experience. It provides the necessary information for conceptual design and feasibility studies. Volume II provides descriptive engineering information such as drawings, specifications, calculations, and costs. It aids duplication of the process at other facilities

Damage tolerance of candidate thermoset composites for use on single stage to orbit vehicles

Science.gov (United States)

Nettles, A. T.; Lance, D.; Hodge, A.

1994-01-01

Four fiber/resin systems were compared for resistance to damage and damage tolerance. One toughened epoxy and three toughened bismaleimide (BMI) resins were used, all with IM7 carbon fiber reinforcement. A statistical design of experiments technique was used to evaluate the effects of impact energy, specimen thickness, and impactor diameter on the damage area, as computed by C-scans, and residual compression-after-impact (CAI) strength. Results showed that two of the BMI systems sustained relatively large damage zones yet had an excellent retention of CAI strength.

Recovery From a First-Time Lateral Ankle Sprain and the Predictors of Chronic Ankle Instability: A Prospective Cohort Analysis.

Science.gov (United States)

Doherty, Cailbhe; Bleakley, Chris; Hertel, Jay; Caulfield, Brian; Ryan, John; Delahunt, Eamonn

2016-04-01

Impairments in motor control may predicate the paradigm of chronic ankle instability (CAI) that can develop in the year after an acute lateral ankle sprain (LAS) injury. No prospective analysis is currently available identifying the mechanisms by which these impairments develop and contribute to long-term outcome after LAS. To identify the motor control deficits predicating CAI outcome after a first-time LAS injury. Cohort study (diagnosis); Level of evidence, 2. Eighty-two individuals were recruited after sustaining a first-time LAS injury. Several biomechanical analyses were performed for these individuals, who completed 5 movement tasks at 3 time points: (1) 2 weeks, (2) 6 months, and (3) 12 months after LAS occurrence. A logistic regression analysis of several "salient" biomechanical parameters identified from the movement tasks, in addition to scores from the Cumberland Ankle Instability Tool and the Foot and Ankle Ability Measure (FAAM) recorded at the 2-week and 6-month time points, were used as predictors of 12-month outcome. At the 2-week time point, an inability to complete 2 of the movement tasks (a single-leg drop landing and a drop vertical jump) was predictive of CAI outcome and correctly classified 67.6% of cases (sensitivity, 83%; specificity, 55%; P = .004). At the 6-month time point, several deficits exhibited by the CAI group during 1 of the movement tasks (reach distances and sagittal plane joint positions at the hip, knee and ankle during the posterior reach directions of the Star Excursion Balance Test) and their scores on the activities of daily living subscale of the FAAM were predictive of outcome and correctly classified 84.8% of cases (sensitivity, 75%; specificity, 91%; P < .001). An inability to complete jumping and landing tasks within 2 weeks of a first-time LAS and poorer dynamic postural control and lower self-reported function 6 months after a first-time LAS were predictive of eventual CAI outcome. © 2016 The Author(s).

Geology, mineralization, and fluid inclusion study of the Kuru-Tegerek Au-Cu-Mo skarn deposit in the Middle Tien Shan, Kyrgyzstan

Science.gov (United States)

Soloviev, Serguei G.; Kryazhev, Sergey; Dvurechenskaya, Svetlana

2018-02-01

The Kuru-Tegerek Cu-Au-Mo deposit is situated in a system of Late Carboniferous subduction-related magmatic arcs of the Middle Tien Shan, which together constitute a metallogenic belt of Cu-Au-Mo (±W) porphyry, with local skarns, deposits. The deposit is related to magnetite-series gabbro-diorite to tonalite intrusion. It contains prograde magnesian and calcic skarns with abundant magnetite, associated with gabbro-diorite, and retrograde skarn with Cu mineralization, formed after intrusion of tonalite. Subsequent propylitic alteration introduced abundant chalcopyrite and pyrrhotite, and native Au culminating in zones overprinting magnetite and garnet skarn. Later quartz-muscovite-carbonate veins, formed after intrusion of late mafic quartz monzogabbro dikes, contain chalcopyrite, pyrite, arsenopyrite and other sulfides and sulfosalts, tellurides, and native Au. The earliest retrograde skarn garnet contains gaseous low-salinity (1.7-3.4 wt.% NaCl eq.) fluid inclusions homogenizing at 460-500 °C into vapor, indicating that the early fluid released from crystallizing magma was a low-density vapor. It was followed by more saline (4.0-5.0 wt.% NaCl eq.), high-temperature (400-440 °C) aqueous fluid, as fluid release from the magma progressed. Boiling of this fluid at temperatures of 420 to 370 °C and a pressure of 350-300 bar produced a low-salinity (0.6-1.2 wt.% NaCl eq.), essentially gaseous, and high-salinity (from 39 to 31 wt.% NaCl eq.) brine, with possible metal (including Cu) partitioning into both gaseous and aqueous-saline phases. Boiling was coeval with sulfide deposition in the retrograde skarn. The latest episode of the retrograde skarn stage included direct separation of saline ( 40-42 wt.% NaCl eq.) fluid from crystallizing magma. The separation of saline ( 40 to 14 wt.% NaCl eq.) fluids from a crystallizing magmatic melt continued during the propylitic stage, when fluid cooling from 370 to 320 °C, together with decreasing fO2, caused Cu and especially

Spectroscopy and Photometry of CAI-rich asteroids

Science.gov (United States)

Tanga, P.; Devogele, M.; Bendjoya, Ph.; Cellino, A.; Surdej, J.

2017-09-01

Asteroids with an anomalous amount of primitive elements, formed in ancient times in the solar nebula, exist. Our study confirms their nature and provides hints to the interpretation of the ancient evolution of asteroids.

STAF: A Powerful and Sophisticated CAI System.

Science.gov (United States)

Loach, Ken

1982-01-01

Describes the STAF (Science Teacher's Authoring Facility) computer-assisted instruction system developed at Leeds University (England), focusing on STAF language and major program features. Although programs for the system emphasize physical chemistry and organic spectroscopy, the system and language are general purpose and can be used in any…

Selection criteria for patients with chronic ankle instability in controlled research: a position statement of the International Ankle Consortium.

Science.gov (United States)

Gribble, Phillip A; Delahunt, Eamonn; Bleakley, Chris; Caulfield, Brian; Docherty, Carrie; Fourchet, François; Fong, Daniel Tik-Pui; Hertel, Jay; Hiller, Claire; Kaminski, Thomas; McKeon, Patrick; Refshauge, Kathryn; van der Wees, Philip; Vincenzino, Bill; Wikstrom, Erik

2014-07-01

While research on chronic ankle instability (CAI) and awareness of its impact on society and health care systems has grown substantially in the last 2 decades, the inconsistency in participant/patient selection criteria across studies presents a potential obstacle to addressing the problem properly. This major gap within the literature limits the ability to generalise this evidence to the target patient population. Therefore, there is a need to provide standards for patient/participant selection criteria in research focused on CAI with justifications using the best available evidence. The International Ankle Consortium provides this position paper to present and discuss an endorsed set of selection criteria for patients with CAI based on the best available evidence to be used in future research and study designs. These recommendations will enhance the validity of research conducted in this clinical population with the end goal of bringing the research evidence to the clinician and patient. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

Six Sessions of Anterior-to-Posterior Ankle Joint Mobilizations Improve Patient-Reported Outcomes in Chronic Ankle Instability Patients: A Critically Appraised Topic.

Science.gov (United States)

Wikstrom, Erik A; Bagherian, Sajad; Cordero, Nicole B; Song, Kyeongtak

2018-01-24

Clinical Scenario: Chronic ankle instability (CAI) is a complex musculoskeletal condition that results in sensorimotor and mechanical alterations. Manual therapies, such as ankle joint mobilizations are known to improve clinician-oriented outcomes like dorsiflexion range of motion but their impact of patient-reported outcomes remains less clear. Focused Clinical Question: Do anterior-to-posterior ankle joint mobilizations improve patient reported outcomes in patients with CAI? Summary of Key Findings: Three studies (2 RCT, 1 Prospective cohort) quantified the effect of at least 2-weeks of anterior-to-posterior ankle joint mobilizations on improving patient reported outcomes immediately after the intervention and at a follow-up assessment. All three studies demonstrated significant improvements in at least one patient-reported outcome immediately after the intervention and at the follow-up assessment. Clinical Bottom Line: At least 2-weeks of ankle joint mobilization improves patient-reported outcomes in patients with CAI and these benefits are retained for at least a week following the termination of the intervention. Strength of Recommendation: Strength of recommendation is an A due to consistent good-quality patient-oriented evidence.

Effectiveness of a computer-based tutorial for teaching how to make a blood smear.

Science.gov (United States)

Preast, Vanessa; Danielson, Jared; Bender, Holly; Bousson, Maury

2007-09-01

Computer-aided instruction (CAI) was developed to teach veterinary students how to make blood smears. This instruction was intended to replace the traditional instructional method in order to promote efficient use of faculty resources while maintaining learning outcomes and student satisfaction. The purpose of this study was to evaluate the effect of a computer-aided blood smear tutorial on 1) instructor's teaching time, 2) students' ability to make blood smears, and 3) students' ability to recognize smear quality. Three laboratory sessions for senior veterinary students were taught using traditional methods (control group) and 4 sessions were taught using the CAI tutorial (experimental group). Students in the control group received a short demonstration and lecture by the instructor at the beginning of the laboratory and then practiced making blood smears. Students in the experimental group received their instruction through the self-paced, multimedia tutorial on a laptop computer and then practiced making blood smears. Data was collected from observation, interview, survey questionnaires, and smear evaluation by students and experts using a scoring rubric. Students using the CAI made better smears and were better able to recognize smear quality. The average time the instructor spent in the room was not significantly different between groups, but the quality of the instructor time was improved with the experimental instruction. The tutorial implementation effectively provided students and instructors with a teaching and learning experience superior to the traditional method of instruction. Using CAI is a viable method of teaching students to make blood smears.

Psychological well-being and workability in child abuse investigators.

Science.gov (United States)

Tehrani, N

2018-05-17

Working with victims and offenders of child abuse can impact on the health and well-being of police officers and staff. To identify the effects of tenure, work ability, gender and a personal experience of child abuse on symptoms of anxiety, depression and primary and secondary trauma in child abuse investigators (CAIs). Screening questionnaires were sent to police officers and staff. The officers and staff worked in child protection in seven police forces. The surveillance was undertaken online and the data were encrypted and personal identifiers removed. The four clinical measures were Goldberg Anxiety/Depression Scale, Professional Quality of Life and Impact of Events (extended). Eighty-two per cent of 2798 CAIs returned questionnaires. There was a statistically significant relationship between all four clinical symptoms and workability (P < 0.001), between tenure and primary trauma (P < 0.01) and between anxiety, depression, primary trauma and workability and adverse childhood experience (ACE) scores (P < 0.001). Regression analysis showed that workability, tenure and ACE scores explained between 12 and 23% of the variance. There were gender differences with women having higher levels of symptoms; however, the effect size and clinical significance were negligible for all but the primary trauma scores. Psychological surveillance can provide an important source of evidence for occupational health practitioners working with CAIs in informing them of the factors which could be considered in selecting, training, supporting and retaining officers and staff. Psychological surveillance can also help police management to identify ways to monitor the long-term effectiveness and well-being of CAIs.

Commercial incineration demonstration

International Nuclear Information System (INIS)

Vavruska, J.S.; Borduin, L.C.

1982-01-01

Low-level radioactive wastes (LLW) generated by nuclear utilities presently are shipped to commercial burial grounds for disposal. Increasing transportation and disposal costs have caused industry to consider incineration as a cost-effective means of volume reduction of combustible LLW. Repeated inquiries from the nuclear industry regarding the applicability of the Los Alamos controlled air incineration (CAI) design led the DOE to initiate a commercial demonstration program in FY-1980. Development studies and results in support of this program involving ion exchange resin incineration and fission/activation product distributions within the Los Alamos CAI are described

Steering committee for the management of the post-accidental phase of a nuclear accident or of a radiological situation (CODIRPA). Validated report of the 'Public reception and information Centre' work group - December 2011. Work document

International Nuclear Information System (INIS)

2011-12-01

As previous works performed by the CODIRPA proposed the creation of Centres for public reception and information (CAIs) within the population protection area, and as local groups have been created in three districts (Vienne, Haut-Rhin, Drome) to work on the preparation of the implementation of such centres, this report proposes a synthesis of these previous works, examines the doctrine related to the support to victims of collective accidents by the ministry of interior and by the ministry of justice, and finally makes recommendations and proposals for the implementation of CAIs in a post-accidental situation

Light-element nucleosynthesis in a molecular cloud interacting with a supernova remnant and the origin of beryllium-10 in the protosolar nebula

International Nuclear Information System (INIS)

Tatischeff, Vincent; Duprat, Jean; De Séréville, Nicolas

2014-01-01

The presence of short-lived radionuclides (t 1/2 < 10 Myr) in the early solar system provides important information about the astrophysical environment in which the solar system formed. The discovery of now extinct 10 Be (t 1/2 = 1.4 Myr) in calcium-aluminum-rich inclusions (CAIs) with Fractionation and Unidentified Nuclear isotope anomalies (FUN-CAIs) suggests that a baseline concentration of 10 Be in the early solar system was inherited from the protosolar molecular cloud. In this paper, we investigate various astrophysical contexts for the nonthermal nucleosynthesis of 10 Be by cosmic-ray-induced reactions. We first show that the 10 Be recorded in FUN-CAIs cannot have been produced in situ by irradiation of the FUN-CAIs themselves. We then show that trapping of Galactic cosmic rays (GCRs) in the collapsing presolar cloud core induced a negligible 10 Be contamination of the protosolar nebula, the inferred 10 Be/ 9 Be ratio being at least 40 times lower than that recorded in FUN-CAIs ( 10 Be/ 9 Be ∼ 3 × 10 –4 ). Irradiation of the presolar molecular cloud by background GCRs produced a steady-state 10 Be/ 9 Be ratio ≲ 1.3 × 10 –4 at the time of the solar system formation, which suggests that the presolar cloud was irradiated by an additional source of CRs. Considering a detailed model for CR acceleration in a supernova remnant (SNR), we find that the 10 Be abundance recorded in FUN-CAIs can be explained within two alternative scenarios: (1) the irradiation of a giant molecular cloud by CRs produced by ≳ 50 supernovae exploding in a superbubble of hot gas generated by a large star cluster of at least 20,000 members, and (2) the irradiation of the presolar molecular cloud by freshly accelerated CRs escaped from an isolated SNR at the end of the Sedov-Taylor phase. In the second picture, the SNR resulted from the explosion of a massive star that ran away from its parent OB association, expanded during most of its adiabatic phase in an intercloud medium of

Between the sea and the land: the livelihood of estuarine people in southeastern Brazil Entre o mar e a terra: modos de vida de comunidades estuarinas no sudeste do Brasil

Directory of Open Access Journals (Sweden)

Natalia anazaki

2007-06-01

Full Text Available The central focus of this study is to characterize and compare the livelihood strategies of two coastal communities from the estuarine region of Ribeira Valley (São Paulo State, Southeastern Brazil, analyzing the interplay among four economic activities: small-scale agriculture, fishing, tourism-related jobs, and extraction of non-timber vegetal resources. The local people of these communities are mostly Caiçara, the native inhabitants of southeastern Brazilian coast, in an Atlantic forest area. The miscegenation of Amerindians, European colonizers, and African Brazilians gave rise to the Caiçara people, whose subsistence was originally based on small-scale itinerant agriculture, small-scale fishery, and some extraction of forest products. Their livelihoods activities changed through time: agricultural practices were gradually abandoned, while fishing grew in importance. Recently, tourism-related jobs and the extraction of non-timber vegetal resources acquired a key role in the estuarine Caiçara livelihood. After an historical overview, we focus our analysis on the local factors and external pressures affecting the combination of these activities.O objetivo central deste artigo é caracterizar e comparar as estratégias dos meios de vida de duas comunidades da região estuarina do vale de Ribeira (Estado de São Paulo, analisando a inter-relação entre quatro atividades econômicas: agricultura de pequena escala, pesca, trabalhos relacionados ao turismo e extração de recursos vegetais não madeireiros. Os habitantes destas comunidades são na maior parte Caiçaras, nativos da costa sudeste do Brasil, vivendo em área do domínio Mata Atlântica. Caiçaras são descendentes de ameríndios e colonizadores europeus, com influências mais recentes de escravos africanos. Sua subsistência era baseada originalmente na agricultura itinerante de pequena escala, na pesca artesanal e, em menor grau, na extração de produtos florestais. Suas

El contrabando de armas no tiene fronteras (Internacional)

OpenAIRE

López, Noemí

2011-01-01

El tráfico de armas transfronterizo se ha convertido en una situación a combatir para los gobiernos locales. En el año 2004 la violencia en México se incrementó, al tiempo que el crecía el tráfico ilegal de armas desde los Estados Unidos. Esto aumentó los casos de violencia en el país y las bandas dedicadas al contrabando de armamento. En el año 2008 las autoridades de Estados Unidos y México crearon el plan "Armas Cruzadas" para combatir el contrabando de armas a través de su frontera común....

Tien procent minder emissies (interview met Chris Karman)

NARCIS (Netherlands)

Wolkers, H.; Karman, C.C.

2012-01-01

De nieuwe havensleepboot E3-Tug bespaart brandstof en vermindert emissies. IMARES Wageningen UR ontwikkelde de software die een optimale combinatie berekent van de elektrische en de dieselvoortstuwing.

Tien jaar Knolcyperus (Cyperus esculentus L.) in Nederland

NARCIS (Netherlands)

Rotteveel, A.J.W.

1993-01-01

Yellow nutsedge ( Cyperus esculentus L.) was first recorded in 1981 as an agricultural pest. A considerable number of fields was found to be infested. Because the species is very damaging to agriculture legal measures were taken to restrict the dispersion and promote the control of the weed. During

Moroccorp: tien miljoen woorden uit twee Marokkaans- Nederlandse ...

African Journals Online (AJOL)

beperkt tot Genk en ook straattaal (Appel 1999) is regiogebonden. Maar een goed begrip van deze variëteiten kan .... werd het eerste chatkanaal gelogd, en van juli tot en met september werd het tweede chatkanaal gelogd. Onze logactiviteiten .... is marked by certain contact phenomena". Die definities zien er op het eerste.

Prevalence of condomless anal intercourse and recent HIV testing and their associated factors among men who have sex with men in Hangzhou, China: A respondent-driven sampling survey.

