International Nuclear Information System (INIS)
Toernqvist, M.M.; Mowrer, J.; Jensen, S.; Ehrenberg, L.
1986-01-01
Tissue doses of cancer initiators/mutagens are suitably monitored through hemoglobin adducts formed in vivo, but the use of this method has been hampered by a lack of sufficiently simple and fast procedures. It was previously observed that when the N-terminal amino acid in hemoglobin, valine, is alkylated it is cleaved off by the Edman sequencing reagent, phenyl isothiocyanate, in the neutral-alkaline coupling medium, as opposed to the acidic medium required by normal amino acids. Based on this principle, conditions for a functioning procedure for gas chromatography/mass spectrometry (GC/MS) determination of N-terminal alkylvalines in hemoglobin were worked out. Derivatizing the protein in formamide solution with pentafluorophenyl isothiocyanate, using a 2 H-alkylated protein as internal standard, and applying on-column injection during analysis, permit reproducible determination of hydroxyethylvaline and other adducts down into the dose range where cancer risks may be considered acceptably low
Vliegenthart, J.F.G.; Gejyo, F.; Chang, J.-L.; Bürgi, W.; Schmid, K.; Offner, G.D.; Troxler, R.F.; Halbeek, H. van
1983-01-01
α2HS-Glycoprotein, a normal human plasma protein, was recently shown to consist of two polypeptide chains. In the present study, we have separated these two chains from one another and have elucidated the complete primary structure of the B-chain. Employing automated Edman degradation, the
Structure, antihyperglycemic activity and cellular actions of a novel diglycated human insulin
DEFF Research Database (Denmark)
O'Harte, F P; Boyd, A C; McKillop, A M
2000-01-01
Human insulin was glycated under hyperglycemic reducing conditions and a novel diglycated form (M(r) 6135.1 Da) was purified by RP-HPLC. Endoproteinase Glu-C digestion combined with mass spectrometry and automated Edman degradation localized glycation to Gly(1) and Phe(1) of the insulin A- and B-...
Automated Degradation Diagnosis in Character Recognition System Subject to Camera Vibration
Directory of Open Access Journals (Sweden)
Chunmei Liu
2014-01-01
Full Text Available Degradation diagnosis plays an important role for degraded character processing, which can tell the recognition difficulty of a given degraded character. In this paper, we present a framework for automated degraded character recognition system by statistical syntactic approach using 3D primitive symbol, which is integrated by degradation diagnosis to provide accurate and reliable recognition results. Our contribution is to design the framework to build the character recognition submodels corresponding to degradation subject to camera vibration or out of focus. In each character recognition submodel, statistical syntactic approach using 3D primitive symbol is proposed to improve degraded character recognition performance. In the experiments, we show attractive experimental results, highlighting the system efficiency and recognition performance by statistical syntactic approach using 3D primitive symbol on the degraded character dataset.
DEFF Research Database (Denmark)
Casci Ceccacci, Andrea; Morelli, Lidia; Bosco, Filippo
2015-01-01
setup unit, the system allows high-throughput measurements of resonance frequency over microresonator arrays under controlled flow conditions. We here demonstrate the acquisition of statistical data on biopolymer films degradation under enzymatic reaction over a large sample of micromechanical......In this work we present a novel automated system which allows the study of enzymatic degradation of biopolymer films coated on micromechanical resonators. The system combines an optical readout based on Blu-Ray technology with a software-controlled scanning mechanism. Integrated with a microfluidic...
Automated marker tracking using noisy X-ray images degraded by the treatment beam
Energy Technology Data Exchange (ETDEWEB)
Wisotzky, E. [Fraunhofer Institute for Production Systems and Design Technology (IPK), Berlin (Germany); German Cancer Research Center (DKFZ), Heidelberg (Germany); Fast, M.F.; Nill, S. [The Royal Marsden NHS Foundation Trust, London (United Kingdom). Joint Dept. of Physics; Oelfke, U. [The Royal Marsden NHS Foundation Trust, London (United Kingdom). Joint Dept. of Physics; German Cancer Research Center (DKFZ), Heidelberg (Germany)
2015-09-01
This study demonstrates the feasibility of automated marker tracking for the real-time detection of intrafractional target motion using noisy kilovoltage (kV) X-ray images degraded by the megavoltage (MV) treatment beam. The authors previously introduced the in-line imaging geometry, in which the flat-panel detector (FPD) is mounted directly underneath the treatment head of the linear accelerator. They found that the 121 kVp image quality was severely compromised by the 6 MV beam passing through the FPD at the same time. Specific MV-induced artefacts present a considerable challenge for automated marker detection algorithms. For this study, the authors developed a new imaging geometry by re-positioning the FPD and the X-ray tube. This improved the contrast-to-noise-ratio between 40% and 72% at the 1.2 mAs/image exposure setting. The increase in image quality clearly facilitates the quick and stable detection of motion with the aid of a template matching algorithm. The setup was tested with an anthropomorphic lung phantom (including an artificial lung tumour). In the tumour one or three Calypso {sup registered} beacons were embedded to achieve better contrast during MV radiation. For a single beacon, image acquisition and automated marker detection typically took around 76±6 ms. The success rate was found to be highly dependent on imaging dose and gantry angle. To eliminate possible false detections, the authors implemented a training phase prior to treatment beam irradiation and also introduced speed limits for motion between subsequent images.
Automated marker tracking using noisy X-ray images degraded by the treatment beam
International Nuclear Information System (INIS)
Wisotzky, E.; Fast, M.F.; Nill, S.
2015-01-01
This study demonstrates the feasibility of automated marker tracking for the real-time detection of intrafractional target motion using noisy kilovoltage (kV) X-ray images degraded by the megavoltage (MV) treatment beam. The authors previously introduced the in-line imaging geometry, in which the flat-panel detector (FPD) is mounted directly underneath the treatment head of the linear accelerator. They found that the 121 kVp image quality was severely compromised by the 6 MV beam passing through the FPD at the same time. Specific MV-induced artefacts present a considerable challenge for automated marker detection algorithms. For this study, the authors developed a new imaging geometry by re-positioning the FPD and the X-ray tube. This improved the contrast-to-noise-ratio between 40% and 72% at the 1.2 mAs/image exposure setting. The increase in image quality clearly facilitates the quick and stable detection of motion with the aid of a template matching algorithm. The setup was tested with an anthropomorphic lung phantom (including an artificial lung tumour). In the tumour one or three Calypso registered beacons were embedded to achieve better contrast during MV radiation. For a single beacon, image acquisition and automated marker detection typically took around 76±6 ms. The success rate was found to be highly dependent on imaging dose and gantry angle. To eliminate possible false detections, the authors implemented a training phase prior to treatment beam irradiation and also introduced speed limits for motion between subsequent images.
Schlesinger, D H; Hay, D I
1977-03-10
The complete amino acid sequence of human salivary statherin, a peptide which strongly inhibits precipitation from supersaturated calcium phosphate solutions, and therefore stabilizes supersaturated saliva, has been determined. The NH2-terminal half of this Mr=5380 (43 amino acids) polypeptide was determined by automated Edman degradations (liquid phase) on native statherin. The peptide was digested separately with trypsin, chymotrypsin, and Staphylococcus aureus protease, and the resulting peptides were purified by gel filtration. Manual Edman degradations on purified peptide fragments yielded peptides that completed the amino acid sequence through the penultimate COOH-terminal residue. These analyses, together with carboxypeptidase digestion of native statherin and of peptide fragments of statherin, established the complete sequence of the molecule. The 2 serine residues (positions 2 and 3) in statherin were identified as phosphoserine. The amino acid sequence of human salivary statherin is striking in a number of ways. The NH2-terminal one-third is highly polar and includes three polar dipeptides: H2PO3-Ser-Ser-H2PO3-Arg-Arg-, and Glu-Glu-. The COOH-terminal two-thirds of the molecule is hydrophobic, containing several repeating dipeptides: four of -Gn-Pro-, three of -Tyr-Gln-, two of -Gly-Tyr-, two of-Gln-Tyr-, and two of the tetrapeptide sequence -Pro-Tyr-Gln-Pro-. Unusual cleavage sites in the statherin sequence obtained with chymotrypsin and S. aureus protease were also noted.
Chen, Stephanie I; Visser, Troy A W; Huf, Samuel; Loft, Shayne
2017-09-01
Automation can improve operator performance and reduce workload, but can also degrade operator situation awareness (SA) and the ability to regain manual control. In 3 experiments, we examined the extent to which automation could be designed to benefit performance while ensuring that individuals maintained SA and could regain manual control. Participants completed a simulated submarine track management task under varying task load. The automation was designed to facilitate information acquisition and analysis, but did not make task decisions. Relative to a condition with no automation, the continuous use of automation improved performance and reduced subjective workload, but degraded SA. Automation that was engaged and disengaged by participants as required (adaptable automation) moderately improved performance and reduced workload relative to no automation, but degraded SA. Automation engaged and disengaged based on task load (adaptive automation) provided no benefit to performance or workload, and degraded SA relative to no automation. Automation never led to significant return-to-manual deficits. However, all types of automation led to degraded performance on a nonautomated task that shared information processing requirements with automated tasks. Given these outcomes, further research is urgently required to establish how to design automation to maximize performance while keeping operators cognitively engaged. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Complacency and Automation Bias in the Use of Imperfect Automation.
Wickens, Christopher D; Clegg, Benjamin A; Vieane, Alex Z; Sebok, Angelia L
2015-08-01
We examine the effects of two different kinds of decision-aiding automation errors on human-automation interaction (HAI), occurring at the first failure following repeated exposure to correctly functioning automation. The two errors are incorrect advice, triggering the automation bias, and missing advice, reflecting complacency. Contrasts between analogous automation errors in alerting systems, rather than decision aiding, have revealed that alerting false alarms are more problematic to HAI than alerting misses are. Prior research in decision aiding, although contrasting the two aiding errors (incorrect vs. missing), has confounded error expectancy. Participants performed an environmental process control simulation with and without decision aiding. For those with the aid, automation dependence was created through several trials of perfect aiding performance, and an unexpected automation error was then imposed in which automation was either gone (one group) or wrong (a second group). A control group received no automation support. The correct aid supported faster and more accurate diagnosis and lower workload. The aid failure degraded all three variables, but "automation wrong" had a much greater effect on accuracy, reflecting the automation bias, than did "automation gone," reflecting the impact of complacency. Some complacency was manifested for automation gone, by a longer latency and more modest reduction in accuracy. Automation wrong, creating the automation bias, appears to be a more problematic form of automation error than automation gone, reflecting complacency. Decision-aiding automation should indicate its lower degree of confidence in uncertain environments to avoid the automation bias. © 2015, Human Factors and Ergonomics Society.
Zhang, Yuwei; Li, Jie; Yuan, Yong; Gu, Jijuan; Chen, Peng
2017-05-25
Rutin-degrading enzymes (RDE) can degrade rutin into poorly water soluble compound, quercetin, and cause the bitter taste in tartary buckwheat. In the present study RDE from Yu 6-21 tartary buckwheat seeds was purified by ammonium sulphate precipitation, followed by hydrophobic interaction chromatography on Phenyl Sepharose CL-4B, ion exchange chromatography on CM-Cellulose and gel filtration chromatography on Sephadex G-150. Purified RDE showed single band with molecular weight of 66 kDa on SDS-PAGE. The optimum pH and temperature of RDE were 5.0 and 50 ℃ respectively. The Km was 0.27 mmol/L, and the Vmax was 39.68 U/mg. The RDE activity could be inhibited by Cu²⁺, Zn²⁺, Mn²⁺ and EDTA, and showed tolerance to 50% methanol (V/V). The N terminal sequence (TVSRSSFPDGFLFGL) was obtained by Edman degradation method and 15 internal peptide sequences were determined by MALDI-TOF-MS (matrix-assisted laser desorption ionization time of flight mass spectrometry). These results established the foundations for identification of the candidate gene of RDE via transcriptome data and further studying RDE biological function.
Automated Non-Destructive Testing Array Evaluation System
Energy Technology Data Exchange (ETDEWEB)
Wei, T.; Zavaljevski, N.; Bakhtiari, S.; Miron, A.; Jupperman, D.
2004-12-31
Utilities perform eddy current tests on nuclear power plant steam generator (SG) tubes to detect degradation. This report summarizes the status of ongoing research to develop signal processing algorithms that automate analysis of eddy current test data. The research focuses on analyzing array probe data for detecting, classifying, and characterizing degradation in SG tubes.
Automated Non-Destructive Testing Array Evaluation System
International Nuclear Information System (INIS)
Wei, T.; Zavaljevski, N.; Bakhtiari, S.; Miron, A.; Kupperman, D.
2004-01-01
Utilities perform eddy current tests on nuclear power plant steam generator (SG) tubes to detect degradation. This report summarizes the status of ongoing research to develop signal processing algorithms that automate analysis of eddy current test data. The research focuses on analyzing array probe data for detecting, classifying, and characterizing degradation in SG tubes
Poliovirus RNA synthesis in vitro: structural elements and antibody inhibition
International Nuclear Information System (INIS)
Semler, B.L.; Hanecak, R.; Dorner, L.F.; Anderson, C.W.; Wimmer, E.
1983-01-01
The poliovirus RNA polymerase complex has been analyzed by immunoautoradiography using antibody probes derived from purified replicase (P3) region viral polypeptides. Antibody preparations made against the polio RNA polymerase, P3-4b, detected a previously unreported cellular protein that copurifies with the RNA polymerase. An IgG fraction purified from rabbit antiserum to polypeptide P3-2, a precursor fo the RNA polymerase, specifically inhibits poliovirus RNA synthesis in vitro. The authors have also immunoprecipitated a 60,000-dalton protein (P3-4a) with antiserum to protein P3-4b and have determined the precise genomic map position of this protein by automated Edman degradation. Protein P3-4a originates by cleavage of the RNA polymerase precursor at a glutamine-glucine amino acid pair not previously reported to be a viral cleavage site
Bayesian Safety Risk Modeling of Human-Flightdeck Automation Interaction
Ancel, Ersin; Shih, Ann T.
2015-01-01
Usage of automatic systems in airliners has increased fuel efficiency, added extra capabilities, enhanced safety and reliability, as well as provide improved passenger comfort since its introduction in the late 80's. However, original automation benefits, including reduced flight crew workload, human errors or training requirements, were not achieved as originally expected. Instead, automation introduced new failure modes, redistributed, and sometimes increased workload, brought in new cognitive and attention demands, and increased training requirements. Modern airliners have numerous flight modes, providing more flexibility (and inherently more complexity) to the flight crew. However, the price to pay for the increased flexibility is the need for increased mode awareness, as well as the need to supervise, understand, and predict automated system behavior. Also, over-reliance on automation is linked to manual flight skill degradation and complacency in commercial pilots. As a result, recent accidents involving human errors are often caused by the interactions between humans and the automated systems (e.g., the breakdown in man-machine coordination), deteriorated manual flying skills, and/or loss of situational awareness due to heavy dependence on automated systems. This paper describes the development of the increased complexity and reliance on automation baseline model, named FLAP for FLightdeck Automation Problems. The model development process starts with a comprehensive literature review followed by the construction of a framework comprised of high-level causal factors leading to an automation-related flight anomaly. The framework was then converted into a Bayesian Belief Network (BBN) using the Hugin Software v7.8. The effects of automation on flight crew are incorporated into the model, including flight skill degradation, increased cognitive demand and training requirements along with their interactions. Besides flight crew deficiencies, automation system
Automating large-scale reactor systems
International Nuclear Information System (INIS)
Kisner, R.A.
1985-01-01
This paper conveys a philosophy for developing automated large-scale control systems that behave in an integrated, intelligent, flexible manner. Methods for operating large-scale systems under varying degrees of equipment degradation are discussed, and a design approach that separates the effort into phases is suggested. 5 refs., 1 fig
Toward a human-centered aircraft automation philosophy
Billings, Charles E.
1989-01-01
The evolution of automation in civil aircraft is examined in order to discern trends in the respective roles and functions of automation technology and the humans who operate these aircraft. The effects of advances in automation technology on crew reaction is considered and it appears that, though automation may well have decreased the frequency of certain types of human errors in flight, it may also have enabled new categories of human errors, some perhaps less obvious and therefore more serious than those it has alleviated. It is suggested that automation could be designed to keep the pilot closer to the control of the vehicle, while providing an array of information management and aiding functions designed to provide the pilot with data regarding flight replanning, degraded system operation, and the operational status and limits of the aircraft, its systems, and the physical and operational environment. The automation would serve as the pilot's assistant, providing and calculating data, watching for the unexpected, and keeping track of resources and their rate of expenditure.
Fujita, M; Nomura, K; Hong, K; Ito, Y; Asada, A; Nishimuro, S
1993-12-30
A strong fibrinolytic enzyme (nattokinase) was purified from the vegetable cheese natto. Nattokinase was extracted from natto with saline and isolated by sequential use of hydrophobic chromatography on Butyl-Toyopearl, ion-exchange chromatography on CM-Toyopearl, and gel-filtration on Sephadex G-50. The isolated protein gave a single sharp band on SDS-PAGE either before or after reduction. The sequence, as determined by automated Edman degradation of the uncleaved molecule and its enzymatically derived peptide, consisted of a total 275 amino acid residues (M.W = 27,728) and exhibited a high homology with the subtilisins. The purified nattokinase digested not only fibrin but also several synthetic substrates. Among the synthetic substrates, the most sensitive substrate was Suc-Ala-Ala-Pro-Phe-pNA for subtilisin. PMSF inhibited both the fibrinolytic activity and the amidolytic activity. The results indicate that nattokinase is a subtilisin-like serine protease.
DEFF Research Database (Denmark)
Andersen, Jens S.; Andersen, S O; Højrup, P
1993-01-01
The complete amino acid sequence of a 14 kDa structural protein (LM-76) isolated from pharate cuticle of the locust, Locusta migratoria, was determined by Edman degradation of the intact protein and enzymatically derived peptides. Plasma desorption and electrospray mass spectrometry was used as a...
Novel antimicrobial peptides isolated from the venom of wild bees
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav; Monincová, Lenka; Slaninová, Jiřina; Fučík, Vladimír; Borovičková, Lenka; Hovorka, Oldřich; Voburka, Zdeněk; Cvačka, Josef; Bednárová, Lucie; Buděšínský, Miloš; Straka, J.
2009-01-01
Roč. 276, Suppl. 1 (2009), s. 106-106 ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] Institutional research plan: CEZ:AV0Z40550506 Keywords : linear cationic alpha-helical antimicrobial peptides * Edman degradation * mass spectrometry Subject RIV: CC - Organic Chemistry
Klein, Michel; van Lambalgen, Rianne
2011-01-01
In demanding tasks, human performance can seriously degrade as a consequence of increased workload and limited resources. In such tasks it is very important to maintain an optimal performance quality, therefore automation assistance is required. On the other hand, automation can also impose
The Effects of Automation on Battle Manager Workload and Performance
National Research Council Canada - National Science Library
Soller, Amy; Morrison, John
2008-01-01
...) can moderate this degradation. The sources for this survey range from studies that describe the basic limits of human memory capacity to those that assess the number of battle managers needed to operate a partially automated missile defense system...
Crystallization and diffraction analysis of beta-N-acetylhexosaminidase from Aspergillus oryzae
Czech Academy of Sciences Publication Activity Database
Vaněk, Ondřej; Brynda, Jiří; Hofbauerová, Kateřina; Kukačka, Zdeněk; Pachl, Petr; Bezouška, Karel; Řezáčová, Pavlína
2011-01-01
Roč. 67, - (2011), s. 498-503 ISSN 1744-3091 R&D Projects: GA MŠk 1M0505 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z40550506; CEZ:AV0Z50520514 Keywords : fungal hexosaminidases * glycoproteins * quantitative Edman degradation Subject RIV: CE - Biochemistry Impact factor: 0.506, year: 2011
The Automated Conflict Resolution System (ACRS)
Kaplan, Ted; Musliner, Andrew; Wampler, David
1993-01-01
The Automated Conflict Resolution System (ACRS) is a mission-current scheduling aid that predicts periods of mutual interference when two or more orbiting spacecraft are scheduled to communicate with the same Tracking and Data Relay Satellite (TDRS) at the same time. The mutual interference predicted has the potential to degrade or prevent communications. Thus the ACRS system is a useful tool for aiding in the scheduling of Space Network (SN) communications.
Directory of Open Access Journals (Sweden)
Jukka Miettinen
2014-12-01
Full Text Available In this review paper we present geographical, ecological and historical aspects of Southeast Asia from the perspective of forest degradation monitoring and critically discuss available approaches for large area forest degradation monitoring with satellite remote sensing data at high to medium spatial resolution (5–30 m. Several authors have achieved promising results in geographically limited areas within Southeast Asia using automated detection algorithms. However, the application of automated methods to large area assessments remains a major challenge. To-date, nearly all large area assessments of forest degradation in the region have included a strong visual interpretation component. We conclude that due to the variety of forest types and forest disturbance levels, as well as the variable image acquisition conditions in Southeast Asia, it is unlikely that forest degradation monitoring can be conducted throughout the region using a single automated approach with currently available remote sensing data. The provision of regionally consistent information on forest degradation from satellite remote sensing data remains therefore challenging. However, the expected increase in observation frequency in the near future (due to Landsat 8 and Sentinel-2 satellites may lead to the desired improvement in data availability and enable consistent and robust regional forest degradation monitoring in Southeast Asia. Keywords: Tropical forest disturbance, Selective logging, Shifting cultivation, Satellite data, Indochina peninsula, Maritime continent
Investigation of possible causes for human-performance degradation during microgravity flight
Schroeder, James E.; Tuttle, Megan L.
1992-01-01
The results of the first year of a three year study of the effects of microgravity on human performance are given. Test results show support for the hypothesis that the effects of microgravity can be studied indirectly on Earth by measuring performance in an altered gravitational field. The hypothesis was that an altered gravitational field could disrupt performance on previously automated behaviors if gravity was a critical part of the stimulus complex controlling those behaviors. In addition, it was proposed that performance on secondary cognitive tasks would also degrade, especially if the subject was provided feedback about degradation on the previously automated task. In the initial experimental test of these hypotheses, there was little statistical support. However, when subjects were categorized as high or low in automated behavior, results for the former group supported the hypotheses. The predicted interaction between body orientation and level of workload in their joint effect on performance in the secondary cognitive task was significant for the group high in automatized behavior and receiving feedback, but no such interventions were found for the group high in automatized behavior but not receiving feedback, or the group low in automatized behavior.
Trust in automation and meta-cognitive accuracy in NPP operating crews
Energy Technology Data Exchange (ETDEWEB)
Skraaning Jr, G.; Miberg Skjerve, A. B. [OECD Halden Reactor Project, PO Box 173, 1751 Halden (Norway)
2006-07-01
Nuclear power plant operators can over-trust or under-trust automation. Operator trust in automation is said to be mis-calibrated when the level of trust is not corresponding to the actual level of automation reliability. A possible consequence of mis-calibrated trust is degraded meta-cognitive accuracy. Meta-cognitive accuracy is the ability to correctly monitor the effectiveness of ones own performance while engaged in complex tasks. When operators misjudge their own performance, human control actions will be poorly regulated and safety and/or efficiency may suffer. An analysis of simulator data showed that meta-cognitive accuracy and trust in automation were highly correlated for knowledge-based scenarios, but uncorrelated for rule-based scenarios. In the knowledge-based scenarios, the operators overestimated their performance effectiveness under high levels of trust, they underestimated performance under low levels of trust, but showed realistic self-assessment under intermediate levels of trust in automation. The result was interpreted to suggest that trust in automation impact the meta-cognitive accuracy of the operators. (authors)
Trust in automation and meta-cognitive accuracy in NPP operating crews
International Nuclear Information System (INIS)
Skraaning Jr, G.; Miberg Skjerve, A. B.
2006-01-01
Nuclear power plant operators can over-trust or under-trust automation. Operator trust in automation is said to be mis-calibrated when the level of trust is not corresponding to the actual level of automation reliability. A possible consequence of mis-calibrated trust is degraded meta-cognitive accuracy. Meta-cognitive accuracy is the ability to correctly monitor the effectiveness of ones own performance while engaged in complex tasks. When operators misjudge their own performance, human control actions will be poorly regulated and safety and/or efficiency may suffer. An analysis of simulator data showed that meta-cognitive accuracy and trust in automation were highly correlated for knowledge-based scenarios, but uncorrelated for rule-based scenarios. In the knowledge-based scenarios, the operators overestimated their performance effectiveness under high levels of trust, they underestimated performance under low levels of trust, but showed realistic self-assessment under intermediate levels of trust in automation. The result was interpreted to suggest that trust in automation impact the meta-cognitive accuracy of the operators. (authors)
Automated assay for screening the enzymatic release of reducing sugars from micronized biomass
Directory of Open Access Journals (Sweden)
Asther Marcel
2010-07-01
Full Text Available Abstract Background To reduce the production cost of bioethanol obtained from fermentation of the sugars provided by degradation of lignocellulosic biomass (i.e., second generation bioethanol, it is necessary to screen for new enzymes endowed with more efficient biomass degrading properties. This demands the set-up of high-throughput screening methods. Several methods have been devised all using microplates in the industrial SBS format. Although this size reduction and standardization has greatly improved the screening process, the published methods comprise one or more manual steps that seriously decrease throughput. Therefore, we worked to devise a screening method devoid of any manual steps. Results We describe a fully automated assay for measuring the amount of reducing sugars released by biomass-degrading enzymes from wheat-straw and spruce. The method comprises two independent and automated steps. The first step is the making of "substrate plates". It consists of filling 96-well microplates with slurry suspensions of micronized substrate which are then stored frozen until use. The second step is an enzymatic activity assay. After thawing, the substrate plates are supplemented by the robot with cell-wall degrading enzymes where necessary, and the whole process from addition of enzymes to quantification of released sugars is autonomously performed by the robot. We describe how critical parameters (amount of substrate, amount of enzyme, incubation duration and temperature were selected to fit with our specific use. The ability of this automated small-scale assay to discriminate among different enzymatic activities was validated using a set of commercial enzymes. Conclusions Using an automatic microplate sealer solved three main problems generally encountered during the set-up of methods for measuring the sugar-releasing activity of plant cell wall-degrading enzymes: throughput, automation, and evaporation losses. In its present set-up, the
Ansari, A A; Shenbagamurthi, P; Marsh, D G
1989-10-17
The complete amino acid sequence of a Lolium perenne (rye grass) pollen allergen, Lol p III, determined by the automated Edman degradation of the protein and its selected fragments, is reported in this paper. Cleavage by enzymatic and chemical techniques established unambiguously the sequence for this 97-residue protein (Mr = 10,909), which lacks cysteine and shows no evidence of glycosylation. The sequence of Lol p III is very similar to that of another L. perenne allergen, Lol p II, which was sequenced recently; of the 97 positions in the two proteins, 57 are occupied by identical amino acids (59% identity). In addition, both allergens share a similar structure with an antibody-binding fragment of a third L. perenne allergen, Lol p I. Since human antibody responsiveness to all these three allergens is associated with HLA-DR3, and since the structure common to the three molecules shows high degrees of amphipathicity in Lol p II and III, we speculate that this common segment in the three molecules might contain or contribute to the respectively Ia/T-cell sites.
Virsolvy-Vergine, A; Salazar, G; Sillard, R; Denoroy, L; Mutt, V; Bataille, D
1996-02-01
Anti-diabetic sulphonylureas act via high affinity binding sites coupled to K-ATP channels. Endosulfine, an endogenous ligand for these binding sites, was shown to exist in two molecular forms, alpha and beta, in both the pancreas and the central nervous system. We describe here the isolation, and partial structural characterization of alpha endosulfine derived from porcine brains by means of a series of chromatography runs and gel electrophoresis. Porcine alpha endosulfine is a protein with a molecular mass of 13,196 daltons as determined by mass spectrometry and which is N-terminally blocked. Tryptic digestion followed by separation of the fragments by HPLC and automated Edman degradation yielded a total of 72 amino acids in four partial sequences. Comparison of these sequences with that present in the National Biomedical Research Foundation protein data bank indicated a 82% identity with a 112-amino acid protein with a molecular mass of 12,353 daltons called "cyclic AMP-regulated phosphoprotein-19', isolated from the bovine brain as a substrate for protein kinase A.
An insecticidal toxin from Nephila clavata spider venom.
Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong
2017-07-01
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.
A data-driven multiplicative fault diagnosis approach for automation processes.
Hao, Haiyang; Zhang, Kai; Ding, Steven X; Chen, Zhiwen; Lei, Yaguo
2014-09-01
This paper presents a new data-driven method for diagnosing multiplicative key performance degradation in automation processes. Different from the well-established additive fault diagnosis approaches, the proposed method aims at identifying those low-level components which increase the variability of process variables and cause performance degradation. Based on process data, features of multiplicative fault are extracted. To identify the root cause, the impact of fault on each process variable is evaluated in the sense of contribution to performance degradation. Then, a numerical example is used to illustrate the functionalities of the method and Monte-Carlo simulation is performed to demonstrate the effectiveness from the statistical viewpoint. Finally, to show the practical applicability, a case study on the Tennessee Eastman process is presented. Copyright © 2013. Published by Elsevier Ltd.
Energy Technology Data Exchange (ETDEWEB)
Hacke, P.; Spataru, S.
2014-08-01
We propose a method for increasing the frequency of data collection and reducing the time and cost of accelerated lifetime testing of photovoltaic modules undergoing potential-induced degradation (PID). This consists of in-situ measurements of dark current-voltage curves of the modules at elevated stress temperature, their use to determine the maximum power at 25 degrees C standard test conditions (STC), and distribution statistics for determining degradation rates as a function of stress level. The semi-continuous data obtained by this method clearly show degradation curves of the maximum power, including an incubation phase, rates and extent of degradation, precise time to failure, and partial recovery. Stress tests were performed on crystalline silicon modules at 85% relative humidity and 60 degrees C, 72 degrees C, and 85 degrees C. Activation energy for the mean time to failure (1% relative) of 0.85 eV was determined and a mean time to failure of 8,000 h at 25 degrees C and 85% relative humidity is predicted. No clear trend in maximum degradation as a function of stress temperature was observed.
Iles, E. J.; McCallum, L.; Lovell, J. E. J.; McCallum, J. N.
2018-02-01
As we move into the next era of geodetic VLBI, the scheduling process is one focus for improvement in terms of increased flexibility and the ability to react with changing conditions. A range of simulations were conducted to ascertain the impact of scheduling on geodetic results such as Earth Orientation Parameters (EOPs) and station coordinates. The potential capabilities of new automated scheduling modes were also simulated, using the so-called 'dynamic scheduling' technique. The primary aim was to improve efficiency for both cost and time without losing geodetic precision, particularly to maximise the uses of the Australian AuScope VLBI array. We show that short breaks in observation will not significantly degrade the results of a typical 24 h experiment, whereas simply shortening observing time degrades precision exponentially. We also confirm the new automated, dynamic scheduling mode is capable of producing the same standard of result as a traditional schedule, with close to real-time flexibility. Further, it is possible to use the dynamic scheduler to augment the 3 station Australian AuScope array and thereby attain EOPs of the current global precision with only intermittent contribution from 2 additional stations. We thus confirm automated, dynamic scheduling bears great potential for flexibility and automation in line with aims for future continuous VLBI operations.
A HUMAN AUTOMATION INTERACTION CONCEPT FOR A SMALL MODULAR REACTOR CONTROL ROOM
Energy Technology Data Exchange (ETDEWEB)
Le Blanc, Katya; Spielman, Zach; Hill, Rachael
2017-06-01
Many advanced nuclear power plant (NPP) designs incorporate higher degrees of automation than the existing fleet of NPPs. Automation is being introduced or proposed in NPPs through a wide variety of systems and technologies, such as advanced displays, computer-based procedures, advanced alarm systems, and computerized operator support systems. Additionally, many new reactor concepts, both full scale and small modular reactors, are proposing increased automation and reduced staffing as part of their concept of operations. However, research consistently finds that there is a fundamental tradeoff between system performance with increased automation and reduced human performance. There is a need to address the question of how to achieve high performance and efficiency of high levels of automation without degrading human performance. One example of a new NPP concept that will utilize greater degrees of automation is the SMR concept from NuScale Power. The NuScale Power design requires 12 modular units to be operated in one single control room, which leads to a need for higher degrees of automation in the control room. Idaho National Laboratory (INL) researchers and NuScale Power human factors and operations staff are working on a collaborative project to address the human performance challenges of increased automation and to determine the principles that lead to optimal performance in highly automated systems. This paper will describe this concept in detail and will describe an experimental test of the concept. The benefits and challenges of the approach will be discussed.
Proaño Bolaños, Carolina; Zhou, Mei; Wang, Lei; Luis, Coloma; Chen, Tianbao; Shaw, Christopher
2016-01-01
Phyllomedusine frogs are an extraordinary source of biologically active peptides. At least 8 families of antimicrobial peptides have been reported in this frog clade, the dermaseptins being the most diverse. By a peptidomic approach, integrating molecular cloning, Edman degradation sequencing and tandem mass spectrometry, a new family of antimicrobial peptides has been identified in Cruziohyla calcarifer. These 15 novel antimicrobial peptides of 20–32 residues in length are named cruzioseptin...
Methods and devices for protein assays
Chhabra, Swapnil [San Jose, CA; Cintron, Jose M [Indianapolis, IN; Shediac, Renee [Oakland, CA
2009-11-03
Methods and devices for protein assays based on Edman degradation in microfluidic channels are disclosed herein. As disclosed, the cleaved amino acid residues may be immobilized in an array format and identified by detectable labels, such as antibodies, which specifically bind given amino acid residues. Alternatively, the antibodies are immobilized in an array format and the cleaved amino acids are labeled identified by being bound by the antibodies in the array.
Altering user' acceptance of automation through prior automation exposure.
Bekier, Marek; Molesworth, Brett R C
2017-06-01
Air navigation service providers worldwide see increased use of automation as one solution to overcome the capacity constraints imbedded in the present air traffic management (ATM) system. However, increased use of automation within any system is dependent on user acceptance. The present research sought to determine if the point at which an individual is no longer willing to accept or cooperate with automation can be manipulated. Forty participants underwent training on a computer-based air traffic control programme, followed by two ATM exercises (order counterbalanced), one with and one without the aid of automation. Results revealed after exposure to a task with automation assistance, user acceptance of high(er) levels of automation ('tipping point') decreased; suggesting it is indeed possible to alter automation acceptance. Practitioner Summary: This paper investigates whether the point at which a user of automation rejects automation (i.e. 'tipping point') is constant or can be manipulated. The results revealed after exposure to a task with automation assistance, user acceptance of high(er) levels of automation decreased; suggesting it is possible to alter automation acceptance.
International Nuclear Information System (INIS)
Jou, Y.-T.; Yenn, T.-C.; Lin, Chiuhsiang Joe; Yang, C.-W.; Chiang, C.-C.
2009-01-01
It has been expected that the automation of certain tasks in a control room would help decrease operators' mental workload, enhance situation awareness, and improve the whole system performance. However, there have been too many automation-induced system failures that would warrant a fresh look on the influences of automation. Automation problems include the reduction in the operator's system awareness, an increase in monitoring workload, and the degradation in manual skills. This study evaluates operators' mental workload and system performance during a human-system interface (HSI) automation in an advanced nuclear power plant (NPP). The reactor shutdown task and alarm reset task simulations were conducted in this study to evaluate operators' mental workload and performance. The results of this study indicated that for ensuring safe operating in NPPs, the design of automation needs to be carefully implemented. Task characteristics and degrees of automation should be carefully evaluated while designing HSIs. The reactor shutdown tasks studied in this paper suggest that a high level of automation design for the long period and low workload would be sufficient. On the other hand, the degree of automation of alarm reset task does not show a significant difference to the operator's mental workload. In conclusion, the human-system interface automation in advanced NPPs is suggested to be more flexible and needs to be continually improved.
Complete amino acid sequence of a Lolium perenne (perennial rye grass) pollen allergen, Lol p II.
Ansari, A A; Shenbagamurthi, P; Marsh, D G
1989-07-05
The complete amino acid sequence of a Lolium perenne (rye grass) pollen allergen, Lol p II was determined by automated Edman degradation of the protein and selected fragments. Cleavage of the protein by enzymatic and chemical techniques established an unambiguous sequence for the protein. Lol p II contains 97 amino acid residues, with a calculated molecular weight of 10,882. The protein lacks cysteine and glutamine and shows no evidence of glycosylation. Theoretical predictions by Fraga's (Fraga, S. (1982) Can. J. Chem. 60, 2606-2610) and Hopp and Woods' (Hopp, T. P., and Woods, K. R. (1981) Proc. Natl. Acad. Sci. U.S.A. 78, 3824-3828) methods indicate the presence of four hydrophilic regions, which may contribute to sequential or parts of conformational B-cell epitopes. Analysis of amphipathic regions by Berzofsky's method indicates the presence of a highly amphipathic region, which may contain, or contribute to, an Ia/T-cell epitope. This latter segment of Lol p II was found to be highly homologous with an antibody-binding segment of the major rye allergen Lol p I and may explain why immune responsiveness to both the allergens is associated with HLA-DR3.
Isolation and partial characterization of Alzheimer neurofibrillary tangles
International Nuclear Information System (INIS)
Goni, F.; Alvarez, F.; Gorevic, P.D.; Pons-Estel, F.
1986-01-01
Neurofibrillary tangles (NFT) were isolated from cerebral cortex of three cases of Alzheimer's disease (AD) by SDS-βME treatment followed by sucrose gradient ultracentrifugation. This material was predominantly NFT by electron microscopy and was excluded from all pore-sized polyacrylamide gels. It remained insoluble in strong acid and basic conditions, chaotropic and reducing agents. It resisted digestion by trypsin, chymotrypsin, subtilisin, urea-pepsin, collagenase, pronase, hyaluronidase, lipases and phospholipases but yielded a consistent amino acid analysis showing the presence of cysteine and methionine, more than 20% hydrophobic residues and 12% basic residues. Subjected to automated Edman degradation presented a non-reactive amino terminus. Under electron microscopy NFT appeared to be composed mainly by single and double filaments. Single filaments can turn and intertwine with themselves to make the regular arrangement of the double filaments. Purified NFT have been used to raise high titered polyclonal antisera for immunohistological studies. It specifically reacted with isolated NFT, affected neurons in cases of AD, aging brains, postencephalitic Parkinson's disease, Down's syndrome and dementia pugilistica but no reaction was observed with normal brain, cerebrovascular amyloid angiopathy, or the amyloid core from neuritic plaques
Conlon, J M; Davis, M S; Falkmer, S; Thim, L
1987-11-02
The primary structures of three peptides from extracts from the pancreatic islets of the daddy sculpin (Cottus scorpius) and three analogous peptides from the islets of the flounder (Platichthys flesus), two species of teleostean fish, have been determined by automated Edman degradation. The structures of the flounder peptides were confirmed by fast-atom bombardment mass spectrometry. The peptides show strong homology to residues (49-60), (63-96) and (98-125) of the predicted sequence of preprosomatostatin II from the anglerfish (Lophius americanus). The amino acid sequences of the peptides suggest that, in the sculpin, prosomatostatin II is cleaved at a dibasic amino acid residue processing site (corresponding to Lys61-Arg62 in anglerfish preprosomatostatin II). The resulting fragments are further cleaved at monobasic residue processing sites (corresponding to Arg48 and Arg97 in anglerfish preprosomatostatin II). In the flounder the same dibasic residue processing site is utilised but cleavage at different monobasic sites takes place (corresponding to Arg50 and Arg97 in anglerfish preprosomatostatin II). A peptide identical to mammalian somatostatin-14 was also isolated from the islets of both species and is presumed to represent a cleavage product of prosomatostatin I.
International Nuclear Information System (INIS)
James Graham, Robert Leslie; Graham, Ciaren; McClean, Stephen; Chen, Tianbao; O'Rourke, Martin; Hirst, David; Theakston, David; Shaw, Chris
2005-01-01
A novel undecapeptide has been isolated and structurally characterized from the venoms of three species of New World pit vipers from the subfamily, Crotalinae. These include the Mexican moccasin (Agkistrodon bilineatus), the prairie rattlesnake (Crotalus viridis viridis), and the South American bushmaster (Lachesis muta). The peptide was purified from all three venoms using a combination of gel permeation chromatography and reverse-phase HPLC. Automated Edman degradation sequencing and MALDI-TOF mass spectrometry established its peptide primary structure as: Thr-Pro-Pro-Ala-Gly-Pro-Asp-Val-Gly-Pro-Arg-OH, with a non-protonated molecular mass of 1063.18 Da. A synthetic replicate of the peptide was found to be an antagonist of bradykinin action at the rat vascular B2 receptor. This is the first bradykinin inhibitory peptide isolated from snake venom. Database searching revealed the peptide to be highly structurally related (10/11 residues) with a domain residing between the bradykinin-potentiating peptide and C-type natriuretic peptide domains of a recently cloned precursor from tropical rattlesnake (Crotalus durissus terrificus) venom gland. BIP thus represents a novel biological entity from snake venom
Automation of 3D cell culture using chemically defined hydrogels.
Rimann, Markus; Angres, Brigitte; Patocchi-Tenzer, Isabel; Braum, Susanne; Graf-Hausner, Ursula
2014-04-01
Drug development relies on high-throughput screening involving cell-based assays. Most of the assays are still based on cells grown in monolayer rather than in three-dimensional (3D) formats, although cells behave more in vivo-like in 3D. To exemplify the adoption of 3D techniques in drug development, this project investigated the automation of a hydrogel-based 3D cell culture system using a liquid-handling robot. The hydrogel technology used offers high flexibility of gel design due to a modular composition of a polymer network and bioactive components. The cell inert degradation of the gel at the end of the culture period guaranteed the harmless isolation of live cells for further downstream processing. Human colon carcinoma cells HCT-116 were encapsulated and grown in these dextran-based hydrogels, thereby forming 3D multicellular spheroids. Viability and DNA content of the cells were shown to be similar in automated and manually produced hydrogels. Furthermore, cell treatment with toxic Taxol concentrations (100 nM) had the same effect on HCT-116 cell viability in manually and automated hydrogel preparations. Finally, a fully automated dose-response curve with the reference compound Taxol showed the potential of this hydrogel-based 3D cell culture system in advanced drug development.