Directory of Open Access Journals (Sweden)

Runhua Li

Full Text Available Men who have sex with men (MSM are a large high-risk population for HIV infection in recent years in China. A cross-sectional survey was conducted in Hangzhou, China, to determine rates of condomless anal intercourse (CAI, recent HIV testing (in the recent year and associated factors using respondent-driven sampling. Questionnaires using face-to-face interviews were employed to collect data on sexual risk behaviors and HIV testing. Five hundred eleven MSM were recruited, of which 459 (89.8% had anal intercourse in the past 6 months. Of these 459 participants, 457 (99.6% answered whether they had taken an HIV test in the recent year, so only their data were analyzed. Weighted data were analyzed using bivariate and multivariate logistic regression analysis. The CAI rate with male partners in the past 6 months was 43.7% (95% confidence interval [CI], 34.0-51.5%, while the rate of condomless vaginal intercourse (CVI was 21.6% (95% CI, 15.6-32.3%. The prevalence of recent HIV testing was 56.8% (95% CI, 48.7-66.5%, while the prevalence of HIV and syphilis were 8.8% and 6.5%, respectively. Multivariate analysis indicated that CAI was associated with earlier homosexual debut, suicidal inclinations, childhood sexual abuse, HIV testing in the recent year, and lower estimate of HIV prevalence. Recent HIV testing was associated with homosexual debut age, engaging in CAI with male partners in the past 6 months, having oral sex in the past 6 months, self-perceived higher likelihood of HIV infection, knowing about antiretroviral therapy for HIV/AIDS, receiving AIDS/sexually transmitted infection (STI interventions in the past year, and syphilis infection. Given high prevalence of HIV and syphilis, high levels of CAI and CVI, and low HIV testing rate, the results indicated high risk of HIV infection and transmission among MSM. HIV prevention interventions should target MSM with early homosexual debut and psychosocial health problems, while HIV/AIDS education

Prevalence of condomless anal intercourse and recent HIV testing and their associated factors among men who have sex with men in Hangzhou, China: A respondent-driven sampling survey.

Science.gov (United States)

Li, Runhua; Wang, Hui; Pan, Xiaohong; Ma, Qiaoqin; Chen, Lin; Zhou, Xin; Jiang, Tingting; He, Lin; Chen, Junfang; Zhang, Xingliang; Luo, Yan; Xi, Shengjun; Lv, Xin; Xia, Shichang

2017-01-01

Men who have sex with men (MSM) are a large high-risk population for HIV infection in recent years in China. A cross-sectional survey was conducted in Hangzhou, China, to determine rates of condomless anal intercourse (CAI), recent HIV testing (in the recent year) and associated factors using respondent-driven sampling. Questionnaires using face-to-face interviews were employed to collect data on sexual risk behaviors and HIV testing. Five hundred eleven MSM were recruited, of which 459 (89.8%) had anal intercourse in the past 6 months. Of these 459 participants, 457 (99.6%) answered whether they had taken an HIV test in the recent year, so only their data were analyzed. Weighted data were analyzed using bivariate and multivariate logistic regression analysis. The CAI rate with male partners in the past 6 months was 43.7% (95% confidence interval [CI], 34.0-51.5%), while the rate of condomless vaginal intercourse (CVI) was 21.6% (95% CI, 15.6-32.3%). The prevalence of recent HIV testing was 56.8% (95% CI, 48.7-66.5%), while the prevalence of HIV and syphilis were 8.8% and 6.5%, respectively. Multivariate analysis indicated that CAI was associated with earlier homosexual debut, suicidal inclinations, childhood sexual abuse, HIV testing in the recent year, and lower estimate of HIV prevalence. Recent HIV testing was associated with homosexual debut age, engaging in CAI with male partners in the past 6 months, having oral sex in the past 6 months, self-perceived higher likelihood of HIV infection, knowing about antiretroviral therapy for HIV/AIDS, receiving AIDS/sexually transmitted infection (STI) interventions in the past year, and syphilis infection. Given high prevalence of HIV and syphilis, high levels of CAI and CVI, and low HIV testing rate, the results indicated high risk of HIV infection and transmission among MSM. HIV prevention interventions should target MSM with early homosexual debut and psychosocial health problems, while HIV/AIDS education among MSM

Treatment and prevention of acute and recurrent ankle sprain: an overview of systematic reviews with meta-analysis.

Science.gov (United States)

Doherty, Cailbhe; Bleakley, Chris; Delahunt, Eamonn; Holden, Sinead

2017-01-01

Ankle sprains are highly prevalent with high risk of recurrence. Consequently, there are a significant number of research reports examining strategies for treating and preventing acute and recurrent sprains (otherwise known as chronic ankle instability (CAI)), with a coinciding proliferation of review articles summarising these reports. To provide a systematic overview of the systematic reviews evaluating treatment strategies for acute ankle sprain and CAI. Overview of intervention systematic reviews. Individuals with acute ankle sprain/CAI. The primary outcomes were injury/reinjury incidence and function. 46 papers were included in this systematic review. The reviews had a mean score of 6.5/11 on the AMSTAR quality assessment tool. There was strong evidence for bracing and moderate evidence for neuromuscular training in preventing recurrence of an ankle sprain. For the combined outcomes of pain, swelling and function after an acute sprain, there was strong evidence for non-steroidal anti-inflammatory drugs and early mobilisation, with moderate evidence supporting exercise and manual therapy techniques. There was conflicting evidence regarding the efficacy of surgery and acupuncture for the treatment of acute ankle sprains. There was insufficient evidence to support the use of ultrasound in the treatment of acute ankle sprains. For the treatment of acute ankle sprain, there is strong evidence for non-steroidal anti-inflammatory drugs and early mobilisation, with moderate evidence supporting exercise and manual therapy techniques, for pain, swelling and function. Exercise therapy and bracing are supported in the prevention of CAI. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

Managing ankle ligament sprains and tears: current opinion

Directory of Open Access Journals (Sweden)

McGovern RP

2016-03-01

Full Text Available Ryan P McGovern,1 RobRoy L Martin,1,2 1Department of Physical Therapy, Rangos School of Health Sciences, Duquesne University, 2Centers for Sports Medicine – University of Pittsburgh, Pittsburgh, PA, USA Abstract: The purpose of this paper is to present a current review of pathoanatomical features, differential diagnosis, objective assessment, intervention, and clinical course associated with managing lateral ankle ligament sprains. Proper diagnosis and identification of affected structures should be obtained through history and objective assessment. From this information, an individualized evidence-based intervention plan can be developed to enable recovery while decreasing the risk of reinjury. An appropriate evaluation is needed not only to determine the correct diagnosis but also to allow for grading and determining the prognosis of the injury in those with an acute lateral ankle sprain. Examination should include an assessment of impairments as well as a measure of activity and participation. Evidence-based interventions for those with an acute lateral ankle sprain should include weight bearing with bracing, manual therapy, progressive therapeutic exercises, and cryotherapy. For those with chronic ankle instability (CAI, interventions should include manual therapy and a comprehensive rehabilitation program. It is essential to understand the normal clinical course for athletes who sustain a lateral ankle sprain as well as risk factors for an acute injury and CAI. Risk factors for both an acute lateral ankle sprain and CAI include not using an external support and not participating in an appropriate exercise program. Incorporating the latest evidence-based rehabilitation techniques provides the best course of treatment for athletes with an acute ankle sprain or CAI. Keywords: reinjury, chronic ankle instability, rehabilitation techniques, diagnosis, intervention, athlete

Simulation-based evaluation of a cold atom interferometry gradiometer concept for gravity field recovery

Science.gov (United States)

Douch, Karim; Wu, Hu; Schubert, Christian; Müller, Jürgen; Pereira dos Santos, Franck

2018-03-01

The prospects of future satellite gravimetry missions to sustain a continuous and improved observation of the gravitational field have stimulated studies of new concepts of space inertial sensors with potentially improved precision and stability. This is in particular the case for cold-atom interferometry (CAI) gradiometry which is the object of this paper. The performance of a specific CAI gradiometer design is studied here in terms of quality of the recovered gravity field through a closed-loop numerical simulation of the measurement and processing workflow. First we show that mapping the time-variable field on a monthly basis would require a noise level below 5mE /√{Hz } . The mission scenarios are therefore focused on the static field, like GOCE. Second, the stringent requirement on the angular velocity of a one-arm gradiometer, which must not exceed 10-6 rad/s, leads to two possible modes of operation of the CAI gradiometer: the nadir and the quasi-inertial mode. In the nadir mode, which corresponds to the usual Earth-pointing satellite attitude, only the gradient Vyy , along the cross-track direction, is measured. In the quasi-inertial mode, the satellite attitude is approximately constant in the inertial reference frame and the 3 diagonal gradients Vxx,Vyy and Vzz are measured. Both modes are successively simulated for a 239 km altitude orbit and the error on the recovered gravity models eventually compared to GOCE solutions. We conclude that for the specific CAI gradiometer design assumed in this paper, only the quasi-inertial mode scenario would be able to significantly outperform GOCE results at the cost of technically challenging requirements on the orbit and attitude control.

Corrective Action Decision Document/Closure Report for Corrective Action Unit 232: Area 25 Sewage Lagoons, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

US Department of Energy Nevada Operations Office

1999-01-01

This Corrective Action Decision Document/Closure Report (CADD/CR) has been prepared for Corrective Action Unit (CAU) 232, Area 25 Sewage Lagoons, in accordance with the Federal Facility Agreement and Consent Order. Located at the Nevada Test Site in Nevada, approximately 65 miles northwest of Las Vegas, CAU 232 is comprised of Corrective Action Site 25-03-01, Sewage Lagoon. This CADD/CR identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's (DOE/NV's) recommendation that no corrective action is deemed necessary for CAU 232. The Corrective Action Decision Document and Closure Report have been combined into one report because sample data collected during the July 1999 corrective action investigation (CAI) activities disclosed no evidence of contamination at the site. Contaminants of potential concern (COPCs) addressed during the CAI included total volatile organic compounds, total semivolatile organic compounds, total Resource Conservation and Recovery Act metals, total pesticides, total herbicides, total petroleum hydrocarbons (gasoline and diesel/oil range), polychlorinated biphenyls, isotopic uranium, isotopic plutonium, strontium-90, and gamma-emitting radionuclides. The data confirmed that none of the COPCs identified exceeded preliminary action levels outlined in the CAIP; therefore, no corrective actions were necessary for CAU 232. After the CAI, best management practice activities were completed and included installation of a fence and signs to limit access to the lagoons, cementing Manhole No. 2 and the diverter box, and closing off influent and effluent ends of the sewage lagoon piping. As a result of the CAI, the DOE/NV recommended that: (1) no further actions were required; (2) no Corrective Action Plan would be required; and (3) no use restrictions were required to be placed on the CAU

The Origin and Evolution of Nucleosynthetic Sr Isotope Variability in Calcium and Aluminum-rich Refractory Inclusions

Science.gov (United States)

Myojo, Kunihiro; Yokoyama, Tetsuya; Okabayashi, Satoki; Wakaki, Shigeyuki; Sugiura, Naoji; Iwamori, Hikaru

2018-01-01

Nucleosynthetic isotope anomalies in meteorites are useful for investigating the origin of materials in the protoplanetary disk and dynamical processes of planetary formation. In particular, calcium and aluminum-rich inclusions (CAIs) found in chondrites are key minerals for decoding the initial conditions of the solar system before the accretion of small planetary bodies. In this study, we report isotopic analyses for three Allende CAIs, fluffy type A (FTA), type B, and fine-grained spinel rich (FS) inclusions, with a specific emphasis on the measurements of 84Sr/86Sr ratios. It was found that the average μ 84Sr values (106 relative deviations from a standard material) were 175, 129, and 56 ppm for the samples of FTA, type B, and FS inclusions, respectively. Additionally, the FTA samples exhibited heterogeneous μ 84Sr values, while those for the type B and FS inclusions were homogeneous within individual inclusions. The elevated μ 84Sr values were most likely explained by the relative enrichment of r-process nuclides in the CAI formation region. The variation of μ 84Sr values between the FTA and type B inclusions, as well as within the FTA inclusion, suggests the presence of multiple CAI source reservoirs with distinct isotopic compositions, which is either inherited from isotopic heterogeneity in the molecular cloud or caused by the selective destruction of r-process-enriched supernova grains via nebular thermal processing. On the other hand, the reaction between a refractory precursor of the FS inclusion and a gaseous reservoir enriched in Mg, Si, and 16O resulted in the lowest μ 84Sr values for the FS inclusion.

Role of testosterone and Y chromosome genes for the masculinization of the human brain.

Science.gov (United States)

Savic, Ivanka; Frisen, Louise; Manzouri, Amirhossein; Nordenstrom, Anna; Lindén Hirschberg, Angelica

2017-04-01

Women with complete androgen insensitivity syndrome (CAIS) have a male (46,XY) karyotype but no functional androgen receptors. Their condition, therefore, offers a unique model for studying testosterone effects on cerebral sex dimorphism. We present MRI data from 16 women with CAIS and 32 male (46,XY) and 32 female (46,XX) controls. FreeSurfer software was employed to measure cortical thickness and subcortical structural volumes. Axonal connections, indexed by fractional anisotropy, (FA) were measured with diffusion tensor imaging, and functional connectivity with resting state fMRI. Compared to men, CAIS women displayed a "female" pattern by having thicker parietal and occipital cortices, lower FA values in the right corticospinal, superior and inferior longitudinal tracts, and corpus callosum. Their functional connectivity from the amygdala to the medial prefrontal cortex, was stronger and amygdala-connections to the motor cortex weaker than in control men. CAIS and control women also showed stronger posterior cingulate and precuneus connections in the default mode network. Thickness of the motor cortex, the caudate volume, and the FA in the callosal body followed, however, a "male" pattern. Altogether, these data suggest that testosterone modulates the microstructure of somatosensory and visual cortices and their axonal connections to the frontal cortex. Testosterone also influenced functional connections from the amygdala, whereas the motor cortex could, in agreement with our previous reports, be moderated by processes linked to X-chromosome gene dosage. These data raise the question about other genetic factors masculinizing the human brain than the SRY gene and testosterone. Hum Brain Mapp 38:1801-1814, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

Bogotá no tiene mar pero tiene playa: el vallenato y sus intérpretes costeños en Bogotá

OpenAIRE

Jaramillo Acuña, Juan Guillermo

2015-01-01

La Playa es un sector de la ciudad de Bogotá, donde se encuentra la oferta de músicos informales más grande de Colombia: mariachis, tríos de cuerda y grupos vallenatos. En esta investigación, se analiza la migración de músicos vallenatos provenientes del Caribe colombiano a este sector de la capital del país; se examina el trabajo de estos músicos en La Playa; y se revisa el proceso de consolidación del vallenato como música nacional.

Oral health in young women having a low calcium and vitamin D nutritional status.

Science.gov (United States)

Antonenko, O; Bryk, G; Brito, G; Pellegrini, G; Zeni, S N

2015-07-01

Oral health plays an important role in an individual's eating choices, which in turn ensure good nutrition throughout life. The deterioration in diet quality may partially explain the association between tooth loss and several systemic diseases, including osteoporosis. The study evaluated the association between oral health and calcium (Ca) and vitamin D nutritional status. The effect of several dietary and lifestyle habits was also evaluated. One hundred six women aged 23.7 ± 0.4 years were evaluated. Ca intake (CaI) and protein intake were recorded, and 25-hydroxyvitamin D (25OHD) was evaluated. Dental status and caries risk were assessed by determining the number of decayed (D), missing (M), and filled (F) teeth and DMFT index, Löe Silness plaque index (PI), and sugar intake (SI). Deficient CaI was observed in 59% of women; 71% had 25OHD oral disease in the studied group of young women and low CaI. Although caries progression is a complex process involving multiple factors, an adequate nutritional status of Ca and vitamin D could be an additional factor that may help preserve a good oral health.

The Effect of Joint Mobilization on Dynamic Postural Control in Patients With Chronic Ankle Instability: A Critically Appraised Topic.

Science.gov (United States)

Kosik, Kyle B; Gribble, Phillip A

2018-01-01

Clinical Scenario: Dorsiflexion range of motion is an important factor in the performance of the Star Excursion Balance Test (SEBT). While patients with chronic ankle instability (CAI) commonly experience decreased reach distances on the SEBT, ankle joint mobilization has been suggested to be an effective therapeutic intervention for targeting dorsiflexion range of motion. What is the evidence to support ankle joint mobilization for improving performance on the SEBT in patients with CAI? Summary of Key Findings: The literature was searched for articles examining the effects of ankle joint mobilization on scores of the SEBT. A total of 3 peer-reviewed articles were retrieved, 2 prospective individual cohort studies and 1 randomized controlled trial. Only 2 articles demonstrated favorable results following 6 sessions of ankle joint mobilization. Clinical Bottom Line: Despite the mixed results, the majority of the available evidence suggests that ankle joint mobilization improves dynamic postural control. Strength of Recommendation: In accordance with the Centre of Evidence Based Medicine, the inconsistent results and the limited high-quality studies indicate that there is level C evidence to support the use of ankle joint mobilization to improve performance on the SEBT in patients with CAI.

The effect of two mobilization techniques on dorsiflexion in people with chronic ankle instability.

Science.gov (United States)

Marrón-Gómez, David; Rodríguez-Fernández, Ángel L; Martín-Urrialde, José A

2015-02-01

To compare the effect of two manual therapy techniques, mobilization with movement (WB-MWM) and talocrural manipulation (HVLA), for the improvement of ankle dorsiflexion in people with chronic ankle instability (CAI) over 48 h. Randomized controlled clinical trial. University research laboratory. Fifty-two participants (mean ± SD age, 20.7 ± 3.4 years) with CAI were randomized to WB-MWM (n = 18), HVLA (n = 19) or placebo group (n = 15). Weight-bearing ankle dorsiflexion measured with the weight-bearing lunge. Measurements were obtained prior to intervention, immediately after intervention, and 10 min, 24 h and 48 h post-intervention. There was a significant effect × time (F4,192 = 20.65; P ankle dorsiflexion in both WB-MWM and HVLA groups with respect to the placebo group with no differences between both active treatment groups. A single application of WB-MWM or HVLA manual technique improves ankle dorsiflexion in people with CAI, and the effects persist for at least two days. Both techniques have similar effectiveness for improving ankle dorsiflexion although WB-MWM demonstrated greater effect sizes. Copyright © 2014 Elsevier Ltd. All rights reserved.