The effect of varying levels of vehicle automation on drivers' lane changing behaviour.
Madigan, Ruth; Louw, Tyron; Merat, Natasha
2018-01-01
Much of the Human Factors research into vehicle automation has focused on driver responses to critical scenarios where a crash might occur. However, there is less knowledge about the effects of vehicle automation on drivers' behaviour during non-critical take-over situations, such as driver-initiated lane-changing or overtaking. The current driving simulator study, conducted as part of the EC-funded AdaptIVe project, addresses this issue. It uses a within-subjects design to compare drivers' lane-changing behaviour in conventional manual driving, partially automated driving (PAD) and conditionally automated driving (CAD). In PAD, drivers were required to re-take control from an automated driving system in order to overtake a slow moving vehicle, while in CAD, the driver used the indicator lever to initiate a system-performed overtaking manoeuvre. Results showed that while drivers' acceptance of both the PAD and CAD systems was high, they generally preferred CAD. A comparison of overtaking positions showed that drivers initiated overtaking manoeuvres slightly later in PAD than in manual driving or CAD. In addition, when compared to conventional driving, drivers had higher deviations in lane positioning and speed, along with higher lateral accelerations during lane changes following PAD. These results indicate that even in situations which are not time-critical, drivers' vehicle control after automation is degraded compared to conventional driving.
The effect of varying levels of vehicle automation on drivers’ lane changing behaviour
Louw, Tyron; Merat, Natasha
2018-01-01
Much of the Human Factors research into vehicle automation has focused on driver responses to critical scenarios where a crash might occur. However, there is less knowledge about the effects of vehicle automation on drivers’ behaviour during non-critical take-over situations, such as driver-initiated lane-changing or overtaking. The current driving simulator study, conducted as part of the EC-funded AdaptIVe project, addresses this issue. It uses a within-subjects design to compare drivers’ lane-changing behaviour in conventional manual driving, partially automated driving (PAD) and conditionally automated driving (CAD). In PAD, drivers were required to re-take control from an automated driving system in order to overtake a slow moving vehicle, while in CAD, the driver used the indicator lever to initiate a system-performed overtaking manoeuvre. Results showed that while drivers’ acceptance of both the PAD and CAD systems was high, they generally preferred CAD. A comparison of overtaking positions showed that drivers initiated overtaking manoeuvres slightly later in PAD than in manual driving or CAD. In addition, when compared to conventional driving, drivers had higher deviations in lane positioning and speed, along with higher lateral accelerations during lane changes following PAD. These results indicate that even in situations which are not time-critical, drivers’ vehicle control after automation is degraded compared to conventional driving. PMID:29466402
The effect of varying levels of vehicle automation on drivers' lane changing behaviour.
Directory of Open Access Journals (Sweden)
Ruth Madigan
Full Text Available Much of the Human Factors research into vehicle automation has focused on driver responses to critical scenarios where a crash might occur. However, there is less knowledge about the effects of vehicle automation on drivers' behaviour during non-critical take-over situations, such as driver-initiated lane-changing or overtaking. The current driving simulator study, conducted as part of the EC-funded AdaptIVe project, addresses this issue. It uses a within-subjects design to compare drivers' lane-changing behaviour in conventional manual driving, partially automated driving (PAD and conditionally automated driving (CAD. In PAD, drivers were required to re-take control from an automated driving system in order to overtake a slow moving vehicle, while in CAD, the driver used the indicator lever to initiate a system-performed overtaking manoeuvre. Results showed that while drivers' acceptance of both the PAD and CAD systems was high, they generally preferred CAD. A comparison of overtaking positions showed that drivers initiated overtaking manoeuvres slightly later in PAD than in manual driving or CAD. In addition, when compared to conventional driving, drivers had higher deviations in lane positioning and speed, along with higher lateral accelerations during lane changes following PAD. These results indicate that even in situations which are not time-critical, drivers' vehicle control after automation is degraded compared to conventional driving.
Produksi, isolasi dan karakterisasi enzim dekstranase dari Arthrobacter sp. B7
Directory of Open Access Journals (Sweden)
Afaf Baktir
2012-02-01
Full Text Available Dextranase enzyme has been purified and characterized from Arthrobacter sp. B7. This enzyme was purified from the culture supernatant of Arthrobacter sp. B7 by procedure of native PAGE. The molecular size of the enzyme was estimated 72,5 kDa by SDSPAGE. The N-terminal amino acid sequence of this enzyme determined using Edman degradation techniques were APVTADVGNLHT. SDS-PAGE and native-PAGE analysis revealed that the enzyme molecule consisted of one sub-unit.
Improving the driver-automation interaction: an approach using automation uncertainty.
Beller, Johannes; Heesen, Matthias; Vollrath, Mark
2013-12-01
The aim of this study was to evaluate whether communicating automation uncertainty improves the driver-automation interaction. A false system understanding of infallibility may provoke automation misuse and can lead to severe consequences in case of automation failure. The presentation of automation uncertainty may prevent this false system understanding and, as was shown by previous studies, may have numerous benefits. Few studies, however, have clearly shown the potential of communicating uncertainty information in driving. The current study fills this gap. We conducted a driving simulator experiment, varying the presented uncertainty information between participants (no uncertainty information vs. uncertainty information) and the automation reliability (high vs.low) within participants. Participants interacted with a highly automated driving system while engaging in secondary tasks and were required to cooperate with the automation to drive safely. Quantile regressions and multilevel modeling showed that the presentation of uncertainty information increases the time to collision in the case of automation failure. Furthermore, the data indicated improved situation awareness and better knowledge of fallibility for the experimental group. Consequently, the automation with the uncertainty symbol received higher trust ratings and increased acceptance. The presentation of automation uncertaintythrough a symbol improves overall driver-automation cooperation. Most automated systems in driving could benefit from displaying reliability information. This display might improve the acceptance of fallible systems and further enhances driver-automation cooperation.
Dundar, Halil; Brede, Dag A.; La Rosa, Sabina Leanti; El-Gendy, Ahmed Osama; Diep, Dzung B.; Nes, Ingolf F.
2015-01-01
A novel antimicrobial peptide designated enterocin O16 was purified from Enterococcus faecalis. Mass spectrometry showed a monoisotopic mass of 7,231 Da, and N-terminal Edman degradation identified a 29-amino-acid sequence corresponding to residues 90 to 119 of the EF_1097 protein. Bioinformatic analysis showed that enterocin O16 is composed of the 68 most C-terminal residues of the EF_1097 protein. Introduction of an in-frame isogenic deletion in the ef1097 gene abolished the production of e...
Structure of chymotrypsin variant B from Atlantic cod, Gadus morhua
DEFF Research Database (Denmark)
Leth-Larsen, Rikke; Asgeirsson, B; Thórólfsson, M
1996-01-01
The amino-acid sequence of chymotrypsin variant B isolated from the pyloric caeca of Atlantic cod has been elucidated. The characterization of the primary structure is based on N-terminal Edman degradation and mass spectrometry of the native protein and enzymatically derived peptides. Chymotrypsi...... autolysis sites, cod variant B only contains a single autolysis site. The three-dimensional structures of the A- and B-variants of cod has been modelled on the known crystal structure of bovine alpha-chymotrypsin showing almost superimposable structures....
International Nuclear Information System (INIS)
1987-03-01
This book indicates method of building of automation plan, design of automation facilities, automation and CHIP process like basics of cutting, NC processing machine and CHIP handling, automation unit, such as drilling unit, tapping unit, boring unit, milling unit and slide unit, application of oil pressure on characteristics and basic oil pressure circuit, application of pneumatic, automation kinds and application of process, assembly, transportation, automatic machine and factory automation.
Shively, Jay
2017-01-01
A significant level of debate and confusion has surrounded the meaning of the terms autonomy and automation. Automation is a multi-dimensional concept, and we propose that Remotely Piloted Aircraft Systems (RPAS) automation should be described with reference to the specific system and task that has been automated, the context in which the automation functions, and other relevant dimensions. In this paper, we present definitions of automation, pilot in the loop, pilot on the loop and pilot out of the loop. We further propose that in future, the International Civil Aviation Organization (ICAO) RPAS Panel avoids the use of the terms autonomy and autonomous when referring to automated systems on board RPA. Work Group 7 proposes to develop, in consultation with other workgroups, a taxonomy of Levels of Automation for RPAS.
Toward automated interpretation of integrated information: Managing "big data" for NDE
Gregory, Elizabeth; Lesthaeghe, Tyler; Holland, Stephen
2015-03-01
Large scale automation of NDE processes is rapidly maturing, thanks to recent improvements in robotics and the rapid growth of computer power over the last twenty years. It is fairly straightforward to automate NDE data collection itself, but the process of NDE remains largely manual. We will discuss three threads of technological needs that must be addressed before we are able to perform automated NDE. Spatial context, the first thread, means that each NDE measurement taken is accompanied by metadata that locates the measurement with respect to the 3D physical geometry of the specimen. In this way, the geometry of the specimen acts as a database key. Data context, the second thread, means that we record why the data was taken and how it was measured in addition to the NDE data itself. We will present our software tool that helps users interact with data in context, Databrowse. Condition estimation, the third thread, is maintaining the best possible knowledge of the condition (serviceability, degradation, etc.) of an object or part. In the NDE context, we can prospectively use Bayes' Theorem to integrate the data from each new NDE measurement with prior knowledge. These tools, combined with robotic measurements and automated defect analysis, will provide the information needed to make high-level life predictions and focus NDE measurements where they are needed most.
Ahmed, Zeeshan
2010-01-01
In this paper I briefly discuss the importance of home automation system. Going in to the details I briefly present a real time designed and implemented software and hardware oriented house automation research project, capable of automating house's electricity and providing a security system to detect the presence of unexpected behavior.
Development of an automated vehicle stop system for cardiac emergencies
Directory of Open Access Journals (Sweden)
Tung T. Nguyen
2017-06-01
Full Text Available This paper describes the concept and configuration of a novel automated safety vehicle stop system, and a future prospect of the study. Intrinsic sudden death may cause traffic accident since such accidents sometimes involve not only the driver but also other traffic users such as passengers and pedestrians. Cardiovascular disease (CVD is considered as a serious driving risk factor. The pain and others effects of cardiac events degrade driver’s performance, and CVD causes ischemia brought by the CVD induces incapacity of driving. In the automated safety vehicle stop system, which our research group has developed, steer-sensors collects bio-signals and a camera captures the driver’s posture to monitor driver’s incapability. When the driver loses his or her driving capability, the system takes over the maneuver of the vehicle and automatically drives to a safety spot by observing the traffic environment. An emergency scenario was used to demonstrate the system verifying its potential.
International Nuclear Information System (INIS)
Lee, Seung Min; Kim, Jong Hyun; Seong, Poong Hyun
2014-01-01
Highlights: • We propose an estimation method of the automation rate by taking the advantages of automation as the estimation measures. • We conduct the experiments to examine the validity of the suggested method. • The higher the cognitive automation rate is, the greater the decreased rate of the working time will be. • The usefulness of the suggested estimation method is proved by statistical analyses. - Abstract: Since automation was introduced in various industrial fields, the concept of the automation rate has been used to indicate the inclusion proportion of automation among all work processes or facilities. Expressions of the inclusion proportion of automation are predictable, as is the ability to express the degree of the enhancement of human performance. However, many researchers have found that a high automation rate does not guarantee high performance. Therefore, to reflect the effects of automation on human performance, this paper proposes a new estimation method of the automation rate that considers the effects of automation on human operators in nuclear power plants (NPPs). Automation in NPPs can be divided into two types: system automation and cognitive automation. Some general descriptions and characteristics of each type of automation are provided, and the advantages of automation are investigated. The advantages of each type of automation are used as measures of the estimation method of the automation rate. One advantage was found to be a reduction in the number of tasks, and another was a reduction in human cognitive task loads. The system and the cognitive automation rate were proposed as quantitative measures by taking advantage of the aforementioned benefits. To quantify the required human cognitive task loads and thus suggest the cognitive automation rate, Conant’s information-theory-based model was applied. The validity of the suggested method, especially as regards the cognitive automation rate, was proven by conducting
DEFF Research Database (Denmark)
Hacke, Peter; Spataru, Sergiu
We propose a method for increasing the frequency of data collection and reducing the time and cost of accelerated lifetime testing of photovoltaic modules undergoing potential-induced degradation (PID). This consists of in-situ measurements of dark current-voltage curves of the modules at elevate...
Angiotensin I-Converting Enzyme Inhibitor Derived from Cross-Linked Oyster Protein
Directory of Open Access Journals (Sweden)
Cheng-Liang Xie
2014-01-01
Full Text Available Following cross-linking by microbial transglutaminase, modified oyster proteins were hydrolyzed to improve inhibitory activity against angiotensin-converting enzyme (ACE inhibitory activity with the use of a single protease, or a combination of six proteases. The oyster hydrolysate with the lowest 50% ACE inhibitory concentration (IC50 of 0.40 mg/mL was obtained by two-step hydrolysis of the cross-linked oyster protein using Protamex and Neutrase. Five ACE inhibitory peptides were purified from the oyster hydrolysate using a multistep chromatographic procedure comprised of ion-exchange, size exclusion, and reversed-phase liquid chromatography. Their sequences were identified as TAY, VK, KY, FYN, and YA, using automated Edman degradation and mass spectrometry. These peptides were synthesized, and their IC50 values were measured to be 16.7, 29.0, 51.5, 68.2, and 93.9 μM, respectively. Toxicity of the peptides on the HepG2 cell line was not detected. The oyster hydrolysate also significantly decreased the systolic blood pressure of spontaneously hypertensive rats (SHR. The antihypertensive effect of the oyster hydrolysate on SHR was rapid and long-lasting, compared to commercially obtained sardine hydrolysate. These results suggest that the oyster hydrolysate could be a source of effective nutraceuticals against hypertension.
Fully Automated Trimethylsilyl (TMS) Derivatisation Protocol for Metabolite Profiling by GC-MS.
Zarate, Erica; Boyle, Veronica; Rupprecht, Udo; Green, Saras; Villas-Boas, Silas G; Baker, Philip; Pinu, Farhana R
2016-12-29
Gas Chromatography-Mass Spectrometry (GC-MS) has long been used for metabolite profiling of a wide range of biological samples. Many derivatisation protocols are already available and among these, trimethylsilyl (TMS) derivatisation is one of the most widely used in metabolomics. However, most TMS methods rely on off-line derivatisation prior to GC-MS analysis. In the case of manual off-line TMS derivatisation, the derivative created is unstable, so reduction in recoveries occurs over time. Thus, derivatisation is carried out in small batches. Here, we present a fully automated TMS derivatisation protocol using robotic autosamplers and we also evaluate a commercial software, Maestro available from Gerstel GmbH. Because of automation, there was no waiting time of derivatised samples on the autosamplers, thus reducing degradation of unstable metabolites. Moreover, this method allowed us to overlap samples and improved throughputs. We compared data obtained from both manual and automated TMS methods performed on three different matrices, including standard mix, wine, and plasma samples. The automated TMS method showed better reproducibility and higher peak intensity for most of the identified metabolites than the manual derivatisation method. We also validated the automated method using 114 quality control plasma samples. Additionally, we showed that this online method was highly reproducible for most of the metabolites detected and identified (RSD TMS method has been applied to analyse a large number of complex plasma samples. Furthermore, we found that this method was highly applicable for routine metabolite profiling (both targeted and untargeted) in any metabolomics laboratory.
International Nuclear Information System (INIS)
Moser, D.R.
1986-01-01
Process automation technology has been pursued in the chemical processing industries and to a very limited extent in nuclear fuel reprocessing. Its effective use has been restricted in the past by the lack of diverse and reliable process instrumentation and the unavailability of sophisticated software designed for process control. The Integrated Equipment Test (IET) facility was developed by the Consolidated Fuel Reprocessing Program (CFRP) in part to demonstrate new concepts for control of advanced nuclear fuel reprocessing plants. A demonstration of fuel reprocessing equipment automation using advanced instrumentation and a modern, microprocessor-based control system is nearing completion in the facility. This facility provides for the synergistic testing of all chemical process features of a prototypical fuel reprocessing plant that can be attained with unirradiated uranium-bearing feed materials. The unique equipment and mission of the IET facility make it an ideal test bed for automation studies. This effort will provide for the demonstration of the plant automation concept and for the development of techniques for similar applications in a full-scale plant. A set of preliminary recommendations for implementing process automation has been compiled. Some of these concepts are not generally recognized or accepted. The automation work now under way in the IET facility should be useful to others in helping avoid costly mistakes because of the underutilization or misapplication of process automation. 6 figs
Blom, H; Katla, T; Holck, A; Sletten, K; Axelsson, L; Holo, H
1999-07-01
Leuconostoc MF215B was found to produce a two-peptide bacteriocin referred to as leucocin H. The two peptides were termed leucocin Halpha and leucocin Hbeta. When acting together, they inhibit, among others, Listeria monocytogenes, Bacillus cereus, and Clostridium perfringens. Production of leucocin H in growth medium takes place at temperatures down to 6 degrees C and at pH below 7. The highest activity of leucocin H in growth medium was demonstrated in the late exponential growth phase. The bacteriocin was purified by precipitation with ammonium sulfate, ion-exchange (SP Sepharose) and reverse phase chromatography. Upon purification, specific activity increased 10(5)-fold, and the final specific activity was 2 x 10(7) BU/OD280. Amino acid composition analyses of leucocin Halpha and leucocin Hbeta indicated that both peptides consisted of around 40 amino acid residues. Their N-termini were blocked for Edman degradation, and the methionin residues of leucocin Hbeta did not respond to Cyanogen Bromide (CNBr) cleavage. Absorbance at 280 nm indicated the presence of tryptophan residues and tryptophan-fracturing opened for partial sequencing by Edman degradation. From leucocin Halpha, the sequence of 20 amino acids was obtained; from leucocin Hbeta the sequence of 28 amino acid residues was obtained. No sequence homology to other known bacteriocins could be demonstrated. It also appeared that the two peptides themselves shared little or no sequence homology. The presence of soy oil did not affect the activity of leucocin H in agar.
Fully Automated Trimethylsilyl (TMS Derivatisation Protocol for Metabolite Profiling by GC-MS
Directory of Open Access Journals (Sweden)
Erica Zarate
2016-12-01
Full Text Available Gas Chromatography-Mass Spectrometry (GC-MS has long been used for metabolite profiling of a wide range of biological samples. Many derivatisation protocols are already available and among these, trimethylsilyl (TMS derivatisation is one of the most widely used in metabolomics. However, most TMS methods rely on off-line derivatisation prior to GC-MS analysis. In the case of manual off-line TMS derivatisation, the derivative created is unstable, so reduction in recoveries occurs over time. Thus, derivatisation is carried out in small batches. Here, we present a fully automated TMS derivatisation protocol using robotic autosamplers and we also evaluate a commercial software, Maestro available from Gerstel GmbH. Because of automation, there was no waiting time of derivatised samples on the autosamplers, thus reducing degradation of unstable metabolites. Moreover, this method allowed us to overlap samples and improved throughputs. We compared data obtained from both manual and automated TMS methods performed on three different matrices, including standard mix, wine, and plasma samples. The automated TMS method showed better reproducibility and higher peak intensity for most of the identified metabolites than the manual derivatisation method. We also validated the automated method using 114 quality control plasma samples. Additionally, we showed that this online method was highly reproducible for most of the metabolites detected and identified (RSD < 20 and specifically achieved excellent results for sugars, sugar alcohols, and some organic acids. To the very best of our knowledge, this is the first time that the automated TMS method has been applied to analyse a large number of complex plasma samples. Furthermore, we found that this method was highly applicable for routine metabolite profiling (both targeted and untargeted in any metabolomics laboratory.
Greenspoon, S A; Sykes, K L V; Ban, J D; Pollard, A; Baisden, M; Farr, M; Graham, N; Collins, B L; Green, M M; Christenson, C C
2006-12-20
Human genome, pharmaceutical and research laboratories have long enjoyed the application of robotics to performing repetitive laboratory tasks. However, the utilization of robotics in forensic laboratories for processing casework samples is relatively new and poses particular challenges. Since the quantity and quality (a mixture versus a single source sample, the level of degradation, the presence of PCR inhibitors) of the DNA contained within a casework sample is unknown, particular attention must be paid to procedural susceptibility to contamination, as well as DNA yield, especially as it pertains to samples with little biological material. The Virginia Department of Forensic Science (VDFS) has successfully automated forensic casework DNA extraction utilizing the DNA IQ(trade mark) System in conjunction with the Biomek 2000 Automation Workstation. Human DNA quantitation is also performed in a near complete automated fashion utilizing the AluQuant Human DNA Quantitation System and the Biomek 2000 Automation Workstation. Recently, the PCR setup for casework samples has been automated, employing the Biomek 2000 Automation Workstation and Normalization Wizard, Genetic Identity version, which utilizes the quantitation data, imported into the software, to create a customized automated method for DNA dilution, unique to that plate of DNA samples. The PCR Setup software method, used in conjunction with the Normalization Wizard method and written for the Biomek 2000, functions to mix the diluted DNA samples, transfer the PCR master mix, and transfer the diluted DNA samples to PCR amplification tubes. Once the process is complete, the DNA extracts, still on the deck of the robot in PCR amplification strip tubes, are transferred to pre-labeled 1.5 mL tubes for long-term storage using an automated method. The automation of these steps in the process of forensic DNA casework analysis has been accomplished by performing extensive optimization, validation and testing of the
An automation model of Effluent Treatment Plant
Directory of Open Access Journals (Sweden)
Luiz Alberto Oliveira Lima Roque
2012-07-01
Full Text Available Population growth and intensification of industrial activities have increased the deterioration of natural resources. Industrial, hospital and residential wastes are dumped directly into landfills without processing, polluting soils. This action will have consequences later, because the liquid substance resulting from the putrefaction of organic material plows into the soil to reach water bodies. Cities arise without planning, industrial and household wastes are discharged into rivers, lakes and oceans without proper treatment, affecting water resources. It is well known that in the next century there will be fierce competition for fresh water on the planet, probably due to the scarcity of it. Demographic expansion has occurred without proper health planning, degrading oceans, lakes and rivers. Thus, a large percentage of world population suffers from diseases related to water pollution. Accordingly, it can be concluded that sewage treatment is essential to human survival, to preserve rivers, lakes and oceans. An Effluent Treatment Plant (ETP treats wastewater to reduce its pollution to acceptable levels before sending them to the oceans or rivers. To automate the operation of an ETP, motors, sensors and logic blocks, timers and counters are needed. These functions are achieved with programmable logic controllers (PLC and Supervisory Systems. The Ladder language is used to program controllers and is a pillar of the Automation and Control Engineering. The supervisory systems allow process information to be monitored, while the PLC are responsible for control and data acquisition. In the age we live in, process automation is used in an increasing scale in order to provide higher quality, raise productivity and improve the proposed activities. Therefore, an automatic ETP will improve performance and efficiency to handle large volumes of sewage. Considering the growing importance of environmental awareness with special emphasis
Automated analysis of organic particles using cluster SIMS
Energy Technology Data Exchange (ETDEWEB)
Gillen, Greg; Zeissler, Cindy; Mahoney, Christine; Lindstrom, Abigail; Fletcher, Robert; Chi, Peter; Verkouteren, Jennifer; Bright, David; Lareau, Richard T.; Boldman, Mike
2004-06-15
Cluster primary ion bombardment combined with secondary ion imaging is used on an ion microscope secondary ion mass spectrometer for the spatially resolved analysis of organic particles on various surfaces. Compared to the use of monoatomic primary ion beam bombardment, the use of a cluster primary ion beam (SF{sub 5}{sup +} or C{sub 8}{sup -}) provides significant improvement in molecular ion yields and a reduction in beam-induced degradation of the analyte molecules. These characteristics of cluster bombardment, along with automated sample stage control and custom image analysis software are utilized to rapidly characterize the spatial distribution of trace explosive particles, narcotics and inkjet-printed microarrays on a variety of surfaces.
Sosik, H. M.; Olson, R. J.; Brownlee, E.; Brosnahan, M.; Crockford, E. T.; Peacock, E.; Shalapyonok, A.
2016-12-01
Imaging FlowCytobot (IFCB) was developed to fill a need for automated identification and monitoring of nano- and microplankton, especially phytoplankton in the size range 10 200 micrometer, which are important in coastal blooms (including harmful algal blooms). IFCB uses a combination of flow cytometric and video technology to capture high resolution (1 micrometer) images of suspended particles. This proven, now commercially available, submersible instrument technology has been deployed in fixed time series locations for extended periods (months to years) and in shipboard laboratories where underway water is automatically analyzed during surveys. Building from these successes, we have now constructed and evaluated three new prototype IFCB designs that extend measurement and deployment capabilities. To improve cell counting statistics without degrading image quality, a high throughput version (IFCB-HT) incorporates in-flow acoustic focusing to non-disruptively pre-concentrate cells before the measurement area of the flow cell. To extend imaging to all heterotrophic cells (even those that do not exhibit chlorophyll fluorescence), Staining IFCB (IFCB-S) incorporates automated addition of a live-cell fluorescent stain (fluorescein diacetate) to samples before analysis. A horizontally-oriented IFCB-AV design addresses the need for spatial surveying from surface autonomous vehicles, including design features that reliably eliminate air bubbles and mitigate wave motion impacts. Laboratory evaluation and test deployments in waters near Woods Hole show the efficacy of each of these enhanced IFCB designs.
Lean automation development : applying lean principles to the automation development process
Granlund, Anna; Wiktorsson, Magnus; Grahn, Sten; Friedler, Niklas
2014-01-01
By a broad empirical study it is indicated that automation development show potential of improvement. In the paper, 13 lean product development principles are contrasted to the automation development process and it is suggested why and how these principles can facilitate, support and improve the automation development process. The paper summarises a description of what characterises a lean automation development process and what consequences it entails. Main differences compared to current pr...
Purcell, Royal
1988-01-01
Discusses the concept of a paperless society and the current situation in library automation. Various applications of automation and telecommunications are addressed, and future library automation is considered. Automation at the Monroe County Public Library in Bloomington, Indiana, is described as an example. (MES)
Automated Groundwater Screening
International Nuclear Information System (INIS)
Taylor, Glenn A.; Collard, Leonard B.
2005-01-01
The Automated Intruder Analysis has been extended to include an Automated Ground Water Screening option. This option screens 825 radionuclides while rigorously applying the National Council on Radiation Protection (NCRP) methodology. An extension to that methodology is presented to give a more realistic screening factor for those radionuclides which have significant daughters. The extension has the promise of reducing the number of radionuclides which must be tracked by the customer. By combining the Automated Intruder Analysis with the Automated Groundwater Screening a consistent set of assumptions and databases is used. A method is proposed to eliminate trigger values by performing rigorous calculation of the screening factor thereby reducing the number of radionuclides sent to further analysis. Using the same problem definitions as in previous groundwater screenings, the automated groundwater screening found one additional nuclide, Ge-68, which failed the screening. It also found that 18 of the 57 radionuclides contained in NCRP Table 3.1 failed the screening. This report describes the automated groundwater screening computer application
Caferra, Ricardo; Peltier, Nicholas
2004-01-01
This is the first book on automated model building, a discipline of automated deduction that is of growing importance Although models and their construction are important per se, automated model building has appeared as a natural enrichment of automated deduction, especially in the attempt to capture the human way of reasoning The book provides an historical overview of the field of automated deduction, and presents the foundations of different existing approaches to model construction, in particular those developed by the authors Finite and infinite model building techniques are presented The main emphasis is on calculi-based methods, and relevant practical results are provided The book is of interest to researchers and graduate students in computer science, computational logic and artificial intelligence It can also be used as a textbook in advanced undergraduate courses
2013-08-29
... Customs Automation Program (NCAP) Tests Concerning Automated Commercial Environment (ACE) Document Image... National Customs Automation Program (NCAP) tests concerning document imaging, known as the Document Image... the National Customs Automation Program (NCAP) tests concerning document imaging, known as the...
Automated analysis of invadopodia dynamics in live cells
Directory of Open Access Journals (Sweden)
Matthew E. Berginski
2014-07-01
Full Text Available Multiple cell types form specialized protein complexes that are used by the cell to actively degrade the surrounding extracellular matrix. These structures are called podosomes or invadopodia and collectively referred to as invadosomes. Due to their potential importance in both healthy physiology as well as in pathological conditions such as cancer, the characterization of these structures has been of increasing interest. Following early descriptions of invadopodia, assays were developed which labelled the matrix underneath metastatic cancer cells allowing for the assessment of invadopodia activity in motile cells. However, characterization of invadopodia using these methods has traditionally been done manually with time-consuming and potentially biased quantification methods, limiting the number of experiments and the quantity of data that can be analysed. We have developed a system to automate the segmentation, tracking and quantification of invadopodia in time-lapse fluorescence image sets at both the single invadopodia level and whole cell level. We rigorously tested the ability of the method to detect changes in invadopodia formation and dynamics through the use of well-characterized small molecule inhibitors, with known effects on invadopodia. Our results demonstrate the ability of this analysis method to quantify changes in invadopodia formation from live cell imaging data in a high throughput, automated manner.
International Nuclear Information System (INIS)
Lee, Seung Min; Kim, Jong Hyun; Kim, Man Cheol; Seong, Poong Hyun
2016-01-01
Highlights: • We propose an appropriate automation rate that enables the best human performance. • We analyze the shortest working time considering Situation Awareness Recovery (SAR). • The optimized automation rate is estimated by integrating the automation and ostracism rate estimation methods. • The process to derive the optimized automation rate is demonstrated through case studies. - Abstract: Automation has been introduced in various industries, including the nuclear field, because it is commonly believed that automation promises greater efficiency, lower workloads, and fewer operator errors through reducing operator errors and enhancing operator and system performance. However, the excessive introduction of automation has deteriorated operator performance due to the side effects of automation, which are referred to as Out-of-the-Loop (OOTL), and this is critical issue that must be resolved. Thus, in order to determine the optimal level of automation introduction that assures the best human operator performance, a quantitative method of optimizing the automation is proposed in this paper. In order to propose the optimization method for determining appropriate automation levels that enable the best human performance, the automation rate and ostracism rate, which are estimation methods that quantitatively analyze the positive and negative effects of automation, respectively, are integrated. The integration was conducted in order to derive the shortest working time through considering the concept of situation awareness recovery (SAR), which states that the automation rate with the shortest working time assures the best human performance. The process to derive the optimized automation rate is demonstrated through an emergency operation scenario-based case study. In this case study, four types of procedures are assumed through redesigning the original emergency operating procedure according to the introduced automation and ostracism levels. Using the
World-wide distribution automation systems
International Nuclear Information System (INIS)
Devaney, T.M.
1994-01-01
A worldwide power distribution automation system is outlined. Distribution automation is defined and the status of utility automation is discussed. Other topics discussed include a distribution management system, substation feeder, and customer functions, potential benefits, automation costs, planning and engineering considerations, automation trends, databases, system operation, computer modeling of system, and distribution management systems
WIDAFELS flexible automation systems
International Nuclear Information System (INIS)
Shende, P.S.; Chander, K.P.; Ramadas, P.
1990-01-01
After discussing the various aspects of automation, some typical examples of various levels of automation are given. One of the examples is of automated production line for ceramic fuel pellets. (M.G.B.)
Automation in Clinical Microbiology
Ledeboer, Nathan A.
2013-01-01
Historically, the trend toward automation in clinical pathology laboratories has largely bypassed the clinical microbiology laboratory. In this article, we review the historical impediments to automation in the microbiology laboratory and offer insight into the reasons why we believe that we are on the cusp of a dramatic change that will sweep a wave of automation into clinical microbiology laboratories. We review the currently available specimen-processing instruments as well as the total laboratory automation solutions. Lastly, we outline the types of studies that will need to be performed to fully assess the benefits of automation in microbiology laboratories. PMID:23515547
Casis, E; Garrido, A; Uranga, B; Vives, A; Zufiaurre, C
2001-01-01
Total laboratory automation (TLA) can be substituted in mid-size laboratories by a computer sample workflow control (virtual automation). Such a solution has been implemented in our laboratory using PSM, software developed in cooperation with Roche Diagnostics (Barcelona, Spain), to this purpose. This software is connected to the online analyzers and to the laboratory information system and is able to control and direct the samples working as an intermediate station. The only difference with TLA is the replacement of transport belts by personnel of the laboratory. The implementation of this virtual automation system has allowed us the achievement of the main advantages of TLA: workload increase (64%) with reduction in the cost per test (43%), significant reduction in the number of biochemistry primary tubes (from 8 to 2), less aliquoting (from 600 to 100 samples/day), automation of functional testing, drastic reduction of preanalytical errors (from 11.7 to 0.4% of the tubes) and better total response time for both inpatients (from up to 48 hours to up to 4 hours) and outpatients (from up to 10 days to up to 48 hours). As an additional advantage, virtual automation could be implemented without hardware investment and significant headcount reduction (15% in our lab).
Automation of Test Cases for Web Applications : Automation of CRM Test Cases
Seyoum, Alazar
2012-01-01
The main theme of this project was to design a test automation framework for automating web related test cases. Automating test cases designed for testing a web interface provide a means of improving a software development process by shortening the testing phase in the software development life cycle. In this project an existing AutoTester framework and iMacros test automation tools were used. CRM Test Agent was developed to integrate AutoTester to iMacros and to enable the AutoTester,...
An Automation Planning Primer.
Paynter, Marion
1988-01-01
This brief planning guide for library automation incorporates needs assessment and evaluation of options to meet those needs. A bibliography of materials on automation planning and software reviews, library software directories, and library automation journals is included. (CLB)
Automation in Immunohematology
Directory of Open Access Journals (Sweden)
Meenu Bajpai
2012-01-01
Full Text Available There have been rapid technological advances in blood banking in South Asian region over the past decade with an increasing emphasis on quality and safety of blood products. The conventional test tube technique has given way to newer techniques such as column agglutination technique, solid phase red cell adherence assay, and erythrocyte-magnetized technique. These new technologies are adaptable to automation and major manufacturers in this field have come up with semi and fully automated equipments for immunohematology tests in the blood bank. Automation improves the objectivity and reproducibility of tests. It reduces human errors in patient identification and transcription errors. Documentation and traceability of tests, reagents and processes and archiving of results is another major advantage of automation. Shifting from manual methods to automation is a major undertaking for any transfusion service to provide quality patient care with lesser turnaround time for their ever increasing workload. This article discusses the various issues involved in the process.
Department of Transportation — The Automated Budget System (ABS) automates management and planning of the Mike Monroney Aeronautical Center (MMAC) budget by providing enhanced capability to plan,...
Ball, Oliver; Robinson, Sarah; Bure, Kim; Brindley, David A; Mccall, David
2018-04-01
Phacilitate held a Special Interest Group workshop event in Edinburgh, UK, in May 2017. The event brought together leading stakeholders in the cell therapy bioprocessing field to identify present and future challenges and propose potential solutions to automation in cell therapy bioprocessing. Here, we review and summarize discussions from the event. Deep biological understanding of a product, its mechanism of action and indication pathogenesis underpin many factors relating to bioprocessing and automation. To fully exploit the opportunities of bioprocess automation, therapeutics developers must closely consider whether an automation strategy is applicable, how to design an 'automatable' bioprocess and how to implement process modifications with minimal disruption. Major decisions around bioprocess automation strategy should involve all relevant stakeholders; communication between technical and business strategy decision-makers is of particular importance. Developers should leverage automation to implement in-process testing, in turn applicable to process optimization, quality assurance (QA)/ quality control (QC), batch failure control, adaptive manufacturing and regulatory demands, but a lack of precedent and technical opportunities can complicate such efforts. Sparse standardization across product characterization, hardware components and software platforms is perceived to complicate efforts to implement automation. The use of advanced algorithmic approaches such as machine learning may have application to bioprocess and supply chain optimization. Automation can substantially de-risk the wider supply chain, including tracking and traceability, cryopreservation and thawing and logistics. The regulatory implications of automation are currently unclear because few hardware options exist and novel solutions require case-by-case validation, but automation can present attractive regulatory incentives. Copyright © 2018 International Society for Cellular Therapy
Using Automated Planning for Traffic Signals Control
Directory of Open Access Journals (Sweden)
Matija Gulić
2016-08-01
Full Text Available Solving traffic congestions represents a high priority issue in many big cities. Traditional traffic control systems are mainly based on pre-programmed, reactive and local techniques. This paper presents an autonomic system that uses automated planning techniques instead. These techniques are easily configurable and modified, and can reason about the future implications of actions that change the default traffic lights behaviour. The proposed implemented system includes some autonomic properties, since it monitors the current traffic state, detects if the system is degrading its performance, sets up new sets of goals to be achieved by the planner, triggers the planner that generates plans with control actions, and executes the selected courses of actions. The obtained results in several artificial and real world data-based simulation scenarios show that the proposed system can efficiently solve traffic congestion.
Degradable polyphosphazene/poly(alpha-hydroxyester) blends: degradation studies.
Ambrosio, Archel M A; Allcock, Harry R; Katti, Dhirendra S; Laurencin, Cato T
2002-04-01
Biomaterials based on the polymers of lactic acid and glycolic acid and their copolymers are used or studied extensively as implantable devices for drug delivery, tissue engineering and other biomedical applications. Although these polymers have shown good biocompatibility, concerns have been raised regarding their acidic degradation products, which have important implications for long-term implantable systems. Therefore, we have designed a novel biodegradable polyphosphazene/poly(alpha-hydroxyester) blend whose degradation products are less acidic than those of the poly(alpha-hydroxyester) alone. In this study, the degradation characteristics of a blend of poly(lactide-co-glycolide) (50:50 PLAGA) and poly[(50% ethyl glycinato)(50% p-methylphenoxy) phosphazene] (PPHOS-EG50) were qualitatively and quantitatively determined with comparisons made to the parent polymers. Circular matrices (14mm diameter) of the PLAGA, PPHOS-EG50 and PLAGA-PPHOS-EG50 blend were degraded in non-buffered solutions (pH 7.4). The degraded polymers were characterized for percentage mass loss and molecular weight and the degradation medium was characterized for acid released in non-buffered solutions. The amounts of neutralizing base necessary to bring about neutral pH were measured for each polymer or polymer blend during degradation. The poly(phosphazene)/poly(lactide-co-glycolide) blend required significantly less neutralizing base in order to bring about neutral solution pH during the degradation period studied. The results indicated that the blend degraded at a rate intermediate to that of the parent polymers and that the degradation products of the polyphosphazene neutralized the acidic degradation products of PLAGA. Thus, results from these in vitro degradation studies suggest that the PLAGA-PPHOS-EG50 blend may provide a viable improvement to biomaterials based on acid-releasing organic polymers.
2013-11-04
... Customs Automation Program Test Concerning Automated Commercial Environment (ACE) Cargo Release (Formerly...) plan to both rename and modify the National Customs Automation Program (NCAP) test concerning the... data elements required to obtain release for cargo transported by air. The test will now be known as...
International Nuclear Information System (INIS)
Lee, Seungmin; Seong, Poonghyun; Kim, Jonghyun
2013-01-01
Many researchers have found that a high automation rate does not guarantee high performance. Therefore, to reflect the effects of automation on human performance, a new estimation method of the automation rate that considers the effects of automation on human operators in nuclear power plants (NPPs) was suggested. These suggested measures express how much automation support human operators but it cannot express the change of human operators' workload, whether the human operators' workload is increased or decreased. Before considering automation rates, whether the adopted automation is good or bad might be estimated in advance. In this study, to estimate the appropriateness of automation according to the change of the human operators' task loads, automation-aided task loads index is suggested based on the concept of the suggested automation rate. To insure plant safety and efficiency on behalf of human operators, various automation systems have been installed in NPPs, and many works which were previously conducted by human operators can now be supported by computer-based operator aids. According to the characteristics of the automation types, the estimation method of the system automation and the cognitive automation rate were suggested. The proposed estimation method concentrates on the effects of introducing automation, so it directly express how much the automated system support human operators. Based on the suggested automation rates, the way to estimate how much the automated system can affect the human operators' cognitive task load is suggested in this study. When there is no automation, the calculated index is 1, and it means there is no change of human operators' task load
Asleep at the automated wheel-Sleepiness and fatigue during highly automated driving.