FREQUÊNCIA DE OCORRÊNCIA E CARACTERÍSTICAS MORFOLÓGICAS EXTERNOS DE PEIXES MARINHOS DE CAIÇARA DO NORTE, RIO GRANDE DO NORTE, BRASIL

Directory of Open Access Journals (Sweden)

Marcelo Moreira Carvalho

2014-08-01

Full Text Available O litoral de Caiçara do Norte é considerado uma área de maior produção pesqueira artesanal do Rio Grande do Norte, Brasil. O objetivo deste estudo foi verificar a frequência de ocorrência, as características morfológicos externos de peixes marinhos de Caiçara do Norte, RN. Durante o período de julho de 2012 a agosto de 2013, foi registrada a ocorrência de cinco ordens (Beloniformes, Clupeiformes, Mugiliformes, Perciformes, Siluriformes, 13 famílias (Ariidae, Exocoetidae, Carangidae, Clupeidae, Coryphaenidae, Haemulidae, Hemiramphidae, Istiophoridae, Lutjanidae, Mugilidae, Sparidae, Serranidae,  Scombridae e 29 espécies de peixes marinhos. Os resultados do presente trabalho podem enriquecer o conhecimento da ictiofauna das águas costeiras de Caiçara do Norte, além de fornecer informações para o futuro planejamento da gestão e conservação dos recursos pesqueiros do litoral do Rio Grande do Norte, Brasil. Palavras chave: Águas costeiras; pesca artesanal; recursos pesqueiros; litoral norte do RN. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v4n2p55-63

Can surgical simulation be used to train detection and classification of neural networks?

Science.gov (United States)

Zisimopoulos, Odysseas; Flouty, Evangello; Stacey, Mark; Muscroft, Sam; Giataganas, Petros; Nehme, Jean; Chow, Andre; Stoyanov, Danail

2017-10-01

Computer-assisted interventions (CAI) aim to increase the effectiveness, precision and repeatability of procedures to improve surgical outcomes. The presence and motion of surgical tools is a key information input for CAI surgical phase recognition algorithms. Vision-based tool detection and recognition approaches are an attractive solution and can be designed to take advantage of the powerful deep learning paradigm that is rapidly advancing image recognition and classification. The challenge for such algorithms is the availability and quality of labelled data used for training. In this Letter, surgical simulation is used to train tool detection and segmentation based on deep convolutional neural networks and generative adversarial networks. The authors experiment with two network architectures for image segmentation in tool classes commonly encountered during cataract surgery. A commercially-available simulator is used to create a simulated cataract dataset for training models prior to performing transfer learning on real surgical data. To the best of authors' knowledge, this is the first attempt to train deep learning models for surgical instrument detection on simulated data while demonstrating promising results to generalise on real data. Results indicate that simulated data does have some potential for training advanced classification methods for CAI systems.

Development of a learning-oriented computer assisted instruction designed to improve skills in the clinical assessment of the nutritional status: a pilot evaluation.

Science.gov (United States)

García de Diego, Laura; Cuervo, Marta; Martínez, J Alfredo

2015-01-01

Computer assisted instruction (CAI) is an effective tool for evaluating and training students and professionals. In this article we will present a learning-oriented CAI, which has been developed for students and health professionals to acquire and retain new knowledge through the practice. A two-phase pilot evaluation was conducted, involving 8 nutrition experts and 30 postgraduate students, respectively. In each training session, the software developed guides users in the integral evaluation of a patient's nutritional status and helps them to implement actions. The program includes into the format clinical tools, which can be used to recognize possible patient's needs, to improve the clinical reasoning and to develop professional skills. Among them are assessment questionnaires and evaluation criteria, cardiovascular risk charts, clinical guidelines and photographs of various diseases. This CAI is a complete software package easy to use and versatile, aimed at clinical specialists, medical staff, scientists, educators and clinical students, which can be used as a learning tool. This application constitutes an advanced method for students and health professionals to accomplish nutritional assessments combining theoretical and empirical issues, which can be implemented in their academic curriculum.

Complete Androgen Insensitivity Syndrome: A Rare Case of Disorder of Sex Development

Directory of Open Access Journals (Sweden)

Alfonsa Pizzo

2013-01-01

Full Text Available Androgen Insensitivity Syndrome (AIS could be considered as a disease that causes resistance to androgens actions, influencing both the morphogenesis and differentiation of the body structures, and systems in which this hormone exerts its effects. It depends on an X-linked mutations in the Androgen Receptor (AR gene that express a variety of phenotypes ranging from male infertility to completely normal female external genitalia. The clinical phenotypes of AIS could vary and be classified into three categories, as complete (CAIS, partial (PAIS, and mild (MAIS forms, according to the severity of androgen resistance. We will describe a case of CAIS in a 16-year-old patient.

Evidence for multiple sources of 10Be in the early solar system

DEFF Research Database (Denmark)

Wielandt, Daniel Kim Peel; Nagashima, Kazuhide; Krot, Alexander N.

2012-01-01

Beryllium-10 is a short-lived radionuclide (t 1/2 = 1.4 Myr) uniquely synthesized by spallation reactions and inferred to have been present when the solar system's oldest solids (calcium-aluminum-rich inclusions, CAIs) formed. Yet, the astrophysical site of 10Be nucleosynthesis is uncertain. We...... in the gaseous CAI-forming reservoir, or in the inclusions themselves: this indicates at least two nucleosynthetic sources of 10Be in the early solar system. The most promising locale for 10Be synthesis is close to the proto-Sun during its early mass-accreting stages, as these are thought to coincide...

Radioimmunoassay of rat carbonic anhydrases I and II. Application to central nervous system during ontogenesis

International Nuclear Information System (INIS)

Limozin, Nicole; Filippi, Danielle; Dalmasso, Christiane; Laurent, Georgette

1979-01-01

A specific radioimmunoassay method for rat erythrocyte carbonic anhydrases I and II was developed using a double antibody system. Its sensitivity was in the nanogram range for each of the two isozymes. The method has been applied to the assay of cerebral carbonic anhydrase. Only CAII has been found in brain extracts of perfused rats. Accordingly, the assay of CAI in cerebral tissue can be used to quantify erythrocyte contamination on condition that the ratio CAII/CAI in blood had been worked out. The developmental change in the soluble and the Triton X-100 solubilized brain CAII from birth to adult is reported [fr

Isotopic Investigations of Nebular and Parent Body Processes with a High Sensitivity Ion Microprobe

Science.gov (United States)

McKeegan, Kevin D.

2005-01-01

NASA supported the development of the CAMECA ims 1270 ion microprobe at UCLA for applications in cosmochemistry. The primary investigations centered on measuring the microscopic distributions of key isotopic abundances in primitive meteoritic materials as a means of constraining the nature of important thermal and chemical processes in the solar nebula and the timescales associated with those processes. Our prior work on oxygen isotope anomalies in a wide variety of meteoritic materials had led us to a view of a spatially heterogeneous nebula, and in particular, a restricted region for CAI formation that is characterized by O-16-rich gas. Because of its production of CAIs in the energetic local environment near the protosun, the existence of a natural transport mechanism via bipolar outflows, and a general astrophysical plausibility, we were attracted to the fluctuating X-wind model which had been put forward by Frank Shu, Typhoon Lee, and colleagues. With our collaborators, we undertook a series of investigations to test the viability of this hypothesis; this work led directly to the discovery of live Be in CAIs and a clear demonstration of the existence of 160-rich condensates, which necessarily implies an O-16-rich gaseous reservoir in the nebula. Both of these observations fit well within the context of X-wind type models, i.e. formation of CAIs (or condensation of their precursors) in the reconnection ring sunward of the inner edge of the accretion disk, however much work remains to be done to test whether the physical parameters of the model can quantitatively predict not only the thermal histories of CAIs but also their radioactivity. The issue of spatial heterogeneity in the nebula, central to the X-wind model, is also at the heart of any chronology based on short-lived radioisotopes. In this work, we followed up on strong hints for presence of exireme:j: (53 day) short-lived Be-7, and have prepared a manuscript (in revision). We also measured A1-Mg

Corrective Action Decision Document for Corrective Action Unit 563: Septic Systems, Nevada Test Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Grant Evenson

2008-02-01

This Corrective Action Decision Document has been prepared for Corrective Action Unit (CAU) 563, Septic Systems, in accordance with the Federal Facility Agreement and Consent Order (FFACO, 1996; as amended January 2007). The corrective action sites (CASs) for CAU 563 are located in Areas 3 and 12 of the Nevada Test Site, Nevada, and are comprised of the following four sites: •03-04-02, Area 3 Subdock Septic Tank •03-59-05, Area 3 Subdock Cesspool •12-59-01, Drilling/Welding Shop Septic Tanks •12-60-01, Drilling/Welding Shop Outfalls The purpose of this Corrective Action Decision Document is to identify and provide the rationale for the recommendation of a corrective action alternative (CAA) for the four CASs within CAU 563. Corrective action investigation (CAI) activities were performed from July 17 through November 19, 2007, as set forth in the CAU 563 Corrective Action Investigation Plan (NNSA/NSO, 2007). Analytes detected during the CAI were evaluated against appropriate final action levels (FALs) to identify the contaminants of concern (COCs) for each CAS. The results of the CAI identified COCs at one of the four CASs in CAU 563 and required the evaluation of CAAs. Assessment of the data generated from investigation activities conducted at CAU 563 revealed the following: •CASs 03-04-02, 03-59-05, and 12-60-01 do not contain contamination at concentrations exceeding the FALs. •CAS 12-59-01 contains arsenic and chromium contamination above FALs in surface and near-surface soils surrounding a stained location within the site. Based on the evaluation of analytical data from the CAI, review of future and current operations at CAS 12-59-01, and the detailed and comparative analysis of the potential CAAs, the following corrective actions are recommended for CAU 563.

The prevalence and natural history of complex sleep apnea.

Science.gov (United States)

Javaheri, Shahrokh; Smith, Jason; Chung, Eugene

2009-06-15

Central sleep apnea (CSA) may occasionally occur in patients with obstructive sleep apnea during titration with a continuous positive airway pressure (CPAP) device. To determine the prevalence and the natural history of CPAP-emergent CSA. This is a retrospective study of 1286 patients with a diagnosis of OSAwho underwent titration with a positive airway device during a 1-year period. Patients were seen in consultation and underwent full-night attended polysomnography followed by full-night attended CPAP titration. Four weeks after CPAP therapy, patients returned to the clinic for follow-up, and objective adherence to CPAP was recorded. In patients who had CSA on CPAP, a second full-night attended CPAP titration was recommended. Eighty-four of the 1286 patients developed a central apnea index (CAI) of 5 or greater per hour while on CPAP. The incidence of CSA varied from 3% to 10% monthly, with an overall incidence of 6.5%. Forty-two of the 84 patients returned for a second CPAP titration. In 33 patients, CSA was eliminated. In each of the remaining 9 patients, the CAI remained at 5 or greater per hour, with an average of 13 per hour. These patients characteristically had the most severe OSA, and 5 had a CAI of 5 or more per hour at baseline. Two of the 9 patients were on opioids In this large retrospective study of 1286 patients with a diagnosis of OSA, 6.5% had CPAP-emergent or persistent CSA. However, CPAP-emergent CSA was generally transitory and was eliminated within 8 weeks after CPAP therapy. The prevalence of CPAP-persistent CSA was about 1.5%. Severity of OSA, a CAI of 5 or greater per hour, and use of opioids were potential risk factors.

Corrective Action Decision Document/Closure Report for Corrective Action Unit 266: Area 25 Building 3124 Leachfield, Nevada Test Site, Nevada

Energy Technology Data Exchange (ETDEWEB)

NNSA/NV

2000-02-17

This Corrective Action Decision Document/Closure Report (CADD/CR) was prepared for Corrective Action Unit (CAU) 266, Area 25 Building 3124 Leachfield, in accordance with the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 266 includes Corrective Action Site (CAS) 25-05-09. The Corrective Action Decision Document and Closure Report were combined into one report because sample data collected during the corrective action investigation (CAI) indicated that contaminants of concern (COCs) were either not present in the soil, or present at concentrations not requiring corrective action. This CADD/CR identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's recommendation that no corrective action was necessary for CAU 266. From February through May 1999, CAI activities were performed as set forth in the related Corrective Action Investigation Plan. Analytes detected during the three-stage CAI of CAU 266 were evaluated against preliminary action levels (PALs) to determine COCs, and the analysis of the data generated from soil collection activities indicated the PALs were not exceeded for total volatile/semivolatile organic compounds, total petroleum hydrocarbons, polychlorinated biphenyls, total Resource Conservation and Recovery Act metals, gamma-emitting radionuclides, isotopic uranium/plutonium, and strontium-90 for any of the samples. However, COCs were identified in samples from within the septic tank and distribution box; and the isotopic americium concentrations in the two soil samples did exceed PALs. Closure activities were performed at the site to address the COCs identified in the septic tank and distribution box. Further, no use restrictions were required to be placed on CAU 266 because the CAI revealed soil contamination to be less than the 100 millirems per year limit established by DOE Order 5400.5.

Effect of water content and organic carbon on remote sensing of crop residue cover

Science.gov (United States)

Serbin, G.; Hunt, E. R., Jr.; Daughtry, C. S. T.; McCarty, G. W.; Brown, D. J.; Doraiswamy, P. C.

2009-04-01

Crop residue cover is an important indicator of tillage method. Remote sensing of crop residue cover is an attractive and efficient method when compared with traditional ground-based methods, e.g., the line-point transect or windshield survey. A number of spectral indices have been devised for residue cover estimation. Of these, the most effective are those in the shortwave infrared portion of the spectrum, situated between 1950 and 2500 nm. These indices include the hyperspectral Cellulose Absorption Index (CAI), and advanced multispectral indices, i.e., the Lignin-Cellulose Absorption (LCA) index and the Shortwave Infrared Normalized Difference Residue Index (SINDRI), which were devised for the NASA Terra Advanced Spaceborne Thermal Emission and Reflection Radiometer (ASTER) sensor. Spectra of numerous soils from U.S. Corn Belt (Indiana and Iowa) were acquired under wetness conditions varying from saturation to oven-dry conditions. The behavior of soil reflectance with water content was also dependent on the soil organic carbon content (SOC) of the soils, and the location of the spectral bands relative to significant water absorptions. High-SOC soils showed the least change in spectral index values with increase in soil water content. Low-SOC soils, on the other hand, showed measurable difference. For CAI, low-SOC soils show an initial decrease in index value followed by an increase, due to the way that water content affects CAI spectral bands. Crop residue CAI values decrease with water content. For LCA, water content increases decrease crop residue index values and increase them for soils, resulting in decreased contrast. SINDRI is also affected by SOC and water content. As such, spatial information on the distribution of surface soil water content and SOC, when used in a geographic information system (GIS), will improve the accuracy of remotely-sensed crop residue cover estimates.

The effects of mobilization with movement on dorsiflexion range of motion, dynamic balance, and self-reported function in individuals with chronic ankle instability.

Science.gov (United States)

Gilbreath, Julie P; Gaven, Stacey L; Van Lunen, L; Hoch, Matthew C

2014-04-01

Previous studies have examined the effectiveness of a manual therapy intervention known as Mobilization with Movement (MWM) to increase dorsiflexion range of motion (ROM) in individuals with chronic ankle instability (CAI). While a single talocrural MWM treatment has increased dorsiflexion ROM in these individuals, examining the effects of multiple treatments on dorsiflexion ROM, dynamic balance, and self-reported function would enhance the clinical application of this intervention. This study sought to determine if three treatment sessions of talocrural MWM would improve dorsiflexion ROM, Star Excursion Balance Test (SEBT) reach distances, and self-reported function using the Foot and Ankle Ability Measure (FAAM) in individuals with CAI. Eleven participants with CAI (5 Males, 6 Females, age: 21.5 ± 2.2 years, weight: 83.9 ± 15.6 kg, height: 177.7 ± 10.9 cm, Cumberland Ankle Instability Tool: 17.5 ± 4.2) volunteered in this repeated-measures study. Subjects received three MWM treatments over one week. Weight-bearing dorsiflexion ROM (cm), normalized SEBT reach distances (%), and self-reported function (%) were assessed one week before the intervention (baseline), prior to the first MWM treatment (pre-intervention), and 24–48 h following the final treatment (post-intervention). No significant changes were identified in dorsiflexion ROM, SEBT reach distances, or the FAAM-Activities of Daily Living scale (p > 0.05). Significant changes were identified on the FAAM-Sport (p = 0.01). FAAM-Sport scores were significantly greater post-intervention (86.82 ± 9.18%) compared to baseline (77.27 ± 11.09%; p = 0.01) and pre-intervention (79.82 ± 13.45%; p = 0.04). These results indicate the MWM intervention did not improve dorsiflexion ROM, dynamic balance, or patient-centered measures of activities of daily living. However, MWM did improve patient-centered measures of sport-related activities in individuals with CAI.

Corrective Action Decision Document/Closure Report for Corrective Action Unit 266: Area 25 Building 3124 Leachfield, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

2000-01-01

This Corrective Action Decision Document/Closure Report (CADD/CR) was prepared for Corrective Action Unit (CAU) 266, Area 25 Building 3124 Leachfield, in accordance with the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 266 includes Corrective Action Site (CAS) 25-05-09. The Corrective Action Decision Document and Closure Report were combined into one report because sample data collected during the corrective action investigation (CAI) indicated that contaminants of concern (COCs) were either not present in the soil, or present at concentrations not requiring corrective action. This CADD/CR identifies and rationalizes the U.S. Department of Energy, Nevada Operations Office's recommendation that no corrective action was necessary for CAU 266. From February through May 1999, CAI activities were performed as set forth in the related Corrective Action Investigation Plan. Analytes detected during the three-stage CAI of CAU 266 were evaluated against preliminary action levels (PALs) to determine COCs, and the analysis of the data generated from soil collection activities indicated the PALs were not exceeded for total volatile/semivolatile organic compounds, total petroleum hydrocarbons, polychlorinated biphenyls, total Resource Conservation and Recovery Act metals, gamma-emitting radionuclides, isotopic uranium/plutonium, and strontium-90 for any of the samples. However, COCs were identified in samples from within the septic tank and distribution box; and the isotopic americium concentrations in the two soil samples did exceed PALs. Closure activities were performed at the site to address the COCs identified in the septic tank and distribution box. Further, no use restrictions were required to be placed on CAU 266 because the CAI revealed soil contamination to be less than the 100 millirems per year limit established by DOE Order 5400.5

From policy to practice in the Affordable Care Act: Training center for New York State's health insurance programs.

Science.gov (United States)

Selwyn, Casey; Senter, Lindsay

2016-09-01

The United States currently faces the large, logistical undertaking of enrolling millions of Americans into a complex Affordable Care Act (ACA) system within a short period of time. One way states have addressed this implementation challenge is through the development of consumer assistance programs. In these programs, health care professionals-known as "Assistors"-are trained in insurance enrollment services to help consumers navigate the complex application and plan selection process, with the ultimate goal of optimizing enrollment rates. Cicatelli Associates Inc. (CAI), a non-profit capacity building organization, has served as the Statewide Training Center for New York's Health Insurance Program Initiative since 2013, before the ACA Marketplace roll-out occurred. This article presents a narrative of CAI's experiences and promising practices related to training and developing of the Assistor workforce in New York State (NYS). By the end of the second enrollment period (February 2015), NYS trained and certified over 11,000 Assistors (1); CAI trained fifteen percent of this total workforce. As a result of this intensive workforce training effort, NYS observed extremely high rates of facilitated enrollment, and overall success with the roll-out process. Through this initiative, CAI has garnered key insights for other organizations that engage in similar work, as well as state policymakers considering how to integrate and bolster the Assistor programs in their states. These lessons include: the necessity of ensuring that Assistors are armed with all technical concepts and messages; ensuring that Assistors are motivated to work through a change process; the constructive feedback process that can occur when these Assistors directly communicate issues to the state; and the transformation of public opinion that can occur when Assistors provide good customer service and can effectively promote statewide and federal ACA policies and benefits. Copyright © 2016 Elsevier

A decade of AMS at University of Georgia

Energy Technology Data Exchange (ETDEWEB)

Culp, Randy, E-mail: rculp@uga.edu [Center for Applied Isotope Studies, University of Georgia, Athens, GA (United States); Noakes, John; Cherkinsky, Alex; Ravi Prasad, G.V.; Dvoracek, Doug [Center for Applied Isotope Studies, University of Georgia, Athens, GA (United States)

2013-01-15

In a span of 10 years, University of Georgia's Center for Applied Isotope Studies (CAIS) has transformed itself from principally a liquid scintillation counting (LSC) laboratory to one conducting thousands of accelerator mass spectrometry (AMS) and stable isotope ratio analysis (SIRA) annually. After receiving the first of the NEC compact AMS units in the United States, the CAIS began to meet the demand for {sup 14}C analysis outside the normal realm of most radiocarbon dating laboratories. With industry's support, isotope research continued on an already developing natural products program to authenticate materials origin and process of formation. The CAIS's AMS allowed for the detection of synthetic materials in milligram quantities rather than gram quantities required by LSC and allowed new compound specific SIRA techniques to be directed toward compound specific {sup 14}C measurement. By 2005 the CAIS was one of only a few laboratories accredited to determine bio-base content in industrial fuels and products by both AMS and LSC following ASTM D6866-10 [1]. Since 2001, when our first sample was analyzed by AMS method, both radiocarbon and natural products sample numbers have increased steadily. The advantages of AMS analysis in overall efficiency, cost savings, accuracy, and precision, are detailed here in a review of analytical precision for radiocarbon and natural products analyzed over 10 years of AMS operation. Comparisons are made between natural products and bio-based materials analyzed by both AMS and LSC. Although high precision is not required to authenticate natural products, for the purpose of product comparison with regard to degree of naturalness accurate and precise {sup 14}C measurement is shown to be achievable by both methods.

Effects of focal ankle joint cooling on unipedal static balance in individuals with and without chronic ankle instability.

Science.gov (United States)

Kim, Kyung-Min; Hart, Joseph M; Saliba, Susan A; Hertel, Jay

2015-01-01

Application of cryotherapy over an injured joint has been shown to improve muscle function, yet it is unknown how ankle cryotherapy affects postural control. Our purpose was to determine the effects of a 20-min focal ankle joint cooling on unipedal static stance in individuals with and without chronic ankle instability (CAI). Fifteen young subjects with CAI (9 males, 6 females) and 15 healthy gender-matched controls participated. All subjects underwent two intervention sessions on different days in which they had a 1.5L plastic bag filled with either crushed ice (active treatment) or candy corn (sham) applied to the ankle. Unipedal stance with eyes closed for 10s were assessed with a forceplate before and after each intervention. Center of pressure (COP) data were used to compute 10 specific dependent measures including velocity, area, standard deviation (SD), and percent range of COP excursions, and mean and SD of time-to-boundary (TTB) minima in the anterior-posterior (AP) and mediolateral directions. For each measure a three-way (Group-Intervention-Time) repeated ANOVAs found no significant interactions and main effects involving intervention (all Ps > 0.05). There were group main effects found for mean velocity (F(1,28) = 6.46, P = .017), area (F(1,28) = 12.83, P = .001), and mean of TTB minima in the AP direction (F(1,28) = 5.19, P = .031) indicating that the CAI group demonstrated greater postural instability compared to the healthy group. Postural control of unipedal stance was not significantly altered following focal ankle joint cooling in groups both with and without CAI. Ankle joint cryotherapy was neither beneficial nor harmful to single leg balance. Copyright © 2014 Elsevier B.V. All rights reserved.

Facilitation of Hoffmann reflexes of ankle muscles in prone but not standing positions by focal ankle-joint cooling.

Science.gov (United States)

Kim, Kyung-Min; Ingersoll, Christopher D; Hertel, Jay

2015-05-01

Focal ankle-joint cooling (FAJC) has been shown to increase Hoffmann (H) reflex amplitudes of select leg muscles while subjects lie prone, but it is unknown whether the neurophysiological cooling effects persist in standing. To assess the effects of FAJC on H-reflexes of the soleus and fibularis longus during 3 body positions (prone, bipedal, and unipedal stances) in individuals with and without chronic ankle instability (CAI). Crossover. Laboratory. 15 young adults with CAI (9 male, 6 female) and 15 healthy controls. All subjects received both FAJC and sham treatments on separate days in a randomized order. FAJC was accomplished by applying a 1.5-L plastic bag filled with crushed ice to the ankle for 20 min. Sham treatment involved room-temperature candy corn. Maximum amplitudes of H-reflexes and motor (M) waves were recorded while subjects lay prone and then stood in quiet bipedal and unipedal stances before and immediately after each treatment. Primary outcome measures were H(max):M(max) ratios for the soleus and fibularis longus. Three-factor (group × treatment condition × time) repeated-measures ANOVAs and Fisher LSD tests were performed for statistical analyses. Significant interactions of treatment condition by time for prone H(max):M(max) ratios were found in the soleus (P = .001) and fibularis longus (P = .003). In both muscles, prone H(max):M(max) ratios moderately increased after FAJC but not after sham treatment. The CAI and healthy groups responded similarly to FAJC. In contrast, there were no significant interactions or main effects in the bipedal and unipedal stances in either muscle (P > .05). FAJC moderately increased H-reflex amplitudes of the soleus and fibularis longus while subjects were prone but not during bipedal or unipedal standing. These results were not different between groups with and without CAI.

Freeform surface measurement and characterisation using a toolmakers microscope

International Nuclear Information System (INIS)

Wong, Francis Seung-yin; Chauh, Kong-Bieng; Venuvinod, Patri K

2014-01-01

Current freeform surface (FFS) characterization systems mainly cover aspects related to computer-aided design/manufacture (CAD/CAM). This paper describes a new approach that extends into computer-aided inspection (CAI).The following novel features are addressed: - ◼ Feature recognition and extraction from surface data; - ◼ Characterisation of properties of the surface's M and N vectors at individual vertex; - ◼ Development of a measuring plan using a toolmakers microscope for the inspection of the FFS; - ◼ Inspection of the actual FFS produced by CNC milling; - ◼ Verification of the measurement results and comparison with the CAD design data; Tests have shown that the deviations between the CAI and CAD data were within the estimated uncertainty limits

Commercial incineration demonstration

International Nuclear Information System (INIS)

Borduin, L.C.; Neuls, A.S.

1981-01-01

Low-level radioactive wastes (LLW) generated by nuclear utilities presently are shipped to commercial burial grounds for disposal. Substantially increasing shipping and disposal charges have sparked renewed industry interest in incineration and other advanced volume reduction techniques as potential cost-saving measures. Repeated inquiries from industry sources regarding LLW applicability of the Los Alamos controlled-air incineration (CAI) design led DOE to initiate this commercial demonstration program in FY-1980. The selected program approach to achieving CAI demonstration at a utility site is a DOE sponsored joint effort involving Los Alamos, a nuclear utility, and a liaison subcontractor. Required development tasks and responsibilities of the particpants are described. Target date for project completion is the end of FY-1985

PSYCHE: An Object-Oriented Approach to Simulating Medical Education

Science.gov (United States)

Mullen, Jamie A.

1990-01-01

Traditional approaches to computer-assisted instruction (CAI) do not provide realistic simulations of medical education, in part because they do not utilize heterogeneous knowledge bases for their source of domain knowledge. PSYCHE, a CAI program designed to teach hypothetico-deductive psychiatric decision-making to medical students, uses an object-oriented implementation of an intelligent tutoring system (ITS) to model the student, domain expert, and tutor. It models the transactions between the participants in complex transaction chains, and uses heterogeneous knowledge bases to represent both domain and procedural knowledge in clinical medicine. This object-oriented approach is a flexible and dynamic approach to modeling, and represents a potentially valuable tool for the investigation of medical education and decision-making.

Comportamento alimentar inadequado: comparações em função do comprometimento ao exercício

Directory of Open Access Journals (Sweden)

Leonardo de Sousa Fortes

2013-01-01

Full Text Available El objetivo del presente estudio fue comparar los atributos de conductas de alimentación inapropiada (CAI dependiendo del grado de compromiso psicológico para el ejercicio (GCPE entre los atletas de ambos sexos. Participaron 580 personas de edades comprendidas entre los 10 y 19 años. Se utilizaron las sub escalas del Eating Attitudes Test (EAT-26 y la Escala de Dedicación al Ejercicio para evaluar atributos de CAI y GCPE respectivamente. Los resultados mostraron diferencias en la sub escala "Dieta" de acuerdo al GCPE para ambos sexos (p<0,05. Sin embargo, sólo entre los participantes del sexo masculino con edades entre 10 y 19 años, el test post hoc de Bonferroni mostró una diferencia en la sub escala "La bulimia y preocupación por los alimentos" entre los grupos GCPE (p<0,05. Por último, no hubo diferencias estadísticamente significativas en la sub escala "Autocontrol Oral", tanto para las mujeres, como para los hombres. Se concluyó que la restricción alimentaria patológica fue más frecuente en los atletas con GCPE altos para ambos sexos, que no se reflejan en los otros atributos de los CAI.

Dietetics students' ability to choose appropriate communication and counseling methods is improved by teaching behavior-change strategies in computer-assisted instruction.

Science.gov (United States)

Puri, Ruchi; Bell, Carol; Evers, William D

2010-06-01

Several models and theories have been proposed to help registered dietitians (RD) counsel and communicate nutrition information to patients. However, there is little time for students or interns to observe and/or participate in counseling sessions. Computer-assisted instruction (CAI) can be used to give students more opportunity to observe the various methods and theories of counseling. This study used CAI simulations of RD-client communications to examine whether students who worked through the CAI modules would choose more appropriate counseling methods. Modules were created based on information from experienced RD. They contained videos of RD-patient interactions and demonstrated helpful and less helpful methods of communication. Students in didactic programs in dietetics accessed the modules via the Internet. The intervention group of students received a pretest module, two tutorial modules, and a posttest module. The control group only received the pretest and posttest modules. Data were collected during three semesters in 2006 and 2007. Two sample t tests were used to compare pretest and posttest scores. The influence of other factors was measured using factorial analysis of variance. Statistical significance was set at Pcommunication and counseling methods for dietetics students. 2010 American Dietetic Association. Published by Elsevier Inc. All rights reserved.

Effects of Mixture Stratification on Combustion and Emissions of Boosted Controlled Auto-Ignition Engines

Directory of Open Access Journals (Sweden)

Jacek Hunicz

2017-12-01

Full Text Available The stratification of in-cylinder mixtures appears to be an effective method for managing the combustion process in controlled auto-ignition (CAI engines. Stratification can be achieved and controlled using various injection strategies such as split fuel injection and the introduction of a portion of fuel directly before the start of combustion. This study investigates the effect of injection timing and the amount of fuel injected for stratification on the combustion and emissions in CAI engine. The experimental research was performed on a single cylinder engine with direct gasoline injection. CAI combustion was achieved using negative valve overlap and exhaust gas trapping. The experiments were performed at constant engine fueling. Intake boost was applied to control the excess air ratio. The results show that the application of the late injection strategy has a significant effect on the heat release process. In general, the later the injection is and the more fuel is injected for stratification, the earlier the auto-ignition occurs. However, the experimental findings reveal that the effect of stratification on combustion duration is much more complex. Changes in combustion are reflected in NOX emissions. The attainable level of stratification is limited by the excessive emission of unburned hydrocarbons, CO and soot.

Caffeine Inhibits Fluid Secretion by Interlobular Ducts From Guinea Pig Pancreas.

Science.gov (United States)

Mochimaru, Yuka; Yamamoto, Akiko; Nakakuki, Miyuki; Yamaguchi, Makoto; Taniguchi, Ituka; Ishiguro, Hiroshi

2017-04-01

Caffeine is contained in coffee, tea, and numerous beverages and foods. We examined the direct effects of caffeine on the physiological function of pancreatic duct cells by using interlobular duct segments isolated from guinea pig pancreas. The rate of fluid secretion was continuously measured by monitoring the luminal volume of isolated duct segments. Changes in intracellular Ca concentration ([Ca]i) were estimated by microfluorometry in ducts loaded with Fura-2. Both secretin-stimulated and acetylcholine (ACh)-stimulated fluid secretions were substantially and reversibly inhibited by relatively low concentrations of caffeine as low as 0.03 mM relevant to blood levels after ingestion of caffeine-containing beverages. Caffeine inhibited ACh-induced elevation of [Ca]i and secretin-induced fluctuation of [Ca]i. Caffeine abolished thapsigargin-induced intracellular Ca release but did not affect the entry of extracellular Ca. Caffeine (0.05 mM) abolished ethanol (1 mM)-induced fluid hypersecretion in secretin-stimulated pancreatic duct. Low concentrations of caffeine directly inhibit pancreatic ductal fluid secretion stimulated by secretin or ACh and also ethanol-induced fluid hypersecretion. The inhibition by caffeine seems to be mediated by the blockade of intracellular Ca mobilization. Daily intake of caffeine may reduce the volume of pancreatic juice secretion.

Contribution a l'inspection automatique des pieces flexibles a l'etat libre sans gabarit de conformation

Science.gov (United States)

Sattarpanah Karganroudi, Sasan

The competitive industrial market demands manufacturing companies to provide the markets with a higher quality of production. The quality control department in industrial sectors verifies geometrical requirements of products with consistent tolerances. These requirements are presented in Geometric Dimensioning and Tolerancing (GD&T) standards. However, conventional measuring and dimensioning methods for manufactured parts are time-consuming and costly. Nowadays manual and tactile measuring methods have been replaced by Computer-Aided Inspection (CAI) methods. The CAI methods apply improvements in computational calculations and 3-D data acquisition devices (scanners) to compare the scan mesh of manufactured parts with the Computer-Aided Design (CAD) model. Metrology standards, such as ASME-Y14.5 and ISO-GPS, require implementing the inspection in free-state, wherein the part is only under its weight. Non-rigid parts are exempted from the free-state inspection rule because of their significant geometrical deviation in a free-state with respect to the tolerances. Despite the developments in CAI methods, inspection of non-rigid parts still remains a serious challenge. Conventional inspection methods apply complex fixtures for non-rigid parts to retrieve the functional shape of these parts on physical fixtures; however, the fabrication and setup of these fixtures are sophisticated and expensive. The cost of fixtures has doubled since the client and manufacturing sectors require repetitive and independent inspection fixtures. To eliminate the need for costly and time-consuming inspection fixtures, fixtureless inspection methods of non-rigid parts based on CAI methods have been developed. These methods aim at distinguishing flexible deformations of parts in a free-state from defects. Fixtureless inspection methods are required to be automatic, reliable, reasonably accurate and repeatable for non-rigid parts with complex shapes. The scan model, which is acquired as point

Inflammation and pancreatic cancer: molecular and functional interactions between S100A8, S100A9, NT-S100A8 and TGFβ1.

Science.gov (United States)

Basso, Daniela; Bozzato, Dania; Padoan, Andrea; Moz, Stefania; Zambon, Carlo-Federico; Fogar, Paola; Greco, Eliana; Scorzeto, Michele; Simonato, Francesca; Navaglia, Filippo; Fassan, Matteo; Pelloso, Michela; Dupont, Sirio; Pedrazzoli, Sergio; Fassina, Ambrogio; Plebani, Mario

2014-03-26

In order to gain further insight on the crosstalk between pancreatic cancer (PDAC) and stromal cells, we investigated interactions occurring between TGFβ1 and the inflammatory proteins S100A8, S100A9 and NT-S100A8, a PDAC-associated S100A8 derived peptide, in cell signaling, intracellular calcium (Cai2+) and epithelial to mesenchymal transition (EMT). NF-κB, Akt and mTOR pathways, Cai2+ and EMT were studied in well (Capan1 and BxPC3) and poorly differentiated (Panc1 and MiaPaCa2) cell lines. NT-S100A8, one of the low molecular weight N-terminal peptides from S100A8 to be released by PDAC-derived proteases, shared many effects on NF-κB, Akt and mTOR signaling with S100A8, but mainly with TGFβ1. The chief effects of S100A8, S100A9 and NT-S100A8 were to inhibit NF-κB and stimulate mTOR; the molecules inhibited Akt in Smad4-expressing, while stimulated Akt in Smad4 negative cells. By restoring Smad4 expression in BxPC3 and silencing it in MiaPaCa2, S100A8 and NT-S100A8 were shown to inhibit NF-κB and Akt in the presence of an intact TGFβ1 canonical signaling pathway. TGFβ1 counteracted S100A8, S100A9 and NT-S100A8 effects in Smad4 expressing, not in Smad4 negative cells, while it synergized with NT-S100A8 in altering Cai2+ and stimulating PDAC cell growth. The effects of TGFβ1 on both EMT (increased Twist and decreased N-Cadherin expression) and Cai2+ were antagonized by S100A9, which formed heterodimers with TGFβ1 (MALDI-TOF/MS and co-immuno-precipitation). The effects of S100A8 and S100A9 on PDAC cell signaling appear to be cell-type and context dependent. NT-S100A8 mimics the effects of TGFβ1 on cell signaling, and the formation of complexes between TGFβ1 with S100A9 appears to be the molecular mechanism underlying the reciprocal antagonism of these molecules on cell signaling, Cai2+ and EMT.

Tungsten isotopic compositions of iron meteorites: Chronological constraints vs. cosmogenic effects

Science.gov (United States)

Markowski, A.; Quitté, G.; Halliday, A. N.; Kleine, T.