Vogelpohl, Tobias; Kühn, Matthias; Hummel, Thomas; Vollrath, Mark
2018-03-20
Due to the lack of active involvement in the driving situation and due to monotonous driving environments drivers with automation may be prone to become fatigued faster than manual drivers (e.g. Schömig et al., 2015). However, little is known about the progression of fatigue during automated driving and its effects on the ability to take back manual control after a take-over request. In this driving simulator study with Nö=ö60 drivers we used a three factorial 2ö×ö2ö×ö12 mixed design to analyze the progression (12ö×ö5ömin; within subjects) of driver fatigue in drivers with automation compared to manual drivers (between subjects). Driver fatigue was induced as either mainly sleep related or mainly task related fatigue (between subjects). Additionally, we investigated the drivers' reactions to a take-over request in a critical driving scenario to gain insights into the ability of fatigued drivers to regain manual control and situation awareness after automated driving. Drivers in the automated driving condition exhibited facial indicators of fatigue after 15 to 35ömin of driving. Manual drivers only showed similar indicators of fatigue if they suffered from a lack of sleep and then only after a longer period of driving (approx. 40ömin). Several drivers in the automated condition closed their eyes for extended periods of time. In the driving with automation condition mean automation deactivation times after a take-over request were slower for a certain percentage (about 30%) of the drivers with a lack of sleep (Mö=ö3.2; SDö=ö2.1ös) compared to the reaction times after a long drive (Mö=ö2.4; SDö=ö0.9ös). Drivers with automation also took longer than manual drivers to first glance at the speed display after a take-over request and were more likely to stay behind a braking lead vehicle instead of overtaking it. Drivers are unable to stay alert during extended periods of automated driving without non-driving related tasks. Fatigued drivers could
International Nuclear Information System (INIS)
Andresen, Gisle; Svengren, Haakan; Heimdal, Jan O.; Nilsen, Svein; Hulsund, John-Einar; Bisio, Rossella; Debroise, Xavier
2004-04-01
As advised by the procedure workshop convened in Halden in 2000, the Halden Project conducted an experiment on the effect of automation of Computerised Procedure Systems (CPS) on situation awareness and human performance. The expected outcome of the study was to provide input for guidance on CPS design, and to support the Halden Project's ongoing research on human reliability analysis. The experiment was performed in HAMMLAB using the HAMBO BWR simulator and the COPMA-III CPS. Eight crews of operators from Forsmark 3 and Oskarshamn 3 participated. Three research questions were investigated: 1) Does procedure automation create Out-Of-The-Loop (OOTL) performance problems? 2) Does procedure automation affect situation awareness? 3) Does procedure automation affect crew performance? The independent variable, 'procedure configuration', had four levels: paper procedures, manual CPS, automation with breaks, and full automation. The results showed that the operators experienced OOTL problems in full automation, but that situation awareness and crew performance (response time) were not affected. One possible explanation for this is that the operators monitored the automated procedure execution conscientiously, something which may have prevented the OOTL problems from having negative effects on situation awareness and crew performance. In a debriefing session, the operators clearly expressed their dislike for the full automation condition, but that automation with breaks could be suitable for some tasks. The main reason why the operators did not like the full automation was that they did not feel being in control. A qualitative analysis addressing factors contributing to response time delays revealed that OOTL problems did not seem to cause delays, but that some delays could be explained by the operators having problems with the freeze function of the CPS. Also other factors such as teamwork and operator tendencies were of importance. Several design implications were drawn
Energy Technology Data Exchange (ETDEWEB)
Lee, Seungmin; Seong, Poonghyun [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Kim, Jonghyun [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)
2013-05-15
Many researchers have found that a high automation rate does not guarantee high performance. Therefore, to reflect the effects of automation on human performance, a new estimation method of the automation rate that considers the effects of automation on human operators in nuclear power plants (NPPs) was suggested. These suggested measures express how much automation support human operators but it cannot express the change of human operators' workload, whether the human operators' workload is increased or decreased. Before considering automation rates, whether the adopted automation is good or bad might be estimated in advance. In this study, to estimate the appropriateness of automation according to the change of the human operators' task loads, automation-aided task loads index is suggested based on the concept of the suggested automation rate. To insure plant safety and efficiency on behalf of human operators, various automation systems have been installed in NPPs, and many works which were previously conducted by human operators can now be supported by computer-based operator aids. According to the characteristics of the automation types, the estimation method of the system automation and the cognitive automation rate were suggested. The proposed estimation method concentrates on the effects of introducing automation, so it directly express how much the automated system support human operators. Based on the suggested automation rates, the way to estimate how much the automated system can affect the human operators' cognitive task load is suggested in this study. When there is no automation, the calculated index is 1, and it means there is no change of human operators' task load.
Automation of radioimmunoassay
International Nuclear Information System (INIS)
Yamaguchi, Chisato; Yamada, Hideo; Iio, Masahiro
1974-01-01
Automation systems for measuring Australian antigen by radioimmunoassay under development were discussed. Samples were processed as follows: blood serum being dispensed by automated sampler to the test tube, and then incubated under controlled time and temperature; first counting being omitted; labelled antibody being dispensed to the serum after washing; samples being incubated and then centrifuged; radioactivities in the precipitate being counted by auto-well counter; measurements being tabulated by automated typewriter. Not only well-type counter but also position counter was studied. (Kanao, N.)
2012-08-14
... National Customs Automation Program (NCAP) test concerning the simplified entry functionality in the... DEPARTMENT OF HOMELAND SECURITY U.S. Customs and Border Protection National Customs Automation Program (NCAP) Test Concerning Automated Commercial Environment (ACE) Simplified Entry: Modification of...
Laboratory Automation and Middleware.
Riben, Michael
2015-06-01
The practice of surgical pathology is under constant pressure to deliver the highest quality of service, reduce errors, increase throughput, and decrease turnaround time while at the same time dealing with an aging workforce, increasing financial constraints, and economic uncertainty. Although not able to implement total laboratory automation, great progress continues to be made in workstation automation in all areas of the pathology laboratory. This report highlights the benefits and challenges of pathology automation, reviews middleware and its use to facilitate automation, and reviews the progress so far in the anatomic pathology laboratory. Copyright © 2015 Elsevier Inc. All rights reserved.
Managing laboratory automation.
Saboe, T J
1995-01-01
This paper discusses the process of managing automated systems through their life cycles within the quality-control (QC) laboratory environment. The focus is on the process of directing and managing the evolving automation of a laboratory; system examples are given. The author shows how both task and data systems have evolved, and how they interrelate. A BIG picture, or continuum view, is presented and some of the reasons for success or failure of the various examples cited are explored. Finally, some comments on future automation need are discussed.
International Nuclear Information System (INIS)
Lee, Seung Min; Seong, Poong Hyun; Kim, Jong Hyun; Kim, Man Cheol
2015-01-01
Automation refers to the use of a device or a system to perform a function previously performed by a human operator. It is introduced to reduce the human errors and to enhance the performance in various industrial fields, including the nuclear industry. However, these positive effects are not always achieved in complex systems such as nuclear power plants (NPPs). An excessive introduction of automation can generate new roles for human operators and change activities in unexpected ways. As more automation systems are accepted, the ability of human operators to detect automation failures and resume manual control is diminished. This disadvantage of automation is called the Out-of-the- Loop (OOTL) problem. We should consider the positive and negative effects of automation at the same time to determine the appropriate level of the introduction of automation. Thus, in this paper, we suggest an estimation method to consider the positive and negative effects of automation at the same time to determine the appropriate introduction of automation. This concept is limited in that it does not consider the effects of automation on human operators. Thus, a new estimation method for automation rate was suggested to overcome this problem
2013-07-23
... Customs Automation Program (NCAP) Tests Concerning Automated Commercial Environment (ACE) Document Image... (CBP's) plan to modify the National Customs Automation Program (NCAP) tests concerning document imaging... entry process by reducing the number of data elements required to obtain release for cargo transported...
The Science of Home Automation
Thomas, Brian Louis
Smart home technologies and the concept of home automation have become more popular in recent years. This popularity has been accompanied by social acceptance of passive sensors installed throughout the home. The subsequent increase in smart homes facilitates the creation of home automation strategies. We believe that home automation strategies can be generated intelligently by utilizing smart home sensors and activity learning. In this dissertation, we hypothesize that home automation can benefit from activity awareness. To test this, we develop our activity-aware smart automation system, CARL (CASAS Activity-aware Resource Learning). CARL learns the associations between activities and device usage from historical data and utilizes the activity-aware capabilities to control the devices. To help validate CARL we deploy and test three different versions of the automation system in a real-world smart environment. To provide a foundation of activity learning, we integrate existing activity recognition and activity forecasting into CARL home automation. We also explore two alternatives to using human-labeled data to train the activity learning models. The first unsupervised method is Activity Detection, and the second is a modified DBSCAN algorithm that utilizes Dynamic Time Warping (DTW) as a distance metric. We compare the performance of activity learning with human-defined labels and with automatically-discovered activity categories. To provide evidence in support of our hypothesis, we evaluate CARL automation in a smart home testbed. Our results indicate that home automation can be boosted through activity awareness. We also find that the resulting automation has a high degree of usability and comfort for the smart home resident.
Adaptive Automation Design and Implementation
2015-09-17
with an automated system to a real-world adaptive au- tomation system implementation. There have been plenty of adaptive automation 17 Adaptive...of systems without increasing manpower requirements by allocating routine tasks to automated aids, improving safety through the use of au- tomated ...between intermediate levels of au- tomation , explicitly defining which human task a given level automates. Each model aids the creation and classification
Layered distributed architecture for plant automation
International Nuclear Information System (INIS)
Aravamuthan, G.; Verma, Yachika; Ranjan, Jyoti; Chachondia, Alka S.; Ganesh, G.
2005-01-01
The development of plant automation system and associated software remains one of the greatest challenges to the widespread implementation of highly adaptive re-configurable automation technology. This paper presents a layered distributed architecture for a plant automation system designed to support rapid reconfiguration and redeployment of automation components. The paper first presents evolution of automation architecture and their associated environment in the past few decades and then presents the concept of layered system architecture and the use of automation components to support the construction of a wide variety of automation system. It also highlights the role of standards and technology, which can be used in the development of automation components. We have attempted to adhere to open standards and technology for the development of automation component at a various layers. It also highlights the application of this concept in the development of an Operator Information System (OIS) for Advanced Heavy Water Reactor (AHWR). (author)
Semantics-based Automated Web Testing
Directory of Open Access Journals (Sweden)
Hai-Feng Guo
2015-08-01
Full Text Available We present TAO, a software testing tool performing automated test and oracle generation based on a semantic approach. TAO entangles grammar-based test generation with automated semantics evaluation using a denotational semantics framework. We show how TAO can be incorporated with the Selenium automation tool for automated web testing, and how TAO can be further extended to support automated delta debugging, where a failing web test script can be systematically reduced based on grammar-directed strategies. A real-life parking website is adopted throughout the paper to demonstrate the effectivity of our semantics-based web testing approach.
Automation in organizations: Eternal conflict
Dieterly, D. L.
1981-01-01
Some ideas on and insights into the problems associated with automation in organizations are presented with emphasis on the concept of automation, its relationship to the individual, and its impact on system performance. An analogy is drawn, based on an American folk hero, to emphasize the extent of the problems encountered when dealing with automation within an organization. A model is proposed to focus attention on a set of appropriate dimensions. The function allocation process becomes a prominent aspect of the model. The current state of automation research is mentioned in relation to the ideas introduced. Proposed directions for an improved understanding of automation's effect on the individual's efficiency are discussed. The importance of understanding the individual's perception of the system in terms of the degree of automation is highlighted.
Mobile home automation-merging mobile value added services and home automation technologies
Rosendahl, Andreas; Hampe, Felix J.; Botterweck, Goetz
2007-01-01
non-peer-reviewed In this paper we study mobile home automation, a field that emerges from an integration of mobile application platforms and home automation technologies. In a conceptual introduction we first illustrate the need for such applications by introducing a two-dimensional conceptual model of mobility. Subsequently we suggest an architecture and discuss different options of how a user might access a mobile home automation service and the controlled devices. As another contrib...
International Nuclear Information System (INIS)
Lackman, Tomas
2011-01-01
In many systems an increased level of automation implies an altered role for the human. Behind the introduction of new automation lies different automation philosophies which stretches from trying to use as much automation as possible to adding automation only as a support to human tasks in specific situations. The Swedish Radiation Safety Authority has assigned AaF-engineering to describe the current automation philosophies within the nuclear industry. The assignment also includes a survey of events in which human involvement was necessary in order to save a situation in which the automation has not been sufficient. The survey also include an analysis of these events focusing on which automation philosophy/level of automation is most appropriate for obtaining a high level of safety. In the report three events are described in which human involvement has been crucial for the successful outcome of the situation; Spain 1989, Switzerland 1996, Forsmark/Sweden 2006. These events shows that the human is one of the most vital parts of the defense in depth, hence a strong focus should be given to looking after and maintaining human abilities in order for her to be able to act safely in such situations. The events also show potential enhancement of the defense in depth through making the most of the unique human abilities of intuitive and creative thinking and acting without access to external sources of power or prearranged procedures. These abilities are affected by the levels of automation, e.g. a too high level of automation can lead to a lack in situation awareness whilst a too low level can lead to too high levels of mental workload for the operators. To avoid degradation in human abilities to safely intervene, changes in automation levels at nuclear power plants should always be preceded by an analysis of its effect on the human in the situation at hand. In order better determine the efficiency of existing methods for assessing the effects of automation on human
Sauer, Juergen; Chavaillaz, Alain; Wastell, David
2016-06-01
This work examined the effects of operators' exposure to various types of automation failures in training. Forty-five participants were trained for 3.5 h on a simulated process control environment. During training, participants either experienced a fully reliable, automatic fault repair facility (i.e. faults detected and correctly diagnosed), a misdiagnosis-prone one (i.e. faults detected but not correctly diagnosed) or a miss-prone one (i.e. faults not detected). One week after training, participants were tested for 3 h, experiencing two types of automation failures (misdiagnosis, miss). The results showed that automation bias was very high when operators trained on miss-prone automation encountered a failure of the diagnostic system. Operator errors resulting from automation bias were much higher when automation misdiagnosed a fault than when it missed one. Differences in trust levels that were instilled by the different training experiences disappeared during the testing session. Practitioner Summary: The experience of automation failures during training has some consequences. A greater potential for operator errors may be expected when an automatic system failed to diagnose a fault than when it failed to detect one.
Automated Processing Workflow for Ambient Seismic Recordings
Girard, A. J.; Shragge, J.
2017-12-01
Structural imaging using body-wave energy present in ambient seismic data remains a challenging task, largely because these wave modes are commonly much weaker than surface wave energy. In a number of situations body-wave energy has been extracted successfully; however, (nearly) all successful body-wave extraction and imaging approaches have focused on cross-correlation processing. While this is useful for interferometric purposes, it can also lead to the inclusion of unwanted noise events that dominate the resulting stack, leaving body-wave energy overpowered by the coherent noise. Conversely, wave-equation imaging can be applied directly on non-correlated ambient data that has been preprocessed to mitigate unwanted energy (i.e., surface waves, burst-like and electromechanical noise) to enhance body-wave arrivals. Following this approach, though, requires a significant preprocessing effort on often Terabytes of ambient seismic data, which is expensive and requires automation to be a feasible approach. In this work we outline an automated processing workflow designed to optimize body wave energy from an ambient seismic data set acquired on a large-N array at a mine site near Lalor Lake, Manitoba, Canada. We show that processing ambient seismic data in the recording domain, rather than the cross-correlation domain, allows us to mitigate energy that is inappropriate for body-wave imaging. We first develop a method for window selection that automatically identifies and removes data contaminated by coherent high-energy bursts. We then apply time- and frequency-domain debursting techniques to mitigate the effects of remaining strong amplitude and/or monochromatic energy without severely degrading the overall waveforms. After each processing step we implement a QC check to investigate improvements in the convergence rates - and the emergence of reflection events - in the cross-correlation plus stack waveforms over hour-long windows. Overall, the QC analyses suggest that
Future Trends in Process Automation
Jämsä-Jounela, Sirkka-Liisa
2007-01-01
The importance of automation in the process industries has increased dramatically in recent years. In the highly industrialized countries, process automation serves to enhance product quality, master the whole range of products, improve process safety and plant availability, efficiently utilize resources and lower emissions. In the rapidly developing countries, mass production is the main motivation for applying process automation. The greatest demand for process automation is in the chemical...
Automation in Warehouse Development
Verriet, Jacques
2012-01-01
The warehouses of the future will come in a variety of forms, but with a few common ingredients. Firstly, human operational handling of items in warehouses is increasingly being replaced by automated item handling. Extended warehouse automation counteracts the scarcity of human operators and supports the quality of picking processes. Secondly, the development of models to simulate and analyse warehouse designs and their components facilitates the challenging task of developing warehouses that take into account each customer’s individual requirements and logistic processes. Automation in Warehouse Development addresses both types of automation from the innovative perspective of applied science. In particular, it describes the outcomes of the Falcon project, a joint endeavour by a consortium of industrial and academic partners. The results include a model-based approach to automate warehouse control design, analysis models for warehouse design, concepts for robotic item handling and computer vision, and auton...
2011-06-13
... Environment (ACE); Announcement of National Customs Automation Program Test of Automated Procedures for In... Customs Automation Program (NCAP) test relating to highway movements of commercial goods that are transported in-bond through the United States from one point in Canada to another point in Canada. The NCAP...
Automated cloning methods.; TOPICAL
International Nuclear Information System (INIS)
Collart, F.
2001-01-01
Argonne has developed a series of automated protocols to generate bacterial expression clones by using a robotic system designed to be used in procedures associated with molecular biology. The system provides plate storage, temperature control from 4 to 37 C at various locations, and Biomek and Multimek pipetting stations. The automated system consists of a robot that transports sources from the active station on the automation system. Protocols for the automated generation of bacterial expression clones can be grouped into three categories (Figure 1). Fragment generation protocols are initiated on day one of the expression cloning procedure and encompass those protocols involved in generating purified coding region (PCR)
Effects of Non-Driving Related Task Modalities on Takeover Performance in Highly Automated Driving.
Wandtner, Bernhard; Schömig, Nadja; Schmidt, Gerald
2018-04-01
Aim of the study was to evaluate the impact of different non-driving related tasks (NDR tasks) on takeover performance in highly automated driving. During highly automated driving, it is allowed to engage in NDR tasks temporarily. However, drivers must be able to take over control when reaching a system limit. There is evidence that the type of NDR task has an impact on takeover performance, but little is known about the specific task characteristics that account for performance decrements. Thirty participants drove in a simulator using a highly automated driving system. Each participant faced five critical takeover situations. Based on assumptions of Wickens's multiple resource theory, stimulus and response modalities of a prototypical NDR task were systematically manipulated. Additionally, in one experimental group, the task was locked out simultaneously with the takeover request. Task modalities had significant effects on several measures of takeover performance. A visual-manual texting task degraded performance the most, particularly when performed handheld. In contrast, takeover performance with an auditory-vocal task was comparable to a baseline without any task. Task lockout was associated with faster hands-on-wheel times but not altered brake response times. Results showed that NDR task modalities are relevant factors for takeover performance. An NDR task lockout was highly accepted by the drivers and showed moderate benefits for the first takeover reaction. Knowledge about the impact of NDR task characteristics is an enabler for adaptive takeover concepts. In addition, it might help regulators to make decisions on allowed NDR tasks during automated driving.
Automation, Performance and International Competition
DEFF Research Database (Denmark)
Kromann, Lene; Sørensen, Anders
This paper presents new evidence on trade‐induced automation in manufacturing firms using unique data combining a retrospective survey that we have assembled with register data for 2005‐2010. In particular, we establish a causal effect where firms that have specialized in product types for which...... the Chinese exports to the world market has risen sharply invest more in automated capital compared to firms that have specialized in other product types. We also study the relationship between automation and firm performance and find that firms with high increases in scale and scope of automation have faster...... productivity growth than other firms. Moreover, automation improves the efficiency of all stages of the production process by reducing setup time, run time, and inspection time and increasing uptime and quantity produced per worker. The efficiency improvement varies by type of automation....
Systematic review automation technologies
2014-01-01
Systematic reviews, a cornerstone of evidence-based medicine, are not produced quickly enough to support clinical practice. The cost of production, availability of the requisite expertise and timeliness are often quoted as major contributors for the delay. This detailed survey of the state of the art of information systems designed to support or automate individual tasks in the systematic review, and in particular systematic reviews of randomized controlled clinical trials, reveals trends that see the convergence of several parallel research projects. We surveyed literature describing informatics systems that support or automate the processes of systematic review or each of the tasks of the systematic review. Several projects focus on automating, simplifying and/or streamlining specific tasks of the systematic review. Some tasks are already fully automated while others are still largely manual. In this review, we describe each task and the effect that its automation would have on the entire systematic review process, summarize the existing information system support for each task, and highlight where further research is needed for realizing automation for the task. Integration of the systems that automate systematic review tasks may lead to a revised systematic review workflow. We envisage the optimized workflow will lead to system in which each systematic review is described as a computer program that automatically retrieves relevant trials, appraises them, extracts and synthesizes data, evaluates the risk of bias, performs meta-analysis calculations, and produces a report in real time. PMID:25005128
International Nuclear Information System (INIS)
Nurhani Kasuan; Zuraida Muhammad; Zakiah Yusoff; Mohd Hezri Fazalul Rahiman; Mohd Nasir Taib; Zaibunnisa Abdul Haiyee
2013-01-01
An automated steam distillation was successfully used to extract volatiles from Citrus hystrix D.C (Kaffir lime) peels. The automated steam distillation integrated with robust temperature control can commercially produce large amount of essential oil with efficient heating system. Objective of this study is to quantify the oil production rate using automated steam distillation and analyze the composition of volatiles in Kaffir lime peels oil at different controlled and uncontrolled temperature conditions. From the experimentation, oil extraction from Kaffir lime peels only took approximately less than 3 hours with amount of oil yield was 13.4 % more than uncontrolled temperature. The identified major compounds from Kaffir lime peels oil were sabinene, β-pinene, limonene, α-pinene, camphene, myrcene, terpinen-4-ol, α-terpineol, linalool, terpinolene and citronellal which are considered to have good organoleptic quality. In contrast with uncontrolled temperature, oil analysis revealed that some important volatile compounds were absent such as terpinolene, linalool, terpinen-4-ol due to thermal degradation effect from fast heating of extracted material. (author)
The Automation-by-Expertise-by-Training Interaction.
Strauch, Barry
2017-03-01
I introduce the automation-by-expertise-by-training interaction in automated systems and discuss its influence on operator performance. Transportation accidents that, across a 30-year interval demonstrated identical automation-related operator errors, suggest a need to reexamine traditional views of automation. I review accident investigation reports, regulator studies, and literature on human computer interaction, expertise, and training and discuss how failing to attend to the interaction of automation, expertise level, and training has enabled operators to commit identical automation-related errors. Automated systems continue to provide capabilities exceeding operators' need for effective system operation and provide interfaces that can hinder, rather than enhance, operator automation-related situation awareness. Because of limitations in time and resources, training programs do not provide operators the expertise needed to effectively operate these automated systems, requiring them to obtain the expertise ad hoc during system operations. As a result, many do not acquire necessary automation-related system expertise. Integrating automation with expected operator expertise levels, and within training programs that provide operators the necessary automation expertise, can reduce opportunities for automation-related operator errors. Research to address the automation-by-expertise-by-training interaction is needed. However, such research must meet challenges inherent to examining realistic sociotechnical system automation features with representative samples of operators, perhaps by using observational and ethnographic research. Research in this domain should improve the integration of design and training and, it is hoped, enhance operator performance.
Automating Trend Analysis for Spacecraft Constellations
Davis, George; Cooter, Miranda; Updike, Clark; Carey, Everett; Mackey, Jennifer; Rykowski, Timothy; Powers, Edward I. (Technical Monitor)
2001-01-01
Spacecraft trend analysis is a vital mission operations function performed by satellite controllers and engineers, who perform detailed analyses of engineering telemetry data to diagnose subsystem faults and to detect trends that may potentially lead to degraded subsystem performance or failure in the future. It is this latter function that is of greatest importance, for careful trending can often predict or detect events that may lead to a spacecraft's entry into safe-hold. Early prediction and detection of such events could result in the avoidance of, or rapid return to service from, spacecraft safing, which not only results in reduced recovery costs but also in a higher overall level of service for the satellite system. Contemporary spacecraft trending activities are manually intensive and are primarily performed diagnostically after a fault occurs, rather than proactively to predict its occurrence. They also tend to rely on information systems and software that are oudated when compared to current technologies. When coupled with the fact that flight operations teams often have limited resources, proactive trending opportunities are limited, and detailed trend analysis is often reserved for critical responses to safe holds or other on-orbit events such as maneuvers. While the contemporary trend analysis approach has sufficed for current single-spacecraft operations, it will be unfeasible for NASA's planned and proposed space science constellations. Missions such as the Dynamics, Reconnection and Configuration Observatory (DRACO), for example, are planning to launch as many as 100 'nanospacecraft' to form a homogenous constellation. A simple extrapolation of resources and manpower based on single-spacecraft operations suggests that trending for such a large spacecraft fleet will be unmanageable, unwieldy, and cost-prohibitive. It is therefore imperative that an approach to automating the spacecraft trend analysis function be studied, developed, and applied to
International Nuclear Information System (INIS)
Gruenemeyer, D.
1991-01-01
This paper reports on a Distribution Automation (DA) System enhances the efficiency and productivity of a utility. It also provides intangible benefits such as improved public image and market advantages. A utility should evaluate the benefits and costs of such a system before committing funds. The expenditure for distribution automation is economical when justified by the deferral of a capacity increase, a decrease in peak power demand, or a reduction in O and M requirements
Understanding human management of automation errors
McBride, Sara E.; Rogers, Wendy A.; Fisk, Arthur D.
2013-01-01
Automation has the potential to aid humans with a diverse set of tasks and support overall system performance. Automated systems are not always reliable, and when automation errs, humans must engage in error management, which is the process of detecting, understanding, and correcting errors. However, this process of error management in the context of human-automation interaction is not well understood. Therefore, we conducted a systematic review of the variables that contribute to error management. We examined relevant research in human-automation interaction and human error to identify critical automation, person, task, and emergent variables. We propose a framework for management of automation errors to incorporate and build upon previous models. Further, our analysis highlights variables that may be addressed through design and training to positively influence error management. Additional efforts to understand the error management process will contribute to automation designed and implemented to support safe and effective system performance. PMID:25383042
Human-centred automation: an explorative study
International Nuclear Information System (INIS)
Hollnagel, Erik; Miberg, Ann Britt
1999-05-01
The purpose of the programme activity on human-centred automation at the HRP is to develop knowledge (in the form of models and theories) and tools (in the form of techniques and simulators) to support design of automation that ensures effective human performance and comprehension. This report presents the work done on both the analytical and experimental side of this project. The analytical work has surveyed common definitions of automation and traditional design principles. A general finding is that human-centred automation usually is defined in terms of what it is not. This is partly due to a lack of adequate models and of human-automation interaction. Another result is a clarification of the consequences of automation, in particular with regard to situation awareness and workload. The experimental work has taken place as an explorative experiment in HAMMLAB in collaboration with IPSN (France). The purpose of this experiment was to increase the understanding of how automation influences operator performance in NPP control rooms. Two different types of automation (extensive and limited) were considered in scenarios having two different degrees of complexity (high and low), and involving diagnostic and procedural tasks. Six licensed NPP crews from the NPP at Loviisa, Finland, participated in the experiment. The dependent variables applied were plant performance, operator performance, self-rated crew performance, situation awareness, workload, and operator trust in the automation. The results from the diagnostic scenarios indicated that operators' judgement of crew efficiency was related to their level of trust in the automation, and further that operators trusted automation least and rated crew performance lowest in situations where crew performance was efficient and vice versa. The results from procedural scenarios indicated that extensive automation efficiently supported operators' performance, and further that operator' judgement of crew performance efficiency
Configuration Management Automation (CMA) -
Department of Transportation — Configuration Management Automation (CMA) will provide an automated, integrated enterprise solution to support CM of FAA NAS and Non-NAS assets and investments. CMA...
Toward designing for trust in database automation
Energy Technology Data Exchange (ETDEWEB)
Duez, P. P.; Jamieson, G. A. [Cognitive Engineering Laboratory, Univ. of Toronto, 5 King' s College Rd., Toronto, Ont. M5S 3G8 (Canada)
2006-07-01
Appropriate reliance on system automation is imperative for safe and productive work, especially in safety-critical systems. It is unsafe to rely on automation beyond its designed use; conversely, it can be both unproductive and unsafe to manually perform tasks that are better relegated to automated tools. Operator trust in automated tools mediates reliance, and trust appears to affect how operators use technology. As automated agents become more complex, the question of trust in automation is increasingly important. In order to achieve proper use of automation, we must engender an appropriate degree of trust that is sensitive to changes in operating functions and context. In this paper, we present research concerning trust in automation in the domain of automated tools for relational databases. Lee and See have provided models of trust in automation. One model developed by Lee and See identifies three key categories of information about the automation that lie along a continuum of attributional abstraction. Purpose-, process-and performance-related information serve, both individually and through inferences between them, to describe automation in such a way as to engender r properly-calibrated trust. Thus, one can look at information from different levels of attributional abstraction as a general requirements analysis for information key to appropriate trust in automation. The model of information necessary to engender appropriate trust in automation [1] is a general one. Although it describes categories of information, it does not provide insight on how to determine the specific information elements required for a given automated tool. We have applied the Abstraction Hierarchy (AH) to this problem in the domain of relational databases. The AH serves as a formal description of the automation at several levels of abstraction, ranging from a very abstract purpose-oriented description to a more concrete description of the resources involved in the automated process
Toward designing for trust in database automation
International Nuclear Information System (INIS)
Duez, P. P.; Jamieson, G. A.
2006-01-01
Appropriate reliance on system automation is imperative for safe and productive work, especially in safety-critical systems. It is unsafe to rely on automation beyond its designed use; conversely, it can be both unproductive and unsafe to manually perform tasks that are better relegated to automated tools. Operator trust in automated tools mediates reliance, and trust appears to affect how operators use technology. As automated agents become more complex, the question of trust in automation is increasingly important. In order to achieve proper use of automation, we must engender an appropriate degree of trust that is sensitive to changes in operating functions and context. In this paper, we present research concerning trust in automation in the domain of automated tools for relational databases. Lee and See have provided models of trust in automation. One model developed by Lee and See identifies three key categories of information about the automation that lie along a continuum of attributional abstraction. Purpose-, process-and performance-related information serve, both individually and through inferences between them, to describe automation in such a way as to engender r properly-calibrated trust. Thus, one can look at information from different levels of attributional abstraction as a general requirements analysis for information key to appropriate trust in automation. The model of information necessary to engender appropriate trust in automation [1] is a general one. Although it describes categories of information, it does not provide insight on how to determine the specific information elements required for a given automated tool. We have applied the Abstraction Hierarchy (AH) to this problem in the domain of relational databases. The AH serves as a formal description of the automation at several levels of abstraction, ranging from a very abstract purpose-oriented description to a more concrete description of the resources involved in the automated process
International Nuclear Information System (INIS)
Thompson, K.A.; Walker, L.R.
1986-01-01
The Plant Laboratory at the Oak Ridge Y-12 Plant has recently obtained a Cameca MBX electron microprobe with a Tracor Northern TN5500 automation system. This allows full stage and spectrometer automation and digital beam control. The capabilities of the system include qualitative and quantitative elemental microanalysis for all elements above and including boron in atomic number, high- and low-magnification imaging and processing, elemental mapping and enhancement, and particle size, shape, and composition analyses. Very low magnification, quantitative elemental mapping using stage control (which is of particular interest) has been accomplished along with automated size, shape, and composition analysis over a large relative area
Directory of Open Access Journals (Sweden)
Ramesh Kalindri
2014-06-01
Full Text Available Currently, software engineers are increasingly turning to the option of automating functional tests, but not always have successful in this endeavor. Reasons range from low planning until over cost in the process. Some principles that can guide teams in automating these tests are described in this article.
Driver Psychology during Automated Platooning
Heikoop, D.D.
2017-01-01
With the rapid increase in vehicle automation technology, the call for understanding how humans behave while driving in an automated vehicle becomes more urgent. Vehicles that have automated systems such as Lane Keeping Assist (LKA) or Adaptive Cruise Control (ACC) not only support drivers in their
Ancel, Ersin; Shih, Ann T.
2014-01-01
This paper highlights the development of a model that is focused on the safety issue of increasing complexity and reliance on automation systems in transport category aircraft. Recent statistics show an increase in mishaps related to manual handling and automation errors due to pilot complacency and over-reliance on automation, loss of situational awareness, automation system failures and/or pilot deficiencies. Consequently, the aircraft can enter a state outside the flight envelope and/or air traffic safety margins which potentially can lead to loss-of-control (LOC), controlled-flight-into-terrain (CFIT), or runway excursion/confusion accidents, etc. The goal of this modeling effort is to provide NASA's Aviation Safety Program (AvSP) with a platform capable of assessing the impacts of AvSP technologies and products towards reducing the relative risk of automation related accidents and incidents. In order to do so, a generic framework, capable of mapping both latent and active causal factors leading to automation errors, is developed. Next, the framework is converted into a Bayesian Belief Network model and populated with data gathered from Subject Matter Experts (SMEs). With the insertion of technologies and products, the model provides individual and collective risk reduction acquired by technologies and methodologies developed within AvSP.
Automation systems for radioimmunoassay
International Nuclear Information System (INIS)
Yamasaki, Paul
1974-01-01
The application of automation systems for radioimmunoassay (RIA) was discussed. Automated systems could be useful in the second step, of the four basic processes in the course of RIA, i.e., preparation of sample for reaction. There were two types of instrumentation, a semi-automatic pipete, and a fully automated pipete station, both providing for fast and accurate dispensing of the reagent or for the diluting of sample with reagent. Illustrations of the instruments were shown. (Mukohata, S.)
Classification of Automated Search Traffic
Buehrer, Greg; Stokes, Jack W.; Chellapilla, Kumar; Platt, John C.
As web search providers seek to improve both relevance and response times, they are challenged by the ever-increasing tax of automated search query traffic. Third party systems interact with search engines for a variety of reasons, such as monitoring a web site’s rank, augmenting online games, or possibly to maliciously alter click-through rates. In this paper, we investigate automated traffic (sometimes referred to as bot traffic) in the query stream of a large search engine provider. We define automated traffic as any search query not generated by a human in real time. We first provide examples of different categories of query logs generated by automated means. We then develop many different features that distinguish between queries generated by people searching for information, and those generated by automated processes. We categorize these features into two classes, either an interpretation of the physical model of human interactions, or as behavioral patterns of automated interactions. Using the these detection features, we next classify the query stream using multiple binary classifiers. In addition, a multiclass classifier is then developed to identify subclasses of both normal and automated traffic. An active learning algorithm is used to suggest which user sessions to label to improve the accuracy of the multiclass classifier, while also seeking to discover new classes of automated traffic. Performance analysis are then provided. Finally, the multiclass classifier is used to predict the subclass distribution for the search query stream.
An automated swimming respirometer
DEFF Research Database (Denmark)
STEFFENSEN, JF; JOHANSEN, K; BUSHNELL, PG
1984-01-01
An automated respirometer is described that can be used for computerized respirometry of trout and sharks.......An automated respirometer is described that can be used for computerized respirometry of trout and sharks....
Laboratory automation: trajectory, technology, and tactics.
Markin, R S; Whalen, S A
2000-05-01
Laboratory automation is in its infancy, following a path parallel to the development of laboratory information systems in the late 1970s and early 1980s. Changes on the horizon in healthcare and clinical laboratory service that affect the delivery of laboratory results include the increasing age of the population in North America, the implementation of the Balanced Budget Act (1997), and the creation of disease management companies. Major technology drivers include outcomes optimization and phenotypically targeted drugs. Constant cost pressures in the clinical laboratory have forced diagnostic manufacturers into less than optimal profitability states. Laboratory automation can be a tool for the improvement of laboratory services and may decrease costs. The key to improvement of laboratory services is implementation of the correct automation technology. The design of this technology should be driven by required functionality. Automation design issues should be centered on the understanding of the laboratory and its relationship to healthcare delivery and the business and operational processes in the clinical laboratory. Automation design philosophy has evolved from a hardware-based approach to a software-based approach. Process control software to support repeat testing, reflex testing, and transportation management, and overall computer-integrated manufacturing approaches to laboratory automation implementation are rapidly expanding areas. It is clear that hardware and software are functionally interdependent and that the interface between the laboratory automation system and the laboratory information system is a key component. The cost-effectiveness of automation solutions suggested by vendors, however, has been difficult to evaluate because the number of automation installations are few and the precision with which operational data have been collected to determine payback is suboptimal. The trend in automation has moved from total laboratory automation to a
Contaminant analysis automation, an overview
International Nuclear Information System (INIS)
Hollen, R.; Ramos, O. Jr.
1996-01-01
To meet the environmental restoration and waste minimization goals of government and industry, several government laboratories, universities, and private companies have formed the Contaminant Analysis Automation (CAA) team. The goal of this consortium is to design and fabricate robotics systems that standardize and automate the hardware and software of the most common environmental chemical methods. In essence, the CAA team takes conventional, regulatory- approved (EPA Methods) chemical analysis processes and automates them. The automation consists of standard laboratory modules (SLMs) that perform the work in a much more efficient, accurate, and cost- effective manner
Intrinsic immunogenicity of rapidly-degradable polymers evolves during degradation.
Andorko, James I; Hess, Krystina L; Pineault, Kevin G; Jewell, Christopher M
2016-03-01
Recent studies reveal many biomaterial vaccine carriers are able to activate immunostimulatory pathways, even in the absence of other immune signals. How the changing properties of polymers during biodegradation impact this intrinsic immunogenicity is not well studied, yet this information could contribute to rational design of degradable vaccine carriers that help direct immune response. We use degradable poly(beta-amino esters) (PBAEs) to explore intrinsic immunogenicity as a function of the degree of polymer degradation and polymer form (e.g., soluble, particles). PBAE particles condensed by electrostatic interaction to mimic a common vaccine approach strongly activate dendritic cells, drive antigen presentation, and enhance T cell proliferation in the presence of antigen. Polymer molecular weight strongly influences these effects, with maximum stimulation at short degradation times--corresponding to high molecular weight--and waning levels as degradation continues. In contrast, free polymer is immunologically inert. In mice, PBAE particles increase the numbers and activation state of cells in lymph nodes. Mechanistic studies reveal that this evolving immunogenicity occurs as the physicochemical properties and concentration of particles change during polymer degradation. This work confirms the immunological profile of degradable, synthetic polymers can evolve over time and creates an opportunity to leverage this feature in new vaccines. Degradable polymers are increasingly important in vaccination, but how the inherent immunogenicity of polymers changes during degradation is poorly understood. Using common rapidly-degradable vaccine carriers, we show that the activation of immune cells--even in the absence of other adjuvants--depends on polymer form (e.g., free, particulate) and the extent of degradation. These changing characteristics alter the physicochemical properties (e.g., charge, size, molecular weight) of polymer particles, driving changes in
Selecting automation for the clinical chemistry laboratory.
Melanson, Stacy E F; Lindeman, Neal I; Jarolim, Petr
2007-07-01
Laboratory automation proposes to improve the quality and efficiency of laboratory operations, and may provide a solution to the quality demands and staff shortages faced by today's clinical laboratories. Several vendors offer automation systems in the United States, with both subtle and obvious differences. Arriving at a decision to automate, and the ensuing evaluation of available products, can be time-consuming and challenging. Although considerable discussion concerning the decision to automate has been published, relatively little attention has been paid to the process of evaluating and selecting automation systems. To outline a process for evaluating and selecting automation systems as a reference for laboratories contemplating laboratory automation. Our Clinical Chemistry Laboratory staff recently evaluated all major laboratory automation systems in the United States, with their respective chemistry and immunochemistry analyzers. Our experience is described and organized according to the selection process, the important considerations in clinical chemistry automation, decisions and implementation, and we give conclusions pertaining to this experience. Including the formation of a committee, workflow analysis, submitting a request for proposal, site visits, and making a final decision, the process of selecting chemistry automation took approximately 14 months. We outline important considerations in automation design, preanalytical processing, analyzer selection, postanalytical storage, and data management. Selecting clinical chemistry laboratory automation is a complex, time-consuming process. Laboratories considering laboratory automation may benefit from the concise overview and narrative and tabular suggestions provided.
Automated Vehicles Symposium 2014
Beiker, Sven; Road Vehicle Automation 2
2015-01-01
This paper collection is the second volume of the LNMOB series on Road Vehicle Automation. The book contains a comprehensive review of current technical, socio-economic, and legal perspectives written by experts coming from public authorities, companies and universities in the U.S., Europe and Japan. It originates from the Automated Vehicle Symposium 2014, which was jointly organized by the Association for Unmanned Vehicle Systems International (AUVSI) and the Transportation Research Board (TRB) in Burlingame, CA, in July 2014. The contributions discuss the challenges arising from the integration of highly automated and self-driving vehicles into the transportation system, with a focus on human factors and different deployment scenarios. This book is an indispensable source of information for academic researchers, industrial engineers, and policy makers interested in the topic of road vehicle automation.
Work Planing Automation at Mechanical Subdivision
Dzindzelėta, Vytautas
2005-01-01
Work planing automation, installation possibilities and future outlook at mechanical subdivision. To study how the work planing has changed before and after automation process and to analyse automation process methodology.
Physiological Self-Regulation and Adaptive Automation
Prinzell, Lawrence J.; Pope, Alan T.; Freeman, Frederick G.
2007-01-01
Adaptive automation has been proposed as a solution to current problems of human-automation interaction. Past research has shown the potential of this advanced form of automation to enhance pilot engagement and lower cognitive workload. However, there have been concerns voiced regarding issues, such as automation surprises, associated with the use of adaptive automation. This study examined the use of psychophysiological self-regulation training with adaptive automation that may help pilots deal with these problems through the enhancement of cognitive resource management skills. Eighteen participants were assigned to 3 groups (self-regulation training, false feedback, and control) and performed resource management, monitoring, and tracking tasks from the Multiple Attribute Task Battery. The tracking task was cycled between 3 levels of task difficulty (automatic, adaptive aiding, manual) on the basis of the electroencephalogram-derived engagement index. The other two tasks remained in automatic mode that had a single automation failure. Those participants who had received self-regulation training performed significantly better and reported lower National Aeronautics and Space Administration Task Load Index scores than participants in the false feedback and control groups. The theoretical and practical implications of these results for adaptive automation are discussed.
National Research Council Canada - National Science Library
2001-01-01
The Standard Automated Materiel Management System Automated Small Purchase System is a fully automated micro-purchases system used by the General and Industrial Directorate at the Defense Supply Center Philadelphia...
Hirasawa, Kazunori; Takahashi, Natsumi; Satou, Tsukasa; Kasahara, Masayuki; Matsumura, Kazuhiro; Shoji, Nobuyuki
2017-08-01
This prospective observational study compared the performance of size modulation standard automated perimetry with the Octopus 600 10-2 test program, with stimulus size modulation during testing, based on stimulus intensity and conventional standard automated perimetry, with that of the Humphrey 10-2 test program in glaucoma patients. Eighty-seven eyes of 87 glaucoma patients underwent size modulation standard automated perimetry with Dynamic strategy and conventional standard automated perimetry using the SITA standard strategy. The main outcome measures were global indices, point-wise threshold, visual defect size and depth, reliability indices, and test duration; these were compared between size modulation standard automated perimetry and conventional standard automated perimetry. Global indices and point-wise threshold values between size modulation standard automated perimetry and conventional standard automated perimetry were moderately to strongly correlated (p 33.40, p modulation standard automated perimetry than with conventional standard automated perimetry, but the visual-field defect size was smaller (p modulation-standard automated perimetry than on conventional standard automated perimetry. The reliability indices, particularly the false-negative response, of size modulation standard automated perimetry were worse than those of conventional standard automated perimetry (p modulation standard automated perimetry than with conventional standard automated perimetry (p = 0.02). Global indices and the point-wise threshold value of the two testing modalities correlated well. However, the potential of a large stimulus presented at an area with a decreased sensitivity with size modulation standard automated perimetry could underestimate the actual threshold in the 10-2 test protocol, as compared with conventional standard automated perimetry.