2006-02-01

High-precision W isotopic compositions are presented for 35 iron meteorites from 7 magmatic groups (IC, IIAB, IID, IIIAB, IIIF, IVA, and IVB) and 3 non-magmatic groups (IAB, IIICD, and IIE). Small but resolvable isotopic variations are present both within and between iron meteorite groups. Variations in the 182W/ 184W ratio reflect either time intervals of metal-silicate differentiation, or result from the burnout of W isotopes caused by a prolonged exposure to galactic cosmic rays. Calculated apparent time spans for some groups of magmatic iron meteorites correspond to 8.5 ± 2.1 My (IID), 5.1 ± 2.3 My (IIAB), and 5.3 ± 1.3 My (IVB). These time intervals are significantly longer than those predicated from models of planetesimal accretion. It is shown that cosmogenic effects can account for a large part of the W isotopic variation. No simple relationship exists with exposure ages, compromising any reliable method of correction. After allowance for maximum possible cosmogenic effects, it is found that there is no evidence that any of the magmatic iron meteorites studied here have initial W isotopic compositions that differ from those of Allende CAIs [ ɛ182W = - 3.47 ± 0.20; [T. Kleine, K. Mezger, H. Palme, E. Scherer and C. Münker, Early core formation in asteroids and late accretion of chondrite parent bodies: evidence from 182Hf- 182W in CAIs, metal-rich chondrites and iron meteorites, Geochim. Cosmochim. Acta (in press)]. Cosmogenic corrections cannot yet be made with sufficient accuracy to obtain highly precise ages for iron meteorites. Some of the corrected ages nevertheless require extremely early metal-silicate segregation no later than 1 My after formation of CAIs. Therefore, magmatic iron meteorites appear to provide the best examples yet identified of material derived from the first planetesimals that grew by runaway growth, as modelled in dynamic simulations. Non-magmatic iron meteorites have a more radiogenic W isotopic composition than magmatic

Interactive Computer Lessons for Introductory Economics: Guided Inquiry-From Supply and Demand to Women in the Economy.

Science.gov (United States)

Miller, John; Weil, Gordon

1986-01-01

The interactive feature of computers is used to incorporate a guided inquiry method of learning introductory economics, extending the Computer Assisted Instruction (CAI) method beyond drills. (Author/JDH)

Asjade tegemisest / Mari Laaniste

Index Scriptorium Estoniae

Laaniste, Mari, 1977-

1999-01-01

Issey Miyake (s. 1938) näitus "Making Things" Cartier' moodsa kunsti keskuses Raspail' bulvaril Pariisis. Külaliskunstnikud Yasumasa Morimura, Nobuyoshi Araki (fotograaf), Tim Hawkinson, Cai Guo-Qiang.

Choices Outlined 2013-2017. An analysis of ten election programmes for accessibility effects. PBL-CPB background document; Keuzes in kaart 2013-2017. Een analyse van tien verkiezingsprogramma's op bereikbaarheidseffecten. PBL-CPB Achtergronddocument

Energy Technology Data Exchange (ETDEWEB)

Zwaneveld, P.; Verrips, A. [CPB Netherlands Bureau for Economic Policy Analysis, The Hague (Netherlands); Hilbers, H.; Zondag, B.; Van Meerkerk, J. [Planbureau voor de Leefomgeving PBL, Den Haag (Netherlands); Weijschede-van der Straaten, W. [CBS Statistics Netherlands, The Hague (Netherlands)

2012-11-15

In their report 'Keuzes in Kaart 2013-2017' (Choices outlined 2013-2017) the Netherlands Bureau for Economic Policy Analysis (CPB) and the Environmental Assessment Agency (PBL) made calculations for thirteen themes of the election programs of ten Dutch political parties. Accessibility is one of these thirteen themes. Analyses on this theme were conducted jointly by PBL and CPB. This paper addresses which different political choices the Dutch parties have made for the theme of accessibility, how PBL and CPB conducted analyses and which results were yielded. The effect of the party program is compared to a basic path, the expected image for 2020 based on implementation of the Budget Agreement 2013 ('Spring Agreement'). [Dutch] Het Centraal Planbureau (CPB) en het Planbureau voor de Leefomgeving (PBL) hebben in het rapport 'Keuzes in Kaart 2013-2017' de verkiezingsprogramma's van tien politieke partijen doorgerekend op dertien thema's. Bereikbaarheid is één van de dertien thema's. De analyses rond dit thema zijn gezamenlijk uitgevoerd door PBL en CPB. Dit paper gaat in op welke verschillende politieke keuzes de partijen ten aanzien van bereikbaarheid hebben gemaakt, op welke wijze de planbureaus dit hebben geanalyseerd en tot welke resultaten dit heeft geleid. Het effect van het partijprogramma wordt vergeleken met het 'basispad', het verwachte beeld voor 2020 uitgaande van uitvoering van het Begrotingsakkoord 2013 (het 'Lenteakkoord')

OXYGEN ISOTOPIC COMPOSITIONS OF SOLAR CORUNDUM GRAINS

International Nuclear Information System (INIS)

Makide, Kentaro; Nagashima, Kazuhide; Huss, Gary R.; Krot, Alexander N.

2009-01-01

Oxygen is one of the major rock-forming elements in the solar system and the third most abundant element of the Sun. Oxygen isotopic composition of the Sun, however, is not known due to a poor resolution of astronomical spectroscopic measurements. Several Δ 17 O values have been proposed for the composition of the Sun based on (1) the oxygen isotopic measurements of the solar wind implanted into metallic particles in lunar soil ( 2 O 3 ) is thermodynamically the first condensate from a cooling gas of solar composition. Corundum-bearing CAIs, however, are exceptionally rare, suggesting either continuous reaction of the corundum condensates with a cooling nebular gas and their replacement by hibonite (CaAl 12 O 19 ) or their destruction by melting together with less refractory condensates during formation of igneous CAIs. In contrast to the corundum-bearing CAIs, isolated micrometer-sized corundum grains are common in the acid-resistant residues from unmetamorphosed chondrites. These grains could have avoided multistage reprocessing during CAI formation and, therefore, can potentially provide constraints on the initial oxygen isotopic composition of the solar nebula, and, hence, of the Sun. Here we report oxygen isotopic compositions of ∼60 micrometer-sized corundum grains in the acid-resistant residues from unequilibrated ordinary chondrites (Semarkona (LL3.0), Bishunpur (LL3.1), Roosevelt County 075 (H3.2)) and unmetamorphosed carbonaceous chondrites (Orgueil (CI1), Murray (CM2), and Alan Hills A77307 (CO3.0)) measured with a Cameca ims-1280 ion microprobe. All corundum grains, except two, are 16 O-rich (Δ 17 O = -22.7 per mille ± 8.5 per mille, 2σ), and compositionally similar to the mineralogically pristine CAIs from the CR carbonaceous chondrites (-23.3 per mille ± 1.9 per mille, 2σ), and solar wind returned by the Genesis spacecraft (-27 per mille ± 6 per mille, 2σ). One corundum grain is highly 17 O-enriched (δ 17 O ∼ +60 per mille, δ 18 O �

Understanding and treating lateral ankle sprains and their consequences: a constraints-based approach.

Science.gov (United States)

Wikstrom, Erik A; Hubbard-Turner, Tricia; McKeon, Patrick O

2013-06-01

Lateral ankle sprains are a common consequence of physical activity. If not managed appropriately, a cascade of negative alterations to both the joint structure and a person's movement patterns continue to stress the injured ligaments. These alterations result in an individual entering a continuum of disability as evidenced by the ~30 % of ankle sprains that develop into chronic ankle instability (CAI) and up to 78 % of CAI cases that develop into post-traumatic ankle osteoarthritis (OA). Despite this knowledge, no significant improvements in treatment efficacy have been made using traditional treatment paradigms. Therefore, the purpose of this review is to (1) provide an overview of the consequences associated with acute lateral ankle sprains, CAI and post-traumatic ankle OA; (2) introduce the patient-, clinician-, laboratory (PCL)-oriented) model that addresses the lateral ankle sprains and their consequences from a constraints perspective; and (3) introduce the dynamic systems theory as the framework to illustrate how multiple post-injury adaptations create a singular pathology that predisposes individuals with lateral ankle sprains to fall into a continuum of disability. The consequences associated with lateral ankle sprains, CAI and ankle OA are similar and encompass alterations to the structure of the ankle joint (e.g. ligament laxity, positional faults, etc.) and the sensorimotor function responsible for proper ankle joint function (e.g. postural control, gait, etc.). Further, the impairments have been quantified across a range of patient-oriented (e.g. self-report questionnaires), clinician-oriented (e.g. bedside measures of range of motion and postural control), and laboratory-oriented (e.g. arthrometry, gait analysis) outcome measures. The interaction of PCL-oriented outcomes is critically important for understanding the phenomenon of CAI across the continuum of disability. Through the integration of all three sources of evidence, we can clearly see that

Dominio informativo, ¿quién tiene el poder?

Directory of Open Access Journals (Sweden)

César Mauricio Velásquez

2004-01-01

Full Text Available A través de la historia, las relaciones entre los gobiernos y la prensa han sido definitivas en el éxito o fracaso de quienes ostentan el poder. No es extraño que algunos jefes de Estado se sientan incómodos con la manera de informar de algunos medios o, por el contrario, decidan aliarse para estructurar determinadas agendas que se manejan de manera unánime para orientar el temario que decida el ejecutivo. El Observatorio de Medios de la Facultad de Comunicación Social y Periodismo realizó un estudio para conocer el estado de la relación entre el presidente Álvaro Uribe Vélez y la prensa. La investigación reveló presiones directas e indirectas que el gobierno ejerce sobre los periodistas.

Strategische marketing : De tien geboden van het gezonden verstand

NARCIS (Netherlands)

Moenaert, R.K.; Robben, M.

2007-01-01

Door de jaren heen is de klassieke strategische doctrine nogal eens ter discussie gesteld. En het boek ‘Blue Ocean Strategy’ versterkt die trend alleen maar. In het boek staat waarde-innovatie centraal en het biedt, in tegenstelling tot eerdere werken zoals het pamflettistisch-kritische betoog van

De refranes y cantares tiene el pueblo mil millares

Directory of Open Access Journals (Sweden)

Laura Alfonso Soler

2012-08-01

Full Text Available Esta experiencia trata de acercarnos a la palabra para mejorar las competencias comunicativas orales y escritas de los nuevos hablantes de nuestro idioma. El uso de los refranes se incluye en el ámbito del nivel popular; en él abunda la subjetividad, se economizan considerablemente los medios lingüísticos y aparecen numerosas apelaciones al oyente. Relativo a esto podemos señalar que los proverbios y refranes son expresiones de contenido moral y didáctico que se transmiten de manera oral.

In memory of Professor Tianqin Cao(Tien-chin Tsao)

Institute of Scientific and Technical Information of China (English)

Youshang Zhang

2010-01-01

@@ In December this year,the 4th Tianqin Cao Memorial Symposium on Protein Research will be held in Xiamen(Amoy).On this occasion,it is my pleasure to write a recollection in memory of Professor Tianqin Cao.It was rather late when Ⅰ was able to study in Prof.Cao's laboratory as a graduate student in the Institute of Biochemistry.After graduating from the Department of Chemical Engineering of Zhejiang University in 1948,Ⅰ could not find a job in a chemical engineering factory; therefore,Ⅰ changed my profession to biochemistry and worked as an assistant in the Department of Biochemistry of Hunan Yale Medical College.

La construction relative dans Chrétien de Troyes

NARCIS (Netherlands)

Fabriek, Pieter

1924-01-01

1. On peut reléguer à la syntaxe figée la construction relative avec la pronom neutre que dans feire que sages, que je sache, (au) plus tost qu'il pot, je n'ai que feire; avec le pronom adjectif qui dans il n'i a celui (nul, un seul) qui, com cil qui; en outre qui vive dans riens (om) qui vive

Menswaardigheid na tien jaar van regstaatlikheid in Suid-Afrika

Directory of Open Access Journals (Sweden)

LWH Ackermann

2004-06-01

Full Text Available HUMAN DIGNITY AFTER TEN YEARS OF TEH CONSTITUTIONAL STATE IN SOUTH AFRICASpeech delivered on 16 March 2004 on the Potchefstroom campus of the North-West UniversityHuman dignity has been the marrow of our Constitution and our constitutional state since 1994. The inherent dignity of man is also a key principle of the Universal Declaration of Human Rights of 1948. The Kantian categorical imperatives continue to provide guidance regarding the meaning of human dignity. At the very least, people are entitled to be regarded as moral subjects and not as objects: as subjects with absolute and inherent worth and therefore also as moral subjects of equal worth.The juridical core of the pathology of apartheid was the extensive and sustained attempt to deprive the majority of South Africans of the right to self-identification and self-determination. It amounted to an inversion of the Kantian imperatives. A reversal of this inversion has been attempted over the past ten years. The Constitution not only elevates human dignity to a specially entrenched value, but also affords it special protection in the context of fundamental rights. It is furthermore a specific consideration in the limitation of rights and in the development of the common law. It applies not only to the state/subject relationship, but also to "horizontal" relationships and it must be taken into account in the interpretation of the Constitution.Constitutional jurisprudence has established that the Constitution is more than a formal document, but that it also represents an objective, normative value system. Thus the foundational norm of human dignity radiates into all areas of the law. The role of human dignity in the interpretation and application of norms applicable to remedial or restitutionary equality, as well as in the achievement of constitutional equilibrium in the "horizontal" operation of the Bill of Rights, has also been established.The realization of human dignity is but in its initial stages: civil society, including educational institutions, are called upon to make their contribution to the process.

De refranes y cantares tiene el pueblo mil millares

Directory of Open Access Journals (Sweden)

Laura Alfonso Soler

2010-01-01

Full Text Available Esta experiencia trata de acercarnos a la palabra para mejorar las competencias comunicativas orales y escritas de los nuevos hablantes de nuestro idioma. El uso de los refranes se incluye en el ámbito del nivel popular; en él abunda la subjetividad, se economizan considerablemente los medios lingüísticos y aparecen numerosas apelaciones al oyente. Relativo a esto podemos señalar que los proverbios y refranes son expresiones de contenido moral y didáctico que se transmiten de manera oral.

Climatology (communication arising): Rural land-use change and climate

Science.gov (United States)

Trenberth, Kevin E.

2004-01-01

Kalnay and Cai claim that urbanization and land-use change have a major effect on the climate in the United States. They used surface temperatures obtained from NCEP/NCAR 50-year reanalyses (NNR) and their difference compared with observed station surface temperatures as the basis for their conclusions, on the grounds that the NNR did not include these anthropogenic effects. However, we note that the NNR also overlooked other factors, such as known changes in clouds and in surface moisture, which are more likely to explain Kalnay and Cai's findings. Although urban heat-island effects are real in cities, direct estimates of the effects of rural land-use change indicate a cooling rather than a warming influence that is due to a greater reflection of sunlight.

Climatology (communication arising): rural land-use change and climate.

Science.gov (United States)

Trenberth, Kevin E

2004-01-15

Kalnay and Cai claim that urbanization and land-use change have a major effect on the climate in the United States. They used surface temperatures obtained from NCEP/NCAR 50-year reanalyses (NNR) and their difference compared with observed station surface temperatures as the basis for their conclusions, on the grounds that the NNR did not include these anthropogenic effects. However, we note that the NNR also overlooked other factors, such as known changes in clouds and in surface moisture, which are more likely to explain Kalnay and Cai's findings. Although urban heat-island effects are real in cities, direct estimates of the effects of rural land-use change indicate a cooling rather than a warming influence that is due to a greater reflection of sunlight.

The Use of Computer-Assisted Instruction as an Instructional Tool to Teach Social Stories to Individuals Who Have Been Diagnosed on the Autism Spectrum

Directory of Open Access Journals (Sweden)

Nanette Edeiken-Cooperman

2014-10-01

Full Text Available This article discusses the use of computer-assisted instruction (CAI to teach Social Stories as a method of positively affecting the social understanding and behaviors of learners who have been diagnosed on the autism spectrum. As the diagnosis rate for those with ASD continues to rise along with the practice of including these learners in the general education environment, there is an increasing need to identify evidence-based practices that focus on the acquisition and remediation of social-communication skills, social skills, and social competence. A variety of strategies have been developed and implemented to remediate deficits in these areas. The use of CAI is an approach that has been proven to accommodate both the needs and the visual learning styles of these learners.

Charted Choices 2013-2017. An analysis of ten election programmes. Effects on the economy and the environment; Keuzes in Kaart 2013-2017. Een analyse van tien verkiezingsprogramma's. Effecten op economie en milieu

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-05-15

At the request of ten political parties, the Netherlands Bureau for Economic Policy Analysis (CPB) and PBL Netherlands Environmental Assessment Agency have mapped out the effects of the respective election platforms on the economy and the environment. The analysis shows that each of the proposed policy measures included in the platforms has both advantages and disadvantages. The platforms thus reflect the diverse choices that have been made by the parties. The publication presents the impact of party programs on public finances, purchasing power and employment. Also included in the publication are analyses in the field of mobility, energy and climate, nature, education, housing and healthcare [Dutch] De verkiezingsprogramma's 2012 laten zien welke keuzes politieke partijen maken voor de jaren 2013-2017. De programma's tonen aan dat er echt iets te kiezen valt voor de komende kabinetsperiode. Hoe gaan we na de economische crisis de overheidsfinancien weer op orde brengen en hoe snel? Verhogen we de AOW-leeftijd en beperken we de aftrek van de hypotheekrente, of juist niet? Hoe verminderen we de filedruk? Willen we klimaatverandering aanpakken en zo ja, hoe dan? Is het de moeite waarde om meer geld uit te geven aan onderwijs of innovatie? Hoeveel trekken we uit voor natuur? Hoe kunnen we de woningmarkt beter laten functioneren? Hoe gaan we om met de stijging van de kosten van de zorg? In de aanloop naar de verkiezingen van 12 september 2012 hebben tien politieke partijen - VVD, PvdA, PVV, CDA, SP, D66, GroenLinks, ChristenUnie, SGP, DPK - gevraagd om een analyse van hun verkiezingsprogramma's. Het CPB heeft de economische effecten geanalyseerd, het PBL de effecten op milieu.

A visão da família sobre a experiência de ter uma criança gastrostomizada La visión de la familia sobre la experiencia de tener un niño que tiene gastrostomía The views of the family about the experience of having a child with gastrostomy

Directory of Open Access Journals (Sweden)

Andréia Cascaes Cruz

2012-12-01

Full Text Available A gastrostomia é cada vez mais usada para tratar de problemas nutricionais e de crescimento em crianças com doenças crónicas ou deficientes. Embora seja um procedimento simples para a equipa de saúde, a criação de estomas na criança pode gerar consequências emocionais e sociais na vida familiar. Este estudo teve como objetivo identificar as evidências científicas acerca da experiência da família que possui uma criança gastrostomizada. Elaborou-se uma revisão integrativa da literatura no período de 2005 a 2011 e busca de artigos em diferentes bases de dados, sendo selecionados 10 artigos sobre o tema. A análise dos textos permitiu organizar os resultados em quatro temas: o significado da alimentação para os pais; o desempenho do papel parental; a experiência da família na interação com a equipa de saúde; a vida após a gastrostomia. Os resultados demonstram que a família que tem uma criança gastrostomizada experiencia uma grande sobrecarga emocional, sobretudo no período anterior ao procedimento, em virtude do significado sociocultural que a alimentação tem para ela. A família necessita de receber informações e apoio da equipa de saúde que acompanha a criança.La gastrostomía se utiliza cada vez más para tratar problemas nutricionales y de crecimiento en niños con enfermedades crónicas o incapacidades. A pesar de que el equipo sanitario considera que es un procedimiento simple, la realización de un estoma en el niño puede tener consecuencias emocionales y sociales en la vida familiar. El objetivo de este estudio fue identificar las evidencias científicas relacionadas con la experiencia de la familia que tiene un niño con gastrostomía. Se realizó una revisión integrativa de la literatura en el periodo comprendido entre 2005 y 2011 y se buscaron artículos en diferentes bases de datos, de los cuales se seleccionaron 10 sobre el tema. El análisis de los textos permitió organizar los resultados en cuatro

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available [Azoarcus sp. EbN1] emb|CAI06629.1| nudix hydrolase ... [Azoarcus sp. EbN1] ... Length = 151 ... Query: 5 ... EGYRPNVGIILVNT...RNEVFWGKRIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH 64 ... EGYRPNVGIILVNTRNEVFWGK...RIREHSWQFPQGGIKHGESPEQAMFRELFEEVGLRPEH Sbjct: 1 ... EGYRPNVGIILVNTRNEVFWGKRIREHSWQF

sources and use of extension information among maize farmers in ...

African Journals Online (AJOL)

DR ADESOPE

This paper highlights the potentials of agro-tourism for rural development in Nigeria and ... promotion of entrepreneurship and industrialization, economic advancement, ..... Cai, J. (2003), 'Peri-urban Agriculture Development in China, Urban.

Characterization and identification of in vitro metabolites of ...

African Journals Online (AJOL)

Characterization and identification of in vitro metabolites of (-)-epicatechin using ultra-high performance liquid chromatography-mass spectrometry. Rui Jun Cai, Xiao Ling Yin, Jing Liu, Da Xu Qin, Gui Zhen Zhao ...

Whole-Body-Vibration Training and Balance in Recreational Athletes With Chronic Ankle Instability.

Science.gov (United States)

Sierra-Guzmán, Rafael; Jiménez-Diaz, Fernando; Ramírez, Carlos; Esteban, Paula; Abián-Vicén, Javier

2018-04-01

  Deficits in the propioceptive system of the ankle contribute to chronic ankle instability (CAI). Recently, whole-body-vibration (WBV) training has been introduced as a preventive and rehabilitative tool.   To evaluate how a 6-week WBV training program on an unstable surface affected balance and body composition in recreational athletes with CAI.   Randomized controlled clinical trial.   Research laboratory.   Fifty recreational athletes with self-reported CAI were randomly assigned to a vibration (VIB), nonvibration (NVIB), or control group.   The VIB and NVIB groups performed unilateral balance training on a BOSU 3 times weekly for 6 weeks. The VIB group trained on a vibration platform, and the NVIB group trained on the floor.   We assessed balance using the Biodex Balance System and the Star Excursion Balance Test (SEBT). Body composition was measured by dual-energy x-ray absorptiometry.   After 6 weeks of training, improvements on the Biodex Balance System occurred only on the Overall Stability Index ( P = .01) and Anterior-Posterior Stability Index ( P = .03) in the VIB group. We observed better performance in the medial ( P = .008) and posterolateral ( P = .04) directions and composite score of the SEBT in the VIB group ( P = .01) and in the medial ( P Balance System, whereas the VIB and NVIB groups displayed better performance on the SEBT.

Transport activity of the sodium bicarbonate cotransporter NBCe1 is enhanced by different isoforms of carbonic anhydrase.

Directory of Open Access Journals (Sweden)

Christina Schueler

Full Text Available Transport metabolons have been discussed between carbonic anhydrase II (CAII and several membrane transporters. We have now studied different CA isoforms, expressed in Xenopus oocytes alone and together with the electrogenic sodium bicarbonate cotransporter 1 (NBCe1, to determine their catalytic activity and their ability to enhance NBCe1 transport activity. pH measurements in intact oocytes indicated similar activity of CAI, CAII and CAIII, while in vitro CAIII had no measurable activity and CAI only 30% of the activity of CAII. All three CA isoforms increased transport activity of NBCe1, as measured by the transport current and the rate of intracellular sodium rise in oocytes. Two CAII mutants, altered in their intramolecular proton pathway, CAII-H64A and CAII-Y7F, showed significant catalytic activity and also enhanced NBCe1 transport activity. The effect of CAI, CAII, and CAII mutants on NBCe1 activity could be reversed by blocking CA activity with ethoxyzolamide (EZA, 10 µM, while the effect of the less EZA-sensitive CAIII was not reversed. Our results indicate that different CA isoforms and mutants, even if they show little enzymatic activity in vitro, may display significant catalytic activity in intact cells, and that the ability of CA to enhance NBCe1 transport appears to depend primarily on its catalytic activity.

The application of MRI in the infantile congenital dislocation of the hip

International Nuclear Information System (INIS)

Liu Hongsheng; Guo Qiyong; Ye Binbin

2004-01-01

Objective: To evaluate the efficacy of MRI in infantile congenital dislocation of the hip (CDH), and to provide a reasonable basis for clinical examination. Methods: Forty-seven infants (< 3 years) with untreated CDH were examined by using MR imaging. Three types were classified according to the standard of Ogden and Dunn, and then the bony and cartilaginous hip parameters of all hips, including the bony acetabular index (BAI), cartilaginous acetabular index (CAI), bony acetabular quotient (BAQ), and cartilaginous acetabular quotient (CAQ), were measured except in the type III hips. Results: For the normal hips, dislocated hips, the type I hips, and the type II hips, BAI was (25.24 ± 3.70) degree, (38.12 ± 4.07) degree, (35.59 ± 2.86) degree, and (39.64 ± 3.97) degree, respectively, CAI was (8.49 ± 2.15) degree, (17.25 ± 2.41) degree, (15.85 ± 2.00) degree, and (18.08 ± 2.26) degree, respectively, BAQ was 0.199 ± 0.026, 0.126 ± 0.028, 0.131 ± 0.028, and 0.124 ± 0.028, respectively, CAQ was 0.195 ± 0.027, 0.120 ± 0.027, 0.120 ± 0.023, and 0.121 ± 0.030, respectively. The BAI and CAI of the type II hips were higher than those of the type I, and BAQ and CAQ were lower. There was a linear correlation between BAI and CAI (r=0.876) and between BAQ and CAQ (r=0.706), respectively. MRI demonstrated that bony changes as loss of sphericity and diminished aperture of the acetabulum, and cartilage changes as the distortion and overgrowth in CDH. Conclusion: MR imaging is not only a very useful imaging modality for assessment of the bony, cartilaginous, and soft-tissue structures of the infantile hip, but also an excellent tool in the diagnosis and treatment of CDH. (author)

Variations in the cerebrospinal fluid proteome following traumatic brain injury and subarachnoid hemorrhage.

Science.gov (United States)

Connor, David E; Chaitanya, Ganta V; Chittiboina, Prashant; McCarthy, Paul; Scott, L Keith; Schrott, Lisa; Minagar, Alireza; Nanda, Anil; Alexander, J Steven

2017-09-01

Proteomic analysis of cerebrospinal fluid (CSF) has shown great promise in identifying potential markers of injury in neurodegenerative diseases [1-13]. Here we compared CSF proteomes in healthy individuals, with patients diagnosed with traumatic brain injury (TBI) and subarachnoid hemorrhage (SAH) in order to characterize molecular biomarkers which might identify these different clinical states and describe different molecular mechanisms active in each disease state. Patients presenting to the Neurosurgery service at the Louisiana State University Hospital-Shreveport with an admitting diagnosis of TBI or SAH were prospectively enrolled. Patients undergoing CSF sampling for diagnostic procedures were also enrolled as controls. CSF aliquots were subjected to 2-dimensional gel electrophoresis (2D GE) and spot percentage densities analyzed. Increased or decreased spot expression (compared to controls) was defined in terms of in spot percentages, with spots showing consistent expression change across TBI or SAH specimens being followed up by Matrix-Assisted Laser Desorption/Ionization mass spectrometry (MALDI-MS). Polypeptide masses generated were matched to known standards using a search of the NCBI and/or GenPept databases for protein matches. Eight hundred fifteen separately identifiable polypeptide migration spots were identified on 2D GE gels. MALDI-MS successfully identified 13 of 22 selected 2D GE spots as recognizable polypeptides. Statistically significant changes were noted in the expression of fibrinogen, carbonic anhydrase-I (CA-I), peroxiredoxin-2 (Prx-2), both α and β chains of hemoglobin, serotransferrin (Tf) and N-terminal haptoglobin (Hp) in TBI and SAH specimens, as compared to controls. The greatest mean fold change among all specimens was seen in CA-I and Hp at 30.7 and -25.7, respectively. TBI specimens trended toward greater mean increases in CA-I and Prx-2 and greater mean decreases in Hp and Tf. Consistent CSF elevation of CA-I and Prx-2 with

Neuromuscular training to enhance sensorimotor and functional deficits in subjects with chronic ankle instability: a systematic review and best evidence synthesis

LENUS (Irish Health Repository)

O'Driscoll, Jeremiah

2011-09-22

Abstract Objective To summarise the available evidence for the efficacy of neuromuscular training in enhancing sensorimotor and functional deficits in subjects with chronic ankle instability (CAI). Design Systematic review with best evidence synthesis. Data Sources An electronic search was conducted through December 2009, limited to studies published in the English language, using the Pubmed, CINAHL, Embase, and SPORTDiscus databases. Reference screening of all included articles was also undertaken. Methods Studies were selected if the design was a RCT, quasi RCT, or a CCT; the patients were adolescents or adults with confirmed CAI; and one of the treatment options consisted of a neuromuscular training programme. The primary investigator independently assessed the risk of study bias and extracted relevant data. Due to clinical heterogeneity, data was analysed using a best-evidence synthesis. Results Fourteen studies were included in the review. Meta-analysis with statistical pooling of data was not possible, as the studies were considered too heterogeneous. Instead a best evidence synthesis was undertaken. There is limited to moderate evidence to support improvements in dynamic postural stability, and patient perceived functional stability through neuromuscular training in subjects with CAI. There is limited evidence of effectiveness for neuromuscular training for improving static postural stability, active and passive joint position sense (JPS), isometric strength, muscle onset latencies, shank\\/rearfoot coupling, and a reduction in injury recurrence rates. There is limited evidence of no effectiveness for improvements in muscle fatigue following neuromuscular intervention. Conclusion There is limited to moderate evidence of effectiveness in favour of neuromuscular training for various measures of static and dynamic postural stability, active and passive JPS, isometric strength, muscle onset latencies, shank\\/rearfoot coupling and injury recurrence rates. Strong

A designated centre for people with disabilities operated by Health Service Executive, Cork

LENUS (Irish Health Repository)

O'Driscoll, Jeremiah

2011-09-22

Abstract Objective To summarise the available evidence for the efficacy of neuromuscular training in enhancing sensorimotor and functional deficits in subjects with chronic ankle instability (CAI). Design Systematic review with best evidence synthesis. Data Sources An electronic search was conducted through December 2009, limited to studies published in the English language, using the Pubmed, CINAHL, Embase, and SPORTDiscus databases. Reference screening of all included articles was also undertaken. Methods Studies were selected if the design was a RCT, quasi RCT, or a CCT; the patients were adolescents or adults with confirmed CAI; and one of the treatment options consisted of a neuromuscular training programme. The primary investigator independently assessed the risk of study bias and extracted relevant data. Due to clinical heterogeneity, data was analysed using a best-evidence synthesis. Results Fourteen studies were included in the review. Meta-analysis with statistical pooling of data was not possible, as the studies were considered too heterogeneous. Instead a best evidence synthesis was undertaken. There is limited to moderate evidence to support improvements in dynamic postural stability, and patient perceived functional stability through neuromuscular training in subjects with CAI. There is limited evidence of effectiveness for neuromuscular training for improving static postural stability, active and passive joint position sense (JPS), isometric strength, muscle onset latencies, shank\\/rearfoot coupling, and a reduction in injury recurrence rates. There is limited evidence of no effectiveness for improvements in muscle fatigue following neuromuscular intervention. Conclusion There is limited to moderate evidence of effectiveness in favour of neuromuscular training for various measures of static and dynamic postural stability, active and passive JPS, isometric strength, muscle onset latencies, shank\\/rearfoot coupling and injury recurrence rates. Strong

Arthroscopic repair of lateral ankle ligament complex by suture anchor.

Science.gov (United States)

Wang, Jingwei; Hua, Yinghui; Chen, Shiyi; Li, Hongyun; Zhang, Jian; Li, Yunxia

2014-06-01

Arthroscopic repair of the lateral ligament complex with suture anchors is increasingly used to treat chronic ankle instability (CAI). Our aims are (1) to analyze and evaluate the literature on arthroscopic suture anchor repair of the anterior talofibular ligament and (2) to conduct a systematic review of the clinical evidence on the reported outcomes and complications of treating CAI with this technique. We performed a systematic review of the literature using PubMed, Ovid, Elsevier ScienceDirect, Web of Science-Conference Proceedings Citation Index, and the Cochrane Database of Systematic Reviews from 1987 to September 2013. Clinical studies using the arthroscopic suture anchor technique to treat CAI were included. Outcome measures consisted of clinical assessment of postoperative ligament stability and complications. In addition, the methodologic quality of the included studies was assessed by use of the modified Coleman Methodology Score. After reviewing 371 studies, we identified 6 studies (5 retrospective case series and 1 prospective case series, all Level IV) that met the inclusion criteria, with a mean Coleman Methodology Score of 71.8 ± 7.52 (range, 63 to 82). In these studies 178 patients (179 ankles) underwent arthroscopic suture anchor repair of the anterior talofibular ligament with a mean follow-up period of 38.9 months (range, 6 to 117.6 months). All patients were reported to have subjective improvement of their ankle instability, with complications in 31 cases. Studies of arthroscopic suture anchor technique to treat CAI are sparse, with moderate mean methodologic quality. The included studies suggest that the arthroscopic technique is a feasible procedure to restore ankle stability; however, on the basis of our review, this technique seems to be associated with a relatively high complication rate. Extensive cadaveric studies, clinical trials, and comparative studies comparing arthroscopic and open repair should be performed in the future. Level

AR mutations in 28 patients with androgen insensitivity syndrome (Prader grade 0-3).

Science.gov (United States)

Wang, Yi; Gong, Chunxiu; Wang, Xiou; Qin, Miao

2017-07-01

We investigated the androgen receptor (AR) gene mutation profiles of Chinese patients exhibiting severe androgen insensitivity syndrome (AIS) phenotypes. The present study enrolled 28 patients with genetically diagnosed AIS, who presented with severe phenotypes (Prader grade 0-3). Patients and some family members were screened via amplification and sequencing of their AR exons 1-8, including the corresponding intronic flanking regions. Luteinizing (LH), follicle-stimulating (FSH), and testosterone (T) hormone levels were found to be slightly, but not significantly, higher in patients with complete androgen insensitivity syndrome (CAIS) than in patients with partial androgen insensitivity syndrome (PAIS) (P>0.05). We identified 24 different AR mutations, including 12 that were novel. Ten patients (cases 2, 3, 10, 28, 11, 12, 19, 20, 24, and 25) were found to carry five recurrent mutations (p.Y572S, p.P914S, p.S176R, p.Y782N, and p.R841H); of these, p.Y572S, p.S176R, and p.Y782N were novel. Among the mutations identified in patients with CAIS, six (66.7%) were characterized as single-nucleotide missense mutations, and six (66.7%) were found to be located in the AR ligand-binding domain (LBD). Among the mutations identified in patients with PAIS, 15 (93.8%) were found to be missense, and 11 (68.8%) were found to be located in the LBD. Patients 10 and 28 were determined to harbor the same missense mutation (p.P914S), but were diagnosed with CAIS and PAIS, respectively. Sex hormone levels were slightly, but not significantly, elevated in patients with CAIS compared to those with PAIS. Missense mutations spanning AR exons 1-8 were the predominant form of identified mutations, and these were mostly located in the AR LBD. Approximately 50% of the identified mutations were novel, and have enriched the AR gene-mutation database. Patients harboring identical mutations were in some instances found to exhibit divergent phenotypes.

Obstructive Sleep-Disordered Breathing Is More Common than Central in Mild Familial Dysautonomia

Science.gov (United States)

Hilz, Max J.; Moeller, Sebastian; Buechner, Susanne; Czarkowska, Hanna; Ayappa, Indu; Axelrod, Felicia B.; Rapoport, David M.

2016-01-01

Study Objectives: In familial dysautonomia (FD) patients, sleep-disordered breathing (SDB) might contribute to their high risk of sleep-related sudden death. Prevalence of central versus obstructive sleep apneas is controversial but may be therapeutically relevant. We, therefore, assessed sleep structure and SDB in FD-patients with no history of SDB. Methods: 11 mildly affected FD-patients (28 ± 11 years) without clinically overt SDB and 13 controls (28 ± 10 years) underwent polysomnographic recording during one night. We assessed sleep stages, obstructive and central apneas (≥ 90% air flow reduction) and hypopneas (> 30% decrease in airflow with ≥ 4% oxygen-desaturation), and determined obstructive (oAI) and central (cAI) apnea indices and the hypopnea index (HI) as count of respective apneas/hypopneas divided by sleep time. We obtained the apnea-hypopnea index (AHI4%) from the total of apneas and hypopneas divided by sleep time. We determined differences between FD-patients and controls using the U-test and within-group differences between oAIs, cAIs, and HIs using the Friedman test and Wilcoxon test. Results: Sleep structure was similar in FD-patients and controls. AHI4% and HI were significantly higher in patients than controls. In patients, HIs were higher than oAIs and oAIs were higher than cAIs. In controls, there was no difference between HIs, oAIs, and cAIs. Only patients had apneas and hypopneas during slow wave sleep. Conclusions: In our FD-patients, obstructive apneas were more common than central apneas. These findings may be related to FD-specific pathophysiology. The potential ramifications of SDB in FD-patients suggest the utility of polysomnography to unveil SDB and initiate treatment. Commentary: A commentary on this article appears in this issue on page 1583. Citation: Hilz MJ, Moeller S, Buechner S, Czarkowska H, Ayappa I, Axelrod FB, Rapoport DM. Obstructive sleep-disordered breathing is more common than central in mild familial

De Actividades de Innovación y su Presencia en Pymes Santafesinas

Directory of Open Access Journals (Sweden)

Marcela S. Ambrosini

2009-12-01

Full Text Available La asimilación y la incorporación de nuevas tecnologías son cuestiones ineludibles al pensar en la permanencia y/o crecimiento de las empresas en el mercado. El reconocimiento de la innovación como ventaja competitiva sustentable es creciente y las Pymes requieren de estrategias que contemplen competencias y habilidades para mejorar su competitividad. Si bien el objeto de la transferencia de tecnología es el conocimiento, la viabilidad de un proceso con dinámica sistémica involucra una multiplicidad de instituciones, organismos y agentes; requiere de adaptaciones de productos, procesos y técnicas de gestión, y demanda la difusión de diseños alternativos para la inserción en diferentes mercados. Todas éstas cuestiones relevantes a contemplar por las Pymes cuando enfrentan el desafío de concretar la novedad en el mercado. En este marco, el texto que se presenta tiene por objetivo retomar parte de los resultados alcanzados y divulgados en el proyecto CAI+D 2005 “Estrategias de competitividad de Pymes de la región”. En tal sentido, la estructura de abordaje de este trabajo responde a tres aspectos: inicialmente se tratan los conceptos de innovación y competitividad en general y en las Pymes en particular. En una segunda parte se presentan los resultados obtenidos en entrevistas realizadas a 75 Pymes de Santa Fe. Finalmente se presentan las conclusiones que se obtuvieron en el escenario de innovación en el que se desenvuelven las Pymes de nuestra región.

hydrochemical assessment of groundwater quality in sagamu area ...