Advances in Automated QA/QC for TRISO Fuel Particle Production
International Nuclear Information System (INIS)
Hockey, Ronald L.; Bond, Leonard J.; Batishko, Charles R.; Gray, Joseph N.; Saurwein, John J.; Lowden, Richard A.
2004-01-01
Fuel in most Generation IV reactor designs typically encompasses billions of the TRISO particles. Present day QA/QC methods, done manually and in many cases destructively, cannot economically test a statistically significant fraction of the large number of the individual fuel particles required. Fully automated inspection technologies are essential to economical TRISO fuel particle production. A combination of in-line nondestructive (NDE) measurements employing electromagnetic induction and digital optical imaging analysis is currently under investigation and preliminary data indicate the potential for meeting the demands of this application. To calibrate high-speed NDE methods, surrogate fuel particle samples are being coated with layers containing a wide array of defect types found to degrade fuel performance and these are being characterized via high-resolution CT and digital radiographic images
Laboratory automation and LIMS in forensics
DEFF Research Database (Denmark)
Stangegaard, Michael; Hansen, Anders Johannes; Morling, Niels
2013-01-01
. Furthermore, implementation of automated liquid handlers reduces the risk of sample misplacement. A LIMS can efficiently control the sample flow through the laboratory and manage the results of the conducted tests for each sample. Integration of automated liquid handlers with a LIMS provides the laboratory......Implementation of laboratory automation and LIMS in a forensic laboratory enables the laboratory, to standardize sample processing. Automated liquid handlers can increase throughput and eliminate manual repetitive pipetting operations, known to result in occupational injuries to the technical staff...... with the tools required for setting up automated production lines of complex laboratory processes and monitoring the whole process and the results. Combined, this enables processing of a large number of samples. Selection of the best automated solution for an individual laboratory should be based on user...
Montemerlo, Melvin
1988-01-01
The Autonomous Systems focus on the automation of control systems for the Space Station and mission operations. Telerobotics focuses on automation for in-space servicing, assembly, and repair. The Autonomous Systems and Telerobotics each have a planned sequence of integrated demonstrations showing the evolutionary advance of the state-of-the-art. Progress is briefly described for each area of concern.
Automating the radiographic NDT process
International Nuclear Information System (INIS)
Aman, J.K.
1986-01-01
Automation, the removal of the human element in inspection, has not been generally applied to film radiographic NDT. The justication for automating is not only productivity but also reliability of results. Film remains in the automated system of the future because of its extremely high image content, approximately 8 x 10 9 bits per 14 x 17. The equivalent to 2200 computer floppy discs. Parts handling systems and robotics applied for manufacturing and some NDT modalities, should now be applied to film radiographic NDT systems. Automatic film handling can be achieved with the daylight NDT film handling system. Automatic film processing is becoming the standard in industry and can be coupled to the daylight system. Robots offer the opportunity to automate fully the exposure step. Finally, computer aided interpretation appears on the horizon. A unit which laser scans a 14 x 17 (inch) film in 6 - 8 seconds can digitize film information for further manipulation and possible automatic interrogations (computer aided interpretation). The system called FDRS (for Film Digital Radiography System) is moving toward 50 micron (*approx* 16 lines/mm) resolution. This is believed to meet the need of the majority of image content needs. We expect the automated system to appear first in parts (modules) as certain operations are automated. The future will see it all come together in an automated film radiographic NDT system (author) [pt
Automated Vehicles Symposium 2015
Beiker, Sven
2016-01-01
This edited book comprises papers about the impacts, benefits and challenges of connected and automated cars. It is the third volume of the LNMOB series dealing with Road Vehicle Automation. The book comprises contributions from researchers, industry practitioners and policy makers, covering perspectives from the U.S., Europe and Japan. It is based on the Automated Vehicles Symposium 2015 which was jointly organized by the Association of Unmanned Vehicle Systems International (AUVSI) and the Transportation Research Board (TRB) in Ann Arbor, Michigan, in July 2015. The topical spectrum includes, but is not limited to, public sector activities, human factors, ethical and business aspects, energy and technological perspectives, vehicle systems and transportation infrastructure. This book is an indispensable source of information for academic researchers, industrial engineers and policy makers interested in the topic of road vehicle automation.
Automated PCB Inspection System
Directory of Open Access Journals (Sweden)
Syed Usama BUKHARI
2017-05-01
Full Text Available Development of an automated PCB inspection system as per the need of industry is a challenging task. In this paper a case study is presented, to exhibit, a proposed system for an immigration process of a manual PCB inspection system to an automated PCB inspection system, with a minimal intervention on the existing production flow, for a leading automotive manufacturing company. A detailed design of the system, based on computer vision followed by testing and analysis was proposed, in order to aid the manufacturer in the process of automation.
Bholanath, P.; Cort, K.
2015-04-01
Monitoring deforestation and forest degradation at national scale has been identified as a national priority under Guyana's REDD+ Programme. Based on Guyana's MRV (Monitoring Reporting and Verification) System Roadmap developed in 2009, Guyana sought to establish a comprehensive, national system to monitor, report and verify forest carbon emissions resulting from deforestation and forest degradation in Guyana. To date, four national annual assessments have been conducted: 2010, 2011, 2012 and 2013. Monitoring of forest change in 2010 was completed with medium resolution imagery, mainly Landsat 5. In 2011, assessment was conducted using a combination of Landsat (5 and 7) and for the first time, 5m high resolution imagery, with RapidEye coverage for approximately half of Guyana where majority of land use changes were taking place. Forest change in 2013 was determined using high resolution imagery for the whole of Guyana. The current method is an automated-assisted process of careful systematic manual interpretation of satellite imagery to identify deforestation based on different drivers of change. The minimum mapping unit (MMU) for deforestation is 1 ha (Guyana's forest definition) and a country-specific definition of 0.25 ha for degradation. The total forested area of Guyana is estimated as 18.39 million hectares (ha). In 2012 as planned, Guyana's forest area was reevaluated using RapidEye 5 m imagery. Deforestation in 2013 is estimated at 12 733 ha which equates to a total deforestation rate of 0.068%. Significant progress was made in 2012 and 2013, in mapping forest degradation. The area of forest degradation as measured by interpretation of 5 m RapidEye satellite imagery in 2013 was 4 352 ha. All results are subject to accuracy assessment and independent third party verification.
Automated lung nodule classification following automated nodule detection on CT: A serial approach
International Nuclear Information System (INIS)
Armato, Samuel G. III; Altman, Michael B.; Wilkie, Joel; Sone, Shusuke; Li, Feng; Doi, Kunio; Roy, Arunabha S.
2003-01-01
We have evaluated the performance of an automated classifier applied to the task of differentiating malignant and benign lung nodules in low-dose helical computed tomography (CT) scans acquired as part of a lung cancer screening program. The nodules classified in this manner were initially identified by our automated lung nodule detection method, so that the output of automated lung nodule detection was used as input to automated lung nodule classification. This study begins to narrow the distinction between the 'detection task' and the 'classification task'. Automated lung nodule detection is based on two- and three-dimensional analyses of the CT image data. Gray-level-thresholding techniques are used to identify initial lung nodule candidates, for which morphological and gray-level features are computed. A rule-based approach is applied to reduce the number of nodule candidates that correspond to non-nodules, and the features of remaining candidates are merged through linear discriminant analysis to obtain final detection results. Automated lung nodule classification merges the features of the lung nodule candidates identified by the detection algorithm that correspond to actual nodules through another linear discriminant classifier to distinguish between malignant and benign nodules. The automated classification method was applied to the computerized detection results obtained from a database of 393 low-dose thoracic CT scans containing 470 confirmed lung nodules (69 malignant and 401 benign nodules). Receiver operating characteristic (ROC) analysis was used to evaluate the ability of the classifier to differentiate between nodule candidates that correspond to malignant nodules and nodule candidates that correspond to benign lesions. The area under the ROC curve for this classification task attained a value of 0.79 during a leave-one-out evaluation
International Nuclear Information System (INIS)
Smith, L.I.; Bodwell, J.E.; Mendel, D.B.; Ciardelli, T.; North, W.G.; Munck, A.
1988-01-01
Dexamethasone 21-mesylate is a highly specific synthetic glucocorticoid derivative that binds covalently to glucocorticoid receptors via sulfhydryl groups. The authors have identified the amino acid that reacts with the dexamethasone 21-mesylate by using enzymatic digestion and microsequencing for radiolabel. Nonactivated glucocorticoid receptors obtained from labeling intact WEHI-7 mouse thymoma cells with [ 3 H]dexamethasone 21-mesylate were immunopurified and analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Trypsin digestion followed by reversed-phase high-performance liquid chromatography (reversed-phase HPLC) produced a single [ 3 H]dexamethasone 21-mesylate labeled peptide. Automated Edman degradation of this peptide revealed that the [ 3 H]dexamethasone 21-mesylate was located at position 5 from the amino terminus. Dual-isotope labeling studies with [ 3 H]dexamethasone 21-mesylate and [ 35 S]methionine demonstrated that this peptide contained methionine. Staphylococcus aureus V8 protease digestion of [ 3 H]dexamethasone 21-mesylate labeled steroid-binding subunits generated a different radiolabeled peptide containing label at position 7 from the amino terminus. On the basis of the published amino acid sequence of the murine glucocorticoid receptor, their data clearly identify cysteine-644 as the single residue in the steroid-binding domain that covalently binds dexamethasone 21-mesylate. They have confirmed this finding by demonstrating that a synthetic peptide representing the amino acid sequence 640-650 of the murine glucocorticoid receptor behaves in an identical manner on reversed-phase HPLC as the trypsin-generated peptide from intact cells
Isolation and Characterization of a Broad Spectrum Bacteriocin from Bacillus amyloliquefaciens RX7
Directory of Open Access Journals (Sweden)
Kong Boon Lim
2016-01-01
Full Text Available We isolated a Bacillus strain, RX7, with inhibitory activity against Listeria monocytogenes from soil and identified it as Bacillus amyloliquefaciens based on 16S rRNA gene sequencing. The inhibitory activity was stable over a wide range of pH and was fully retained after 30 min at 80°C, after which it decreased gradually at higher temperatures. The activity was sensitive to the proteolytic action of α-chymotrypsin, proteinase-K, and trypsin, indicating its proteinaceous nature. This bacteriocin was active against a broad spectrum of bacteria and the fungus Candida albicans. Direct detection of antimicrobial activity on a sodium dodecyl sulfate-polyacrylamide gel suggested an apparent molecular mass of approximately 5 kDa. Ammonium sulfate precipitation and anion-exchange and gel permeation chromatography integrated with reverse phase-high-performance liquid chromatography were used for bacteriocin purification. Automated N-terminal Edman degradation of the purified RX7 bacteriocin recognized the first 15 amino acids as NH2-X-Ala-Trp-Tyr-Asp-Ile-Arg-Lys-Leu-Gly-Asn-Lys-Gly-Ala, where the letter X in the sequence indicates an unknown or nonstandard amino acid. Based on BLAST similarity search and multiple alignment analysis, the obtained partial sequence showed high homology with the two-peptide lantibiotic haloduracin (HalA1 from Bacillus halodurans, although at least two amino acids differed between the sequences. A time-kill study demonstrated a bactericidal mode of action of RX7 bacteriocin.
Automation of Electrical Cable Harnesses Testing
Directory of Open Access Journals (Sweden)
Zhuming Bi
2017-12-01
Full Text Available Traditional automated systems, such as industrial robots, are applied in well-structured environments, and many automated systems have a limited adaptability to deal with complexity and uncertainty; therefore, the applications of industrial robots in small- and medium-sized enterprises (SMEs are very limited. The majority of manual operations in SMEs are too complicated for automation. The rapidly developed information technologies (IT has brought new opportunities for the automation of manufacturing and assembly processes in the ill-structured environments. Note that an automation solution should be designed to meet the given requirements of the specified application, and it differs from one application to another. In this paper, we look into the feasibility of automated testing for electric cable harnesses, and our focus is on some of the generic strategies for the improvement of the adaptability of automation solutions. Especially, the concept of modularization is adopted in developing hardware and software to maximize system adaptability in testing a wide scope of products. A proposed system has been implemented, and the system performances have been evaluated by executing tests on actual products. The testing experiments have shown that the automated system outperformed manual operations greatly in terms of cost-saving, productivity and reliability. Due to the potential of increasing system adaptability and cost reduction, the presented work has its theoretical and practical significance for an extension for other automation solutions in SMEs.
Automated DBS microsampling, microscale automation and microflow LC-MS for therapeutic protein PK.
Zhang, Qian; Tomazela, Daniela; Vasicek, Lisa A; Spellman, Daniel S; Beaumont, Maribel; Shyong, BaoJen; Kenny, Jacqueline; Fauty, Scott; Fillgrove, Kerry; Harrelson, Jane; Bateman, Kevin P
2016-04-01
Reduce animal usage for discovery-stage PK studies for biologics programs using microsampling-based approaches and microscale LC-MS. We report the development of an automated DBS-based serial microsampling approach for studying the PK of therapeutic proteins in mice. Automated sample preparation and microflow LC-MS were used to enable assay miniaturization and improve overall assay throughput. Serial sampling of mice was possible over the full 21-day study period with the first six time points over 24 h being collected using automated DBS sample collection. Overall, this approach demonstrated comparable data to a previous study using single mice per time point liquid samples while reducing animal and compound requirements by 14-fold. Reduction in animals and drug material is enabled by the use of automated serial DBS microsampling for mice studies in discovery-stage studies of protein therapeutics.
Quantitative Estimation for the Effectiveness of Automation
International Nuclear Information System (INIS)
Lee, Seung Min; Seong, Poong Hyun
2012-01-01
In advanced MCR, various automation systems are applied to enhance the human performance and reduce the human errors in industrial fields. It is expected that automation provides greater efficiency, lower workload, and fewer human errors. However, these promises are not always fulfilled. As the new types of events related to application of the imperfect and complex automation are occurred, it is required to analyze the effects of automation system for the performance of human operators. Therefore, we suggest the quantitative estimation method to analyze the effectiveness of the automation systems according to Level of Automation (LOA) classification, which has been developed over 30 years. The estimation of the effectiveness of automation will be achieved by calculating the failure probability of human performance related to the cognitive activities
Automating spectral measurements
Goldstein, Fred T.
2008-09-01
This paper discusses the architecture of software utilized in spectroscopic measurements. As optical coatings become more sophisticated, there is mounting need to automate data acquisition (DAQ) from spectrophotometers. Such need is exacerbated when 100% inspection is required, ancillary devices are utilized, cost reduction is crucial, or security is vital. While instrument manufacturers normally provide point-and-click DAQ software, an application programming interface (API) may be missing. In such cases automation is impossible or expensive. An API is typically provided in libraries (*.dll, *.ocx) which may be embedded in user-developed applications. Users can thereby implement DAQ automation in several Windows languages. Another possibility, developed by FTG as an alternative to instrument manufacturers' software, is the ActiveX application (*.exe). ActiveX, a component of many Windows applications, provides means for programming and interoperability. This architecture permits a point-and-click program to act as automation client and server. Excel, for example, can control and be controlled by DAQ applications. Most importantly, ActiveX permits ancillary devices such as barcode readers and XY-stages to be easily and economically integrated into scanning procedures. Since an ActiveX application has its own user-interface, it can be independently tested. The ActiveX application then runs (visibly or invisibly) under DAQ software control. Automation capabilities are accessed via a built-in spectro-BASIC language with industry-standard (VBA-compatible) syntax. Supplementing ActiveX, spectro-BASIC also includes auxiliary serial port commands for interfacing programmable logic controllers (PLC). A typical application is automatic filter handling.
Ask the experts: automation: part I.
Allinson, John L; Blick, Kenneth E; Cohen, Lucinda; Higton, David; Li, Ming
2013-08-01
Bioanalysis invited a selection of leading researchers to express their views on automation in the bioanalytical laboratory. The topics discussed include the challenges that the modern bioanalyst faces when integrating automation into existing drug-development processes, the impact of automation and how they envision the modern bioanalytical laboratory changing in the near future. Their enlightening responses provide a valuable insight into the impact of automation and the future of the constantly evolving bioanalytical laboratory.
An Automation Survival Guide for Media Centers.
Whaley, Roger E.
1989-01-01
Reviews factors that should affect the decision to automate a school media center and offers suggestions for the automation process. Topics discussed include getting the library collection ready for automation, deciding what automated functions are needed, evaluating software vendors, selecting software, and budgeting. (CLB)
Demands on digital automation; Anforderungen an die Digitale Automation
Energy Technology Data Exchange (ETDEWEB)
Bieler, P.
1995-12-31
In chapter 12 of the anthology about building control the demands on digital automation are presented. The following aspects are discussed: variety of the companies` philosophies, demands of the customer/investor, demands of the use of buildings/rooms, the user, point of view of manufacturer of technical plants. (BWI) [Deutsch] Kapitel 12 des Sammelbandes ueber Building Control stellt die Anforderungen an die Digitale Automation vor. In diesem Zusammenhang wird auf folgende Themenbereiche eingegangen: Spektrum der Firmenphilosophien, Forderungen der Auftraggeber/Investoren, der Gebaeude-/Raumnutzung, der Betreiber sowie Sicht der Ersteller betriebstechnischer Anlagen. (BWI)
Disassembly automation automated systems with cognitive abilities
Vongbunyong, Supachai
2015-01-01
This book presents a number of aspects to be considered in the development of disassembly automation, including the mechanical system, vision system and intelligent planner. The implementation of cognitive robotics increases the flexibility and degree of autonomy of the disassembly system. Disassembly, as a step in the treatment of end-of-life products, can allow the recovery of embodied value left within disposed products, as well as the appropriate separation of potentially-hazardous components. In the end-of-life treatment industry, disassembly has largely been limited to manual labor, which is expensive in developed countries. Automation is one possible solution for economic feasibility. The target audience primarily comprises researchers and experts in the field, but the book may also be beneficial for graduate students.
Schmitt, Kara
2012-01-01
Nuclear power is one of the ways that we can design an efficient sustainable future. Automation is the primary system used to assist operators in the task of monitoring and controlling nuclear power plants (NPP). Automation performs tasks such as assessing the status of the plant's operations as well as making real time life critical situational specific decisions. While the advantages and disadvantages of automation are well studied in variety of domains, accidents remind us that there is still vulnerability to unknown variables. This paper will look at the effects of automation within three NPP accidents and incidents and will consider why automation failed in preventing these accidents from occurring. It will also review the accidents at the Three Mile Island, Chernobyl, and Fukushima Daiichi NPP's in order to determine where better use of automation could have resulted in a more desirable outcome.
Rolfe, B A; Athanasas-Platsis, S; Hoskin, M J; Morton, H; Cavanagh, A C
1995-06-01
The immunomodulatory properties of early pregnancy factor (EPF) are mediated through induction of at least two lymphokines, designated EPF-S1 and EPF-S2 (previously estimated M(r) 15,000 and 55,000 respectively). The activity of the former is MHC-restricted while the latter is restricted to a locus (or loci) outside the MHC. The present study established further criteria by which EPF-S1 and EPF-S2 might be distinguished from each other and compared with other suppressor factors. In addition, techniques have been developed to purify EPF-S1 to homogeneity. Congenic mouse strains were used to map the genetic restriction of EPF-S2 in the rosette inhibition test and high performance gel permeation chromatography was used to demonstrate that EPF-S1 induces EPF-S2 but not vice versa. Further studies then focused on isolation of this first component of the cascade, EPF-S1, from immune ascites (from growth in athymic mice of the anti-EPF-S1 producing rat-mouse hybridoma R2T gamma, in which EPF-S1 is complexed to antibody). Techniques used were acidification followed by application to Sep-pak C18 cartridges, high performance cation-exchange chromatography and two reversed-phased HPLC steps on a C3 column. Purified material was analyzed by SDS-PAGE and Edman degradation. Approximately 10 micrograms EPF-S1 were isolated fom 60 ml ascitic fluid. Homogeneity of the purified material was demonstrated by SDS-PAGE, where it ran as a single band of approximate M(r) 12,000 coincident with biological activity. Attempts at Edman degradation indicate that the molecule is N-blocked. Definitive primary characterization of EPF-S1 must await the preparation and isolation of proteolytic fragments of the molecule, but the present studies establish conditions which make such structural analysis possible.
Automated System Marketplace 1994.
Griffiths, Jose-Marie; Kertis, Kimberly
1994-01-01
Reports results of the 1994 Automated System Marketplace survey based on responses from 60 vendors. Highlights include changes in the library automation marketplace; estimated library systems revenues; minicomputer and microcomputer-based systems; marketplace trends; global markets and mergers; research needs; new purchase processes; and profiles…
Automation in Warehouse Development
Hamberg, R.; Verriet, J.