African Journals Online (AJOL)

ABDULRASHEED

alkaline indices (CAI), were calculated for irrigation purposes. The results were presented as spatial distribution maps for interpretation and further inferences. Comparison of the groundwater quality in the area with local and international ...

Fermions tunneling from apparent horizon of FRW universe

International Nuclear Information System (INIS)

Li Ran; Ren Jirong; Shi Dunfu

2009-01-01

In the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)], the scalar particles' Hawking radiation from the apparent horizon of Friedmann-Robertson-Walker (FRW) universe was investigated by using the tunneling formalism. They obtained the Hawking temperature associated with the apparent horizon, which was extensively applied in investigating the relationship between the first law of thermodynamics and Friedmann equations. In this Letter, we calculate fermions' Hawking radiation from the apparent horizon of FRW universe via tunneling formalism. Applying WKB approximation to the general covariant Dirac equation in FRW spacetime background, the radiation spectrum and Hawking temperature of apparent horizon are correctly recovered, which supports the arguments presented in the paper [R.-G. Cai, L.-M. Cao, Y.-P. Hu, (arXiv: 0809.1554)

Corrective Action Decision Document/Closure Report for Corrective Action Unit 511: Waste Dumps (Piles and Debris) Nevada Test Site, Nevada, Rev. No.: 0

Energy Technology Data Exchange (ETDEWEB)

Pastor, Laura

2005-12-01

This Corrective Action Decision Document/Closure Report has been prepared for Corrective Action Unit (CAU) 511, Waste Dumps (Piles & Debris). The CAU is comprised of nine corrective action sites (CASs) located in Areas 3, 4, 6, 7, 18, and 19 of the Nevada Test Site, Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 511 is comprised of nine CASs: (1) 03-08-02, Waste Dump (Piles & Debris); (2) 03-99-11, Waste Dump (Piles); (3) 03-99-12, Waste Dump (Piles & Debris); (4) 04-99-04, Contaminated Trench/Berm; (5) 06-16-01, Waste Dump (Piles & Debris); (6) 06-17-02, Scattered Ordnance/Automatic Weapons Range; (7) 07-08-01, Contaminated Mound; (8) 18-99-10, Ammunition Dump; and (9) 19-19-03, Waste Dump (Piles & Debris). The purpose of this Corrective Action Decision Document/Closure Report is to provide justification and documentation supporting the recommendation for closure of CAU 511 with no further corrective action. To achieve this, corrective action investigation (CAI) and closure activities were performed from January 2005 through August 2005, as set forth in the ''Corrective Action Investigation Plan for Corrective Action Unit 511: Waste Dumps (Piles & Debris)'' (NNSA/NSO, 2004) and Record of Technical Change No. 1. The purpose of the CAI was to fulfill the following data needs as defined during the data quality objective process: (1) Determine whether contaminants of concern (COCs) are present. (2) If COCs are present, determine their nature and extent. (3) Provide sufficient information and data to complete appropriate corrective actions. The CAU 511 dataset from the investigation results was evaluated based on the data quality indicator parameters. This evaluation demonstrated the quality and acceptability of the dataset for use in fulfilling the data quality objective data needs. Analytes detected during the CAI were evaluated against appropriate preliminary

Continuum Modeling of Biological Network Formation

KAUST Repository

Albi, Giacomo; Burger, Martin; Haskovec, Jan; Markowich, Peter A.; Schlottbom, Matthias

2017-01-01

We present an overview of recent analytical and numerical results for the elliptic–parabolic system of partial differential equations proposed by Hu and Cai, which models the formation of biological transportation networks. The model describes

ORF Alignment: NC_002516 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_005966 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1] emb|CAI07855.1| conse...rved ... hypothetical protein, probably involved in cell wall ... turnover [Azoarcus sp. EbN1

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tein, possibly TonB-like energy transducer ... [Azoarcus sp. EbN1] emb|CAI07122.1| hypothetical ... ... ... protein, possibly TonB-like energy transducer [Azoarcus ... sp. EbN1] ... Length = 87 ... Q

CAI and Its Application in Rural Junior English Class

Science.gov (United States)

He, Xiaojun

2015-01-01

Superiority in developing students' listening, speaking, etc. This thesis explores how to provide a better environment for English teaching in rural junior school with the aid of multimedia and find some ways to improve teaching efficiency. In recent years, using multimedia is the direction of reform and mainstream in English teaching. Compared…

Antimycobacterial and cytotoxic activities of extracts from fungal ...

African Journals Online (AJOL)

Science, Technology and Innovation through Science, Technology and Innovations (NACOSTI/RCD/ST&I) 5th ... Lake Fuxian, Yunnan China (Cai et al., 2002). Lake Magadi which is ..... some fungi indigenous to Tanzania. Tanz. J. Heal. Res.

Computer Assisted Instruction

Science.gov (United States)

Higgins, Paul

1976-01-01

Methodology for developing a computer assisted instruction (CAI) lesson (scripting, programing, and testing) is reviewed. A project done by Informatics Education Ltd. (IEL) for the Department of National Defense (DND) is used as an example. (JT)

Biological transportation networks: Modeling and simulation

KAUST Repository

Albi, Giacomo; Artina, Marco; Foransier, Massimo; Markowich, Peter A.

2015-01-01

We present a model for biological network formation originally introduced by Cai and Hu [Adaptation and optimization of biological transport networks, Phys. Rev. Lett. 111 (2013) 138701]. The modeling of fluid transportation (e.g., leaf venation

Clinical and genetic characterization of 6 cases with complete ...

Indian Academy of Sciences (India)

Navya

2016-12-16

Dec 16, 2016 ... secondary sex characters (partial AIS) to a complete AIS (CAIS) (Ferlin et al., 2006;. Zuccarello et al., 2008). ... The physical examination and the .... 2004 Residual activity of mutant androgen receptors explains wolffian duct.

Charted Choices 2013-2017. An analysis of ten election programmes. Effects on the economy and the environment; Keuzes in Kaart 2013-2017. Een analyse van tien verkiezingsprogramma's. Effecten op economie en milieu

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-05-15

At the request of ten political parties, the Netherlands Bureau for Economic Policy Analysis (CPB) and PBL Netherlands Environmental Assessment Agency have mapped out the effects of the respective election platforms on the economy and the environment. The analysis shows that each of the proposed policy measures included in the platforms has both advantages and disadvantages. The platforms thus reflect the diverse choices that have been made by the parties. The publication presents the impact of party programs on public finances, purchasing power and employment. Also included in the publication are analyses in the field of mobility, energy and climate, nature, education, housing and healthcare [Dutch] De verkiezingsprogramma's 2012 laten zien welke keuzes politieke partijen maken voor de jaren 2013-2017. De programma's tonen aan dat er echt iets te kiezen valt voor de komende kabinetsperiode. Hoe gaan we na de economische crisis de overheidsfinancien weer op orde brengen en hoe snel? Verhogen we de AOW-leeftijd en beperken we de aftrek van de hypotheekrente, of juist niet? Hoe verminderen we de filedruk? Willen we klimaatverandering aanpakken en zo ja, hoe dan? Is het de moeite waarde om meer geld uit te geven aan onderwijs of innovatie? Hoeveel trekken we uit voor natuur? Hoe kunnen we de woningmarkt beter laten functioneren? Hoe gaan we om met de stijging van de kosten van de zorg? In de aanloop naar de verkiezingen van 12 september 2012 hebben tien politieke partijen - VVD, PvdA, PVV, CDA, SP, D66, GroenLinks, ChristenUnie, SGP, DPK - gevraagd om een analyse van hun verkiezingsprogramma's. Het CPB heeft de economische effecten geanalyseerd, het PBL de effecten op milieu.

Protective effect of rhamnopyranosyl vanilloyl isolated from ...

African Journals Online (AJOL)

Cai Tian Di Wang in 2013 and authenticated by. Chang-Wu Wang, a ... purchased from Abcam (Cambridge, UK) and ..... Hosaka T, Suzuki F, Kobayashi M, Seko Y, Kawamura Y, ... Han JJ, Ning N. Research progress on pharmacological.

Codon-optimized antibiotic resistance gene improves efficiency of ...

Indian Academy of Sciences (India)

2013-10-01

Oct 1, 2013 ... transient transformation and cell growth in selective culture were significantly increased by use of fgmR ... Our result shows that similarity in codon usage pattern is an important factor ... Codon adaptation index (CAI) (Sharp.

Corrective Action Decision Document/Closure Report for Corrective Action Unit 550: Smoky Contamination Area Nevada National Security Site, Nevada, Revision 0

Energy Technology Data Exchange (ETDEWEB)

Matthews, Patrick K. [Navarro-Intera, LLC (N-I), Las Vegas, NV (United States)

2015-02-01

This Corrective Action Decision Document/Closure Report presents information supporting the closure of Corrective Action Unit (CAU) 550: Smoky Contamination Area, Nevada National Security Site, Nevada. CAU 550 includes 19 corrective action sites (CASs), which consist of one weapons-related atmospheric test (Smoky), three safety experiments (Ceres, Oberon, Titania), and 15 debris sites (Table ES-1). The CASs were sorted into the following study groups based on release potential and technical similarities: • Study Group 1, Atmospheric Test • Study Group 2, Safety Experiments • Study Group 3, Washes • Study Group 4, Debris The purpose of this document is to provide justification and documentation supporting the conclusion that no further corrective action is needed for CAU 550 based on implementation of the corrective actions listed in Table ES-1. Corrective action investigation (CAI) activities were performed between August 2012 and October 2013 as set forth in the Corrective Action Investigation Plan for Corrective Action Unit 550: Smoky Contamination Area; and in accordance with the Soils Activity Quality Assurance Plan. The approach for the CAI was to investigate and make data quality objective (DQO) decisions based on the types of releases present. The purpose of the CAI was to fulfill data needs as defined during the DQO process. The CAU 550 dataset of investigation results was evaluated based on a data quality assessment. This assessment demonstrated the dataset is complete and acceptable for use in fulfilling the DQO data needs.

Revisiting cognitive and learning styles in computer-assisted instruction: not so useful after all.

Science.gov (United States)

Cook, David A

2012-06-01

In a previous systematic review, the author proposed that adaptation to learners' cognitive and learning styles (CLSs) could improve the efficiency of computer-assisted instruction (CAI). In the present article, he questions that proposition, arguing that CLSs do not make a substantive difference in CAI. To support this argument, the author performed an updated systematic literature search, pooled new findings with those from the previous review, and reinterpreted this evidence with a focus on aptitude-treatment interactions. (An aptitude-treatment interaction occurs when a student with attribute 1 learns better with instructional approach A than with approach B, whereas a student with attribute 2 learns better with instructional approach B).Of 65 analyses reported in 48 studies, only 9 analyses (14%) showed significant interactions between CLS and instructional approach. It seems that aptitude-treatment interactions with CLSs are at best infrequent and small in magnitude. There are several possible explanations for this lack of effect. First, the influence of strong instructional methods likely dominates the impact of CLSs. Second, current methods for assessing CLSs lack validity evidence and are inadequate to accurately characterize the individual learner. Third, theories are vague, and empiric evidence is virtually nonexistent to guide the planning of style-targeted instructional designs. Adaptation to learners' CLSs thus seems unlikely to enhance CAI. The author recommends that educators focus on employing strong instructional methods. Educators might also consider assessing and adapting to learners' prior knowledge or allowing learners to select among alternate instructional approaches.

Attitudes of health care students about computer-aided neuroanatomy instruction.

Science.gov (United States)

McKeough, D Michael; Bagatell, Nancy

2009-01-01

This study examined students' attitudes toward computer-aided instruction (CAI), specifically neuroanatomy learning modules, to assess which components were primary in establishing these attitudes and to discuss the implications of these attitudes for successfully incorporating CAI in the preparation of health care providers. Seventy-seven masters degree, entry-level, health care professional students matriculated in an introductory neuroanatomy course volunteered as subjects for this study. Students independently reviewed the modules as supplements to lecture and completed a survey to evaluate teaching effectiveness. Responses to survey statements were compared across the learning modules to determine if students viewed the modules differently. Responses to individual survey statements were averaged to measure the strength of agreement or disagreement with the statement. Responses to open-ended questions were theme coded, and frequencies and percentages were calculated for each. Students saw no differences between the learning modules. Students perceived the learning modules as valuable; they enjoyed using the modules but did not prefer CAI over traditional lecture format. The modules were useful in learning or reinforcing neuroanatomical concepts and improving clinical problem-solving skills. Students reported that the visual representation of the neuroanatomical systems, computer animation, ability to control the use of the modules, and navigational fidelity were key factors in determining attitudes. The computer-based learning modules examined in this study were effective as adjuncts to lecture in helping entry-level health care students learn and make clinical applications of neuroanatomy information.

Late metal-silicate separation on the IAB parent asteroid: Constraints from combined W and Pt isotopes and thermal modelling

Science.gov (United States)

Hunt, Alison C.; Cook, David L.; Lichtenberg, Tim; Reger, Philip M.; Ek, Mattias; Golabek, Gregor J.; Schönbächler, Maria

2018-01-01

The short-lived 182Hf-182W decay system is a powerful chronometer for constraining the timing of metal-silicate separation and core formation in planetesimals and planets. Neutron capture effects on W isotopes, however, significantly hamper the application of this tool. In order to correct for neutron capture effects, Pt isotopes have emerged as a reliable in-situ neutron dosimeter. This study applies this method to IAB iron meteorites, in order to constrain the timing of metal segregation on the IAB parent body. The ε182W values obtained for the IAB iron meteorites range from -3.61 ± 0.10 to -2.73 ± 0.09. Correlating εiPt with ε182W data yields a pre-neutron capture ε182W of -2.90 ± 0.06. This corresponds to a metal-silicate separation age of 6.0 ± 0.8 Ma after CAI for the IAB parent body, and is interpreted to represent a body-wide melting event. Later, between 10 and 14 Ma after CAI, an impact led to a catastrophic break-up and subsequent reassembly of the parent body. Thermal models of the interior evolution that are consistent with these estimates suggest that the IAB parent body underwent metal-silicate separation as a result of internal heating by short-lived radionuclides and accreted at around 1.4 ± 0.1 Ma after CAIs with a radius of greater than 60 km.

Disease: H00897 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available ) ... AUTHORS ... Akizu N, Cantagrel V, Schroth J, Cai N, Vaux K, McCloskey D, Naviaux RK, Van Vleet J, Fenstermaker AG, Silhavy JL, Sche...liga JS, Toyama K, Morisaki H, Sonmez FM, Celep F, Oraby

Erratum: Quantum corrections and black hole spectroscopy

Science.gov (United States)

Jiang, Qing-Quan; Han, Yan; Cai, Xu

2012-06-01

In my paper [Qing-Quan Jiang, Yan Han, Xu Cai, Quantum corrections and black hole spectroscopy, JHEP 08 (2010) 049], there was an error in deriving the black hole spectroscopy. In this erratum, we attempt to rectify them.

Mathematical Analysis of a PDE System for Biological Network Formation

KAUST Repository

Haskovec, Jan; Markowich, Peter A.; Perthame, Benoit

2015-01-01

Motivated by recent physics papers describing rules for natural network formation, we study an elliptic-parabolic system of partial differential equations proposed by Hu and Cai [13, 15]. The model describes the pressure field thanks to Darcy's type

Controlled-air incineration studies at the Los Alamos Scientific Laboratory

International Nuclear Information System (INIS)

Borduin, L.C.; Neuls, A.S.; Thompson, T.K.; Warner, C.L.

1978-01-01

An overview of the LASL controlled-air incineration (CAI) program is provided through a description of the process, a summary of component selection and system design criteria, a statement of project status, and discussion of experimental and process improvement study plans. The results of the program will be used to formulate the design criteria and operating parameters for a production model controlled-air transuranic (TRU) waste incineration system and govern the construction and operation of a facility for this purpose. The objective of the LASL CAI project is to develop and demonstrate an effective, safe, and reliable process for volume reduction and chemical stabilization of TRU solid wastes using proven technology whenever possible. The benefits of this process will be realized in reduced handling and storage hazards potentials, lower packaging, transportation, and storage expenses, less storage space requirements, and fewer monitoring needs

A petrologic and ion microprobe study of a Vigarano Type B refractory inclusion - Evolution by multiple stages of alteration and melting

Science.gov (United States)

Macpherson, Glenn J.; Davis, Andrew M.

1993-01-01

A Type B Ca-, Al-rich 6-m-diam inclusion (CAI) found in the Vigarano C3V chondrite was inspected using optical and scanning electron microscopies and ion microprobe analyses. It was found that the primary constituents of the CAI inclusion are (in percent), melilite (52), fassaite, (20), anorthite (18), spinel (10), and trace Fe-Ni metal. It is noted that, while many of the properties of the inclusion indicate solidification from a melt droplet, the Al-26/Mg-26 isotopic systematics and some textural relationships are incompatible with single-stage closed system crystallization of a homogeneous molten droplet, indicating that the history of this inclusion must have been more complex than melt solidification alone. Moreover, there was unusually high content of Na in melilite, suggesting that the droplet did not form by melting of pristine high-temperature nebular condensates.

Promoting middle school students’ abstract-thinking ability through cognitive apprenticeship instruction in mathematics learning

Science.gov (United States)

Yusepa, B. G. P.; Kusumah, Y. S.; Kartasasmita, B. G.

2018-01-01

The aim of this study is to get an in-depth understanding of students’ abstract-thinking ability in mathematics learning. This study was an experimental research with pre-test and post-test control group design. The subject of this study was eighth-grade students from two junior high schools in Bandung. In each schools, two parallel groups were selected and assigned into control and experimental groups. The experimental group was exposed to Cognitive Apprenticeship Instruction (CAI) treatment, whereas the control group was exposed to conventional learning. The results showed that abstract-thinking ability of students in experimental group was better than that of those in control group in which it could be observed from the overall and school level. It could be concluded that CAI could be a good alternative learning model to enhance students’ abstract-thinking ability.

Quantitative measurements of in-cylinder gas composition in a controlled auto-ignition combustion engine

Science.gov (United States)

Zhao, H.; Zhang, S.

2008-01-01

One of the most effective means to achieve controlled auto-ignition (CAI) combustion in a gasoline engine is by the residual gas trapping method. The amount of residual gas and mixture composition have significant effects on the subsequent combustion process and engine emissions. In order to obtain quantitative measurements of in-cylinder residual gas concentration and air/fuel ratio, a spontaneous Raman scattering (SRS) system has been developed recently. The optimized optical SRS setups are presented and discussed. The temperature effect on the SRS measurement is considered and a method has been developed to correct for the overestimated values due to the temperature effect. Simultaneous measurements of O2, H2O, CO2 and fuel were obtained throughout the intake, compression, combustion and expansion strokes. It shows that the SRS can provide valuable data on this process in a CAI combustion engine.

Quantitative measurements of in-cylinder gas composition in a controlled auto-ignition combustion engine

International Nuclear Information System (INIS)

Zhao, H; Zhang, S

2008-01-01

One of the most effective means to achieve controlled auto-ignition (CAI) combustion in a gasoline engine is by the residual gas trapping method. The amount of residual gas and mixture composition have significant effects on the subsequent combustion process and engine emissions. In order to obtain quantitative measurements of in-cylinder residual gas concentration and air/fuel ratio, a spontaneous Raman scattering (SRS) system has been developed recently. The optimized optical SRS setups are presented and discussed. The temperature effect on the SRS measurement is considered and a method has been developed to correct for the overestimated values due to the temperature effect. Simultaneous measurements of O 2 , H 2 O, CO 2 and fuel were obtained throughout the intake, compression, combustion and expansion strokes. It shows that the SRS can provide valuable data on this process in a CAI combustion engine

African Journal of Biotechnology - Vol 12, No 31 (2013)

African Journals Online (AJOL)

induced fatty liver model of consecutive extracts from Rosa davurica Pall · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ying Wei, Muyi Cai, Ruizeng Gu, Jun Lu, Feng Lin, Baoping Ji ...

Ethnoveterinary Application of Morinda Citrifolia Fruit Puree on a ...

African Journals Online (AJOL)

Ethnoveterinary Application of Morinda Citrifolia Fruit Puree on a Commercial Heifer Rearing Facility with Endemic Salmonellosis. VJ Brooks, TJ De Wolfe, TJ Paulus, J Xu, J Cai, NS Keuler, RG Godbee, SF Peek, SM McGuirk, BJ Dariena ...

Disease: H00801 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available Z, Cai B, Hostetler EM, Moran R, Liang D, Estrera A, Safi HJ, Leal SM, Bamshad MJ, Shendure J, Nickerson DA,... ... AUTHORS ... Guo DC, Regalado ES, Gong L, Duan X, Santos-Cortez RL, Arnaud P, Ren

¿Es el plagio una sorpresa? ¿Acaso tiene clase?

Directory of Open Access Journals (Sweden)

Marco González T.

2011-12-01

Full Text Available Entendemos que no es posible abordar en un espacio editorial el vasto tema del plagio, sus implicaciones y temas conexos presente en libros, artículos científicos, historias, películas, frases, logotipos, inventos, marcas, colores de productos e ideas entre otros muchos temas desarrollados por el ser humano. Este mal es muy antiguo, pero parafraseando términos de los infectólogos, hoy día se encuentra en plena reemergencia. Al patógeno de esta epidemia le favorece indiscutiblemente la moderna vía de transmisión global que es el internet, ya que través de la red, el cibernauta dispone de toneladas de información; la mayoría gratuita.

NCBI nr-aa BLAST: CBRC-PTRO-27-0002 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-27-0002 gb|AAH18471.1| NFS1 nitrogen fixation 1 homolog (S. cerevisiae) [...Homo sapiens] emb|CAI13602.1| NFS1 nitrogen fixation 1 (S. cerevisiae) [Homo sapiens] AAH18471.1 3e-10 83% ...

Culture conditions for the production of a tannase of Aspergillus ...

African Journals Online (AJOL)

STORAGESEVER

2009-06-03

Jun 3, 2009 ... hydrogen bonds in solutions (Spencer et al., 1988) resulting in the ... death at higher levels of intake (Garg et al., 1992; Makkar and Becker ..... Spencer CM, Cai Y, Martin R, Gaffney SH, Goulding PN, Magnolato D,. Lilley TH ...

Breast Cancer Startup Challenge winners

Science.gov (United States)

Ten winners of a world-wide competition to bring emerging breast cancer research technologies to market faster were announced today by the Avon Foundation for Women, in partnership with NCI and the Center for Advancing Innovation (CAI). Avon is providing

Anticipating Central Asian Water Stress: Variation in River Flow Dependency on Melt Waters from Alpine to Plains in the Remote Tien Shan Range, Kyrgyzstan Using a Rapid Hydro Assessment Methodology

Science.gov (United States)

Hill, A. F.; Wilson, A. M.; Williams, M. W.

2016-12-01

The future of mountain water resources in High Asia is of high interest to water managers, development organizations and policy makers given large populations downstream reliant on snow and ice sourced river flow. Together with historical and cultural divides among ex-Soviet republics, a lack of central water management following the Soviet break-up has led to water stress as trans-boundary waters weave through and along borders. New upstream hydropower development, a thirsty downstream agricultural sector and a shrinking Aral Sea has led to increasing tension in the region. Despite these pressures and in contrast to eastern High Asia's Himalayan basins (Ganges, Brahmaputra), little attention has been given to western High Asia draining the Pamir and Tien Shan ranges (Syr Darya and Amu Darya basins) to better understand the hydrology of this vast and remote area. Difficult access and challenging terrain exacerbate challenges to working in this remote mountain region. As part of the Contributions to High Asia Runoff from Ice and Snow (CHARIS) project, we asked how does river flow source water composition change over an alpine-to-plains domain of Kyrgyzstan's Naryn River in the Syr Darya basin? In addition, what may the future hold for river flow in Central Asia given the differing responses of snow and ice to climate changes? Utilizing a Rapid Hydrologic Assessment methodology including a suite of pre-field mapping techniques we collected in situ water chemistry data at targeted, remote mountain sites over 450km of the Naryn River over an elevation gradient from glacial headwaters to the lower lying areas - places where people, hydropower and agriculture utilize water. Chemical and isotope tracers were used to separate stream flow to understand relative dependency on melt waters as the river moves downstream from glaciers and snow covered areas. This case study demonstrates a technique to acquire field data over large scales in remote regions that facilitates

Neuromuscular training to enhance sensorimotor and functional deficits in subjects with chronic ankle instability: A systematic review and best evidence synthesis

Directory of Open Access Journals (Sweden)

O'Driscoll Jeremiah

2011-09-01

Full Text Available Abstract Objective To summarise the available evidence for the efficacy of neuromuscular training in enhancing sensorimotor and functional deficits in subjects with chronic ankle instability (CAI. Design Systematic review with best evidence synthesis. Data Sources An electronic search was conducted through December 2009, limited to studies published in the English language, using the Pubmed, CINAHL, Embase, and SPORTDiscus databases. Reference screening of all included articles was also undertaken. Methods Studies were selected if the design was a RCT, quasi RCT, or a CCT; the patients were adolescents or adults with confirmed CAI; and one of the treatment options consisted of a neuromuscular training programme. The primary investigator independently assessed the risk of study bias and extracted relevant data. Due to clinical heterogeneity, data was analysed using a best-evidence synthesis. Results Fourteen studies were included in the review. Meta-analysis with statistical pooling of data was not possible, as the studies were considered too heterogeneous. Instead a best evidence synthesis was undertaken. There is limited to moderate evidence to support improvements in dynamic postural stability, and patient perceived functional stability through neuromuscular training in subjects with CAI. There is limited evidence of effectiveness for neuromuscular training for improving static postural stability, active and passive joint position sense (JPS, isometric strength, muscle onset latencies, shank/rearfoot coupling, and a reduction in injury recurrence rates. There is limited evidence of no effectiveness for improvements in muscle fatigue following neuromuscular intervention. Conclusion There is limited to moderate evidence of effectiveness in favour of neuromuscular training for various measures of static and dynamic postural stability, active and passive JPS, isometric strength, muscle onset latencies, shank/rearfoot coupling and injury recurrence

CROSS-CULTURAL ADAPTATION AND VALIDATION OF THE KOREAN VERSION OF THE CUMBERLAND ANKLE INSTABILITY TOOL.

Science.gov (United States)

Ko, Jupil; Rosen, Adam B; Brown, Cathleen N

2015-12-01

The Cumberland Ankle Instability Tool (CAIT) is a valid and reliable patient reported outcome used to assess the presence and severity of chronic ankle instability (CAI). The CAIT has been cross-culturally adapted into other languages for use in non-English speaking populations. However, there are no valid questionnaires to assess CAI in individuals who speak Korean. The purpose of this study was to translate, cross-culturally adapt, and validate the CAIT, for use in a Korean-speaking population with CAI. Cross-cultural reliability study. The CAIT was cross-culturally adapted into Korean according to accepted guidelines and renamed the Cumberland Ankle Instability Tool-Korean (CAIT-K). Twenty-three participants (12 males, 11 females) who were bilingual in English and Korean were recruited and completed the original and adapted versions to assess agreement between versions. An additional 168 national level Korean athletes (106 male, 62 females; age = 20.3 ± 1.1 yrs), who participated in ≥ 90 minutes of physical activity per week, completed the final version of the CAIT-K twice within 14 days. Their completed questionnaires were assessed for internal consistency, test-retest reliability, criterion validity, and construct validity. For bilingual participants, intra-class correlation coefficients (ICC2,1) between the CAIT and the CAIT-K for test-retest reliability were 0.95 (SEM=1.83) and 0.96 (SEM=1.50) in right and left limbs, respectively. The Cronbach's alpha coefficients were 0.92 and 0.90 for the CAIT-K in right and left limbs, respectively. For native Korean speakers, the CAIT-K had high internal consistency (Cronbach's α=0.89) and intra-class correlation coefficient (ICC2,1 = 0.94, SEM=1.72), correlation with the physical component score (rho=0.70, p = 0.001) of the Short-Form Health Survey (SF-36), and the Kaiser-Meyer-Olkin score was 0.87. The original CAIT was translated, cross-culturally adapted, and validated from English to Korean

Developing Computer-Assisted Instruction Multimedia For Educational Technology Course of Coastal Area Students

Science.gov (United States)

Idris, Husni; Nurhayati, Nurhayati; Satriani, Satriani

2018-05-01

This research aims to a) identify instructional software (interactive multimedia CDs) by developing Computer-Assisted Instruction (CAI) multimedia that is eligible to be used in the instruction of the Educational Technology course; b) analysis the role of instructional software (interactive multimedia CDs) on the Educational Technology course through the development of Computer-Assisted Instruction (CAI) multimedia to improve the quality of education and instructional activities. This is Research and Development (R&D). It employed the descriptive procedural model of development, which outlines the steps to be taken to develop a product, which is instructional multimedia. The number of subjects of the research trial or respondents for each stage was 20 people. To maintain development quality, an expert in materials outside the materials under study, an expert in materials who is also a Educational Technology lecturer, a small groupof 3 students, a medium-sized group of 10 students, and 20 students to participate in the field testing took part in this research. Then, data collection instruments were developed in two stages, namely: a) developing the instruments; and b) trying out instruments. Data on students’ responses were collected using questionnaires and analyzed using descriptive statistics with percentage and categorization techniques. Based on data analysis results, it is revealed that the Computer-Assisted Instruction (CAI) multimedia developed and tried out among students during the preliminary field testing falls into the “Good” category, with the aspects of instruction, materials, and media falling into the “Good” category. Subsequently, results of the main field testing among students also suggest that it falls into the “Good” category, with the aspects of instruction, materials, and media falling into the “Good” category. Similarly, results of the operational field testing among students also suggest that it falls into the �

Plasmonic and Magnetically Responsive Gold ShellMagnetic Nanorod Hybrids

Science.gov (United States)

2017-10-10

including bio -targeting/sensing,1,2 structural enhancement/health monitoring,3,4 and energy harvesting/storage.5,6 Typical approaches to achieve...Mirshahghassemi S, Ebner AD, Cai B, Lead JR, Application of high gradient magnetic separation for oil remediation using polymer-coated magnetic

NCBI nr-aa BLAST: CBRC-ACAR-01-0832 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0832 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-142 60% ...

NCBI nr-aa BLAST: CBRC-GGAL-06-0009 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGAL-06-0009 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-152 65% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1682 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1682 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 86% ...

NCBI nr-aa BLAST: CBRC-MMUS-19-0100 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-19-0100 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 90% ...

NCBI nr-aa BLAST: CBRC-RMAC-09-0031 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-09-0031 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 97% ...

NCBI nr-aa BLAST: CBRC-TGUT-09-0014 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TGUT-09-0014 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 1e-144 67% ...

NCBI nr-aa BLAST: CBRC-CFAM-28-0009 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-28-0009 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 84% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0531 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0531 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 88% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-0895 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-0895 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 87% ...

NCBI nr-aa BLAST: CBRC-PTRO-11-0036 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-11-0036 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 98% ...

NCBI nr-aa BLAST: CBRC-HSAP-10-0037 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-HSAP-10-0037 ref|NP_000675.1| beta-1-adrenergic receptor [Homo sapiens] gb|AAA51667.1| beta-1-adrenergi...c receptor emb|CAI16920.1| adrenergic, beta-1-, receptor [Homo sapiens] NP_000675.1 0.0 100% ...

Estimation of Methane Emissions from Municipal Solid Waste Landfills in China Based on Point Emission Sources

Directory of Open Access Journals (Sweden)

Cai Bo-Feng

2014-01-01

Citation: Cai, B.-F., Liu, J.-G., Gao, Q.-X., et al., 2014. Estimation of methane emissions from municipal solid waste landfills in China based on point emission sources. Adv. Clim. Change Res. 5(2, doi: 10.3724/SP.J.1248.2014.081.

ORF Alignment: NC_006513 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

Issey Miyake näitus Pariisis

Index Scriptorium Estoniae

1998-01-01

Moedisaineri Issey Miyake näitus 'Making Things' 17. jaan.-ni 1999 Pariisis Fondation Cartier's. Näitus koosneb neljast osast, teine osa 'Pleats Please Guest Series' on Miyake koostöö nelja kunstikuga: Yasumasa Morimura, Nobuyoshi Araki, Tim Hawkinsoni ja Cai Guo-Qiangiga

Meteorite Dichotomy Implies that Jupiter Formed Early

Science.gov (United States)

Kruijer, T. S.; Burkhardt, C.; Budde, G.; Kleine, T.

2018-05-01

Meteorites derive from two distinct nebular reservoirs that co-existed and remained spatially separated between 1 and 3–4 Ma after CAIs. This can most easily be explained if Jupiter acted as a barrier and formed early, within less than 1 Ma.

Effects of Using Simultaneous Prompting and Computer-Assisted Instruction during Small Group Instruction

Science.gov (United States)

Ozen, Arzu; Ergenekon, Yasemin; Ulke-Kurkcuoglu, Burcu

2017-01-01

The current study investigated the relation between simultaneous prompting (SP), computer-assisted instruction (CAI), and the receptive identification of target pictures (presented on laptop computer) for four preschool students with developmental disabilities. The students' acquisition of nontarget information through observational learning also…

Sex Differences in White Matter Microstructure in the Human Brain Predominantly Reflect Differences in Sex Hormone Exposure

NARCIS (Netherlands)

van Hemmen, J; Saris, I M J; Cohen-Kettenis, P T; Veltman, D J; Pouwels, P J W; Bakker, J

Sex differences have been described regarding several aspects of human brain morphology; however, the exact biological mechanisms underlying these differences remain unclear in humans. Women with the complete androgen insensitivity syndrome (CAIS), who lack androgen action in the presence of a 46,XY

Efeitos do estado de humor sobre os comportamentos alimentares inadequados de atletas de atletismo

Directory of Open Access Journals (Sweden)

Leonardo de Sousa Fortes

Full Text Available O objetivo do presente estudo foi analisar os efeitos do estado de humor sobre os comportamentos alimentares inadequados (CAI em atletas. Participaram 68 atletas de atletismo, do sexo feminino, com idades entre 12 e 17 anos. Utilizaram-se o Eating Attitudes Test (EAT-26 e a Escala de Humor de Brunel (BRUMS para avaliar os CAI e o distúrbio total do humor (DTH, respectivamente. Dois modelos de regressão linear não indicaram influência estatisticamente significativa da BRUMS nas subescalas Dieta (p=0,42 e Bulimia e Preocupação com Alimentos (p=0,81 do EAT-26. Ao contrário, a BRUMS (p=0,04 demonstrou impacto significante (7% sobre os escores da subescala Autocontrole Oral. Concluiu-se que as atletas com DTH elevado podem estar mais susceptíveis à influência ambiental para a ingestão alimentar.

2016 consensus statement of the International Ankle Consortium: prevalence, impact and long-term consequences of lateral ankle sprains.

Science.gov (United States)

Gribble, Phillip A; Bleakley, Chris M; Caulfield, Brian M; Docherty, Carrie L; Fourchet, François; Fong, Daniel Tik-Pui; Hertel, Jay; Hiller, Claire E; Kaminski, Thomas W; McKeon, Patrick O; Refshauge, Kathryn M; Verhagen, Evert A; Vicenzino, Bill T; Wikstrom, Erik A; Delahunt, Eamonn

2016-12-01

The Executive Committee of the International Ankle Consortium presents this 2016 position paper with recommendations for information implementation and continued research based on the paradigm that lateral ankle sprain (LAS), and the development of chronic ankle instability (CAI), serve as a conduit to a significant global healthcare burden. We intend our recommendations to serve as a mechanism to promote efforts to improve prevention and early management of LAS. We believe this will reduce the prevalence of CAI and associated sequelae that have led to the broader public health burdens of decreased physical activity and early onset ankle joint post-traumatic osteoarthritis. Ultimately, this can contribute to healthier lifestyles and promotion of physical activity. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.