2012-01-01
The warehouses of the future will come in a variety of forms, but with a few common ingredients. Firstly, human operational handling of items in warehouses is increasingly being replaced by automated item handling. Extended warehouse automation counteracts the scarcity of human operators and
Operational proof of automation
International Nuclear Information System (INIS)
Jaerschky, R.; Reifenhaeuser, R.; Schlicht, K.
1976-01-01
Automation of the power plant process may imply quite a number of problems. The automation of dynamic operations requires complicated programmes often interfering in several branched areas. This reduces clarity for the operating and maintenance staff, whilst increasing the possibilities of errors. The synthesis and the organization of standardized equipment have proved very successful. The possibilities offered by this kind of automation for improving the operation of power plants will only sufficiently and correctly be turned to profit, however, if the application of these technics of equipment is further improved and if its volume is tallied with a definite etc. (orig.) [de
Chef infrastructure automation cookbook
Marschall, Matthias
2013-01-01
Chef Infrastructure Automation Cookbook contains practical recipes on everything you will need to automate your infrastructure using Chef. The book is packed with illustrated code examples to automate your server and cloud infrastructure.The book first shows you the simplest way to achieve a certain task. Then it explains every step in detail, so that you can build your knowledge about how things work. Eventually, the book shows you additional things to consider for each approach. That way, you can learn step-by-step and build profound knowledge on how to go about your configuration management
Operational proof of automation
International Nuclear Information System (INIS)
Jaerschky, R.; Schlicht, K.
1977-01-01
Automation of the power plant process may imply quite a number of problems. The automation of dynamic operations requires complicated programmes often interfering in several branched areas. This reduces clarity for the operating and maintenance staff, whilst increasing the possibilities of errors. The synthesis and the organization of standardized equipment have proved very successful. The possibilities offered by this kind of automation for improving the operation of power plants will only sufficiently and correctly be turned to profit, however, if the application of these equipment techniques is further improved and if it stands in a certain ratio with a definite efficiency. (orig.) [de
Future Computer, Communication, Control and Automation
2011 International Conference on Computer, Communication, Control and Automation
2012-01-01
The volume includes a set of selected papers extended and revised from the 2011 International Conference on Computer, Communication, Control and Automation (3CA 2011). 2011 International Conference on Computer, Communication, Control and Automation (3CA 2011) has been held in Zhuhai, China, November 19-20, 2011. This volume topics covered include wireless communications, advances in wireless video, wireless sensors networking, security in wireless networks, network measurement and management, hybrid and discrete-event systems, internet analytics and automation, robotic system and applications, reconfigurable automation systems, machine vision in automation. We hope that researchers, graduate students and other interested readers benefit scientifically from the proceedings and also find it stimulating in the process.
"First generation" automated DNA sequencing technology.
Slatko, Barton E; Kieleczawa, Jan; Ju, Jingyue; Gardner, Andrew F; Hendrickson, Cynthia L; Ausubel, Frederick M
2011-10-01
Beginning in the 1980s, automation of DNA sequencing has greatly increased throughput, reduced costs, and enabled large projects to be completed more easily. The development of automation technology paralleled the development of other aspects of DNA sequencing: better enzymes and chemistry, separation and imaging technology, sequencing protocols, robotics, and computational advancements (including base-calling algorithms with quality scores, database developments, and sequence analysis programs). Despite the emergence of high-throughput sequencing platforms, automated Sanger sequencing technology remains useful for many applications. This unit provides background and a description of the "First-Generation" automated DNA sequencing technology. It also includes protocols for using the current Applied Biosystems (ABI) automated DNA sequencing machines. © 2011 by John Wiley & Sons, Inc.
Introduction matters: Manipulating trust in automation and reliance in automated driving.
Körber, Moritz; Baseler, Eva; Bengler, Klaus
2018-01-01
Trust in automation is a key determinant for the adoption of automated systems and their appropriate use. Therefore, it constitutes an essential research area for the introduction of automated vehicles to road traffic. In this study, we investigated the influence of trust promoting (Trust promoted group) and trust lowering (Trust lowered group) introductory information on reported trust, reliance behavior and take-over performance. Forty participants encountered three situations in a 17-min highway drive in a conditionally automated vehicle (SAE Level 3). Situation 1 and Situation 3 were non-critical situations where a take-over was optional. Situation 2 represented a critical situation where a take-over was necessary to avoid a collision. A non-driving-related task (NDRT) was presented between the situations to record the allocation of visual attention. Participants reporting a higher trust level spent less time looking at the road or instrument cluster and more time looking at the NDRT. The manipulation of introductory information resulted in medium differences in reported trust and influenced participants' reliance behavior. Participants of the Trust promoted group looked less at the road or instrument cluster and more at the NDRT. The odds of participants of the Trust promoted group to overrule the automated driving system in the non-critical situations were 3.65 times (Situation 1) to 5 times (Situation 3) higher. In Situation 2, the Trust promoted group's mean take-over time was extended by 1154 ms and the mean minimum time-to-collision was 933 ms shorter. Six participants from the Trust promoted group compared to no participant of the Trust lowered group collided with the obstacle. The results demonstrate that the individual trust level influences how much drivers monitor the environment while performing an NDRT. Introductory information influences this trust level, reliance on an automated driving system, and if a critical take-over situation can be
Skapura, Robert
1987-01-01
Discusses the use of microcomputers for automating school libraries, both for entire systems and for specific library tasks. Highlights include available library management software, newsletters that evaluate software, constructing an evaluation matrix, steps to consider in library automation, and a brief discussion of computerized card catalogs.…
Simplified MPN method for enumeration of soil naphthalene degraders using gaseous substrate.
Wallenius, Kaisa; Lappi, Kaisa; Mikkonen, Anu; Wickström, Annika; Vaalama, Anu; Lehtinen, Taru; Suominen, Leena
2012-02-01
We describe a simplified microplate most-probable-number (MPN) procedure to quantify the bacterial naphthalene degrader population in soil samples. In this method, the sole substrate naphthalene is dosed passively via gaseous phase to liquid medium and the detection of growth is based on the automated measurement of turbidity using an absorbance reader. The performance of the new method was evaluated by comparison with a recently introduced method in which the substrate is dissolved in inert silicone oil and added individually to each well, and the results are scored visually using a respiration indicator dye. Oil-contaminated industrial soil showed slightly but significantly higher MPN estimate with our method than with the reference method. This suggests that gaseous naphthalene was dissolved in an adequate concentration to support the growth of naphthalene degraders without being too toxic. The dosing of substrate via gaseous phase notably reduced the work load and risk of contamination. The result scoring by absorbance measurement was objective and more reliable than measurement with indicator dye, and it also enabled further analysis of cultures. Several bacterial genera were identified by cloning and sequencing of 16S rRNA genes from the MPN wells incubated in the presence of gaseous naphthalene. In addition, the applicability of the simplified MPN method was demonstrated by a significant positive correlation between the level of oil contamination and the number of naphthalene degraders detected in soil.
GUI test automation for Qt application
Wang, Lei
2015-01-01
GUI test automation is a popular and interesting subject in the testing industry. Many companies plan to start test automation projects in order to implement efficient, less expensive software testing. However, there are challenges for the testing team who lack experience performing GUI tests automation. Many GUI test automation projects have ended in failure due to mistakes made during the early stages of the project. The major work of this thesis is to find a solution to the challenges of e...
Automation synthesis modules review
International Nuclear Information System (INIS)
Boschi, S.; Lodi, F.; Malizia, C.; Cicoria, G.; Marengo, M.
2013-01-01
The introduction of 68 Ga labelled tracers has changed the diagnostic approach to neuroendocrine tumours and the availability of a reliable, long-lived 68 Ge/ 68 Ga generator has been at the bases of the development of 68 Ga radiopharmacy. The huge increase in clinical demand, the impact of regulatory issues and a careful radioprotection of the operators have boosted for extensive automation of the production process. The development of automated systems for 68 Ga radiochemistry, different engineering and software strategies and post-processing of the eluate were discussed along with impact of automation with regulations. - Highlights: ► Generators availability and robust chemistry boosted for the huge diffusion of 68Ga radiopharmaceuticals. ► Different technological approaches for 68Ga radiopharmaceuticals will be discussed. ► Generator eluate post processing and evolution to cassette based systems were the major issues in automation. ► Impact of regulations on the technological development will be also considered
2011-11-09
... DEPARTMENT OF HOMELAND SECURITY U.S. Customs and Border Protection National Customs Automation... announces U.S. Customs and Border Protection's (CBP's) plan to conduct a National Customs Automation Program... conveyance transporting the cargo to the United States. This data will fulfill merchandise entry requirements...
Merritt, Stephanie M; Heimbaugh, Heather; LaChapell, Jennifer; Lee, Deborah
2013-06-01
This study is the first to examine the influence of implicit attitudes toward automation on users' trust in automation. Past empirical work has examined explicit (conscious) influences on user level of trust in automation but has not yet measured implicit influences. We examine concurrent effects of explicit propensity to trust machines and implicit attitudes toward automation on trust in an automated system. We examine differential impacts of each under varying automation performance conditions (clearly good, ambiguous, clearly poor). Participants completed both a self-report measure of propensity to trust and an Implicit Association Test measuring implicit attitude toward automation, then performed an X-ray screening task. Automation performance was manipulated within-subjects by varying the number and obviousness of errors. Explicit propensity to trust and implicit attitude toward automation did not significantly correlate. When the automation's performance was ambiguous, implicit attitude significantly affected automation trust, and its relationship with propensity to trust was additive: Increments in either were related to increases in trust. When errors were obvious, a significant interaction between the implicit and explicit measures was found, with those high in both having higher trust. Implicit attitudes have important implications for automation trust. Users may not be able to accurately report why they experience a given level of trust. To understand why users trust or fail to trust automation, measurements of implicit and explicit predictors may be necessary. Furthermore, implicit attitude toward automation might be used as a lever to effectively calibrate trust.
ENHANCEMENT OF RESISTANCE TO OXIDATIVE DEGRADATION OF NATURAL RUBBER THROUGH LATEX DEGRADATION
Institute of Scientific and Technical Information of China (English)
无
1998-01-01
A fully characterised natural rubber latex was subjected to mechanical degradation by stirring at intervals. The resistance to oxidative degradation of the different samples were studied by measuring the Plasticity retention indices (PRI).The results show that there is an enhancement of the PRI from 57% for the undegraded rubber to 79% for the one-hour degraded sample. Further degradation resulted in decrease of PRI as time of degradation increased. Therefore, the one-hour degraded sample is a special rubber with high oxidation resistance which is of great importance in engineering.
Robotics/Automated Systems Technicians.
Doty, Charles R.
Major resources exist that can be used to develop or upgrade programs in community colleges and technical institutes that educate robotics/automated systems technicians. The first category of resources is Economic, Social, and Education Issues. The Office of Technology Assessment (OTA) report, "Automation and the Workplace," presents analyses of…
Primary structure of Lep d I, the main Lepidoglyphus destructor allergen.
Varela, J; Ventas, P; Carreira, J; Barbas, J A; Gimenez-Gallego, G; Polo, F
1994-10-01
The most relevant allergen of the storage mite Lepidoglyphus destructor (Lep d I) has been characterized. Lep d I is a monomer protein of 13273 Da. The primary structure of Lep d I was determined by N-terminal Edman degradation and partially confirmed by cDNA sequencing. Sequence polymorphism was observed at six positions, with non-conservative substitutions in three of them. No potential N-glycosylation site was revealed by peptide sequencing. The 125-residue sequence of Lep d I shows approximately 40% identity (including the six cysteines) with the overlapping regions of group II allergens from the genus Dermatophagoides, which, however, do not share common allergenic epitopes with Lep d I.
Kleinschmidt, T; Braunitzer, G
1980-01-01
The dimeric hemoglobin CTT VIIA (erythrocruorin) was isolated from the hemolymph of the larva from Chironomus thummi thummi and purified by preparative polyacrylamide gel electrophoresis. Peptides obtained by limited tryptical digestion were sequenced by automatic Edman degradation. For the elucidation of the sequence in the C-terminal region of the chain, additional cleavages with proteinase of Staphylococcus aureus and chymotrypsin were necessary. CTT VIIA is compared with human beta-chains and other hemoglobins of Chironomus. The amino acid residues in the pocket are especially discussed. Most of them are invariant in all Chironomus hemoglobins, independent of the size of the heme pocket, which is normal in some components and enlarged in others.
Evaluation of an Automated Keywording System.
Malone, Linda C.; And Others
1990-01-01
Discussion of automated indexing techniques focuses on ways to statistically document improvements in the development of an automated keywording system over time. The system developed by the Joint Chiefs of Staff to automate the storage, categorization, and retrieval of information from military exercises is explained, and performance measures are…
2012-01-01
This volume Future Control and Automation- Volume 2 includes best papers from 2012 2nd International Conference on Future Control and Automation (ICFCA 2012) held on July 1-2, 2012, Changsha, China. Future control and automation is the use of control systems and information technologies to reduce the need for human work in the production of goods and services. This volume can be divided into six sessions on the basis of the classification of manuscripts considered, which is listed as follows: Mathematical Modeling, Analysis and Computation, Control Engineering, Reliable Networks Design, Vehicular Communications and Networking, Automation and Mechatronics.
Automation for a base station stability testing
Punnek, Elvis
2016-01-01
This Batchelor’s thesis was commissioned by Oy LM Ericsson Ab Oulu. The aim of it was to help to investigate and create a test automation solution for the stability testing of the LTE base station. The main objective was to create a test automation for a predefined test set. This test automation solution had to be created for specific environments and equipment. This work included creating the automation for the test cases and putting them to daily test automation jobs. The key factor...
Al-Shaer, Ehab; Xie, Geoffrey
2013-01-01
In this contributed volume, leading international researchers explore configuration modeling and checking, vulnerability and risk assessment, configuration analysis, and diagnostics and discovery. The authors equip readers to understand automated security management systems and techniques that increase overall network assurability and usability. These constantly changing networks defend against cyber attacks by integrating hundreds of security devices such as firewalls, IPSec gateways, IDS/IPS, authentication servers, authorization/RBAC servers, and crypto systems. Automated Security Managemen
Automation System Products and Research
Rintala, Mikko; Sormunen, Jussi; Kuisma, Petri; Rahkala, Matti
2014-01-01
Automation systems are used in most buildings nowadays. In the past they were mainly used in industry to control and monitor critical systems. During the past few decades the automation systems have become more common and are used today from big industrial solutions to homes of private customers. With the growing need for ecologic and cost-efficient management systems, home and building automation systems are becoming a standard way of controlling lighting, ventilation, heating etc. Auto...
Guidelines for Automation Project Execution
Takkinen, Heidi
2011-01-01
The purpose of this Master’s thesis was to create instructions for executing an automation project. Sarlin Oy Ab needed directions on how to execute an automation project. Sarlin is starting up a new business area offering total project solutions for customers. Sarlin focuses on small and minor automation projects on domestic markets. The thesis represents issues related to project execution starting from the theory of the project to its kick-off and termination. Site work is one importan...
Schutte, Paul; Goodrich, Kenneth; Williams, Ralph
2012-01-01
The control automation and interaction paradigm (e.g., manual, autopilot, flight management system) used on virtually all large highly automated aircraft has long been an exemplar of breakdowns in human factors and human-centered design. An alternative paradigm is the Haptic Flight Control System (HFCS) that is part of NASA Langley Research Center s Naturalistic Flight Deck Concept. The HFCS uses only stick and throttle for easily and intuitively controlling the actual flight of the aircraft without losing any of the efficiency and operational benefits of the current paradigm. Initial prototypes of the HFCS are being evaluated and this paper describes one such evaluation. In this evaluation we examined claims regarding improved situation awareness, appropriate workload, graceful degradation, and improved pilot acceptance. Twenty-four instrument-rated pilots were instructed to plan and fly four different flights in a fictitious airspace using a moderate fidelity desktop simulation. Three different flight control paradigms were tested: Manual control, Full Automation control, and a simplified version of the HFCS. Dependent variables included both subjective (questionnaire) and objective (SAGAT) measures of situation awareness, workload (NASA-TLX), secondary task performance, time to recognize automation failures, and pilot preference (questionnaire). The results showed a statistically significant advantage for the HFCS in a number of measures. Results that were not statistically significant still favored the HFCS. The results suggest that the HFCS does offer an attractive and viable alternative to the tactical components of today s FMS/autopilot control system. The paper describes further studies that are planned to continue to evaluate the HFCS.
Organizational changes and automation: Towards a customer-oriented automation: Part 3
International Nuclear Information System (INIS)
Van Gelder, J.W.
1994-01-01
Automation offers great opportunities in the efforts of energy utilities in the Netherlands to reorganize towards more customer-oriented businesses. However, automation in itself is not enough. First, the organizational structure has to be changed considerably. Various energy utilities have already started on it. The restructuring principle is the same everywhere, but the way it is implemented differs widely. In this article attention is paid to the necessity of realizing an integrated computerized system, which, however, is not feasible at the moment. The second best alternative is to use various computerized systems, capable of two-way data exchange. Two viable approaches are discussed: (1) one operating system on which all automated systems within a company should run, or (2) a selective system linking on the basis of required speed information exchange. Option (2) offers more freedom of selecting the system. 2 figs
You're a What? Automation Technician
Mullins, John
2010-01-01
Many people think of automation as laborsaving technology, but it sure keeps Jim Duffell busy. Defined simply, automation is a technique for making a device run or a process occur with minimal direct human intervention. But the functions and technologies involved in automated manufacturing are complex. Nearly all functions, from orders coming in…
Does Automated Feedback Improve Writing Quality?
Wilson, Joshua; Olinghouse, Natalie G.; Andrada, Gilbert N.
2014-01-01
The current study examines data from students in grades 4-8 who participated in a statewide computer-based benchmark writing assessment that featured automated essay scoring and automated feedback. We examined whether the use of automated feedback was associated with gains in writing quality across revisions to an essay, and with transfer effects…
System reliability, performance and trust in adaptable automation.
Chavaillaz, Alain; Wastell, David; Sauer, Jürgen
2016-01-01
The present study examined the effects of reduced system reliability on operator performance and automation management in an adaptable automation environment. 39 operators were randomly assigned to one of three experimental groups: low (60%), medium (80%), and high (100%) reliability of automation support. The support system provided five incremental levels of automation which operators could freely select according to their needs. After 3 h of training on a simulated process control task (AutoCAMS) in which the automation worked infallibly, operator performance and automation management were measured during a 2.5-h testing session. Trust and workload were also assessed through questionnaires. Results showed that although reduced system reliability resulted in lower levels of trust towards automation, there were no corresponding differences in the operators' reliance on automation. While operators showed overall a noteworthy ability to cope with automation failure, there were, however, decrements in diagnostic speed and prospective memory with lower reliability. Copyright © 2015. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
Mikhajlov, S.P.; Vaulin, S.L.; Shcherbinin, V.E.; Shur, M.L.
1993-01-01
Consideration is given to specific features and possible functions of equipment for automated estimation of stretched continuity defects for samples with plane surface in magnetographic defectoscopy are discussed. Two models of automated magnetographic flow detectors, those with built-in microcomputer and in the form computer attachment, are described. Directions of further researches and development are discussed. 35 refs., 6 figs
Order Division Automated System.
Kniemeyer, Justin M.; And Others
This publication was prepared by the Order Division Automation Project staff to fulfill the Library of Congress' requirement to document all automation efforts. The report was originally intended for internal use only and not for distribution outside the Library. It is now felt that the library community at-large may have an interest in the…
Directory of Open Access Journals (Sweden)
Jazmine Francis
2014-12-01
Full Text Available Myths in automation of software testing is an issue of discussion that echoes about the areas of service in validation of software industry. Probably, the first though that appears in knowledgeable reader would be Why this old topic again? What's New to discuss the matter? But, for the first time everyone agrees that undoubtedly automation testing today is not today what it used to be ten or fifteen years ago, because it has evolved in scope and magnitude. What began as a simple linear scripts for web applications today has a complex architecture and a hybrid framework to facilitate the implementation of testing applications developed with various platforms and technologies. Undoubtedly automation has advanced, but so did the myths associated with it. The change in perspective and knowledge of people on automation has altered the terrain. This article reflects the points of views and experience of the author in what has to do with the transformation of the original myths in new versions, and how they are derived; also provides his thoughts on the new generation of myths.
Directory of Open Access Journals (Sweden)
Jazmine Francis
2015-01-01
Full Text Available Myths in automation of software testing is an issue of discussion that echoes about the areas of service in validation of software industry. Probably, the first though that appears in knowledgeable reader would be Why this old topic again? What's New to discuss the matter? But, for the first time everyone agrees that undoubtedly automation testing today is not today what it used to be ten or fifteen years ago, because it has evolved in scope and magnitude. What began as a simple linear scripts for web applications today has a complex architecture and a hybrid framework to facilitate the implementation of testing applications developed with various platforms and technologies. Undoubtedly automation has advanced, but so did the myths associated with it. The change in perspective and knowledge of people on automation has altered the terrain. This article reflects the points of views and experience of the author in what has to do with the transformation of the original myths in new versions, and how they are derived; also provides his thoughts on the new generation of myths.
Proof-of-concept automation of propellant processing
Ramohalli, Kumar; Schallhorn, P. A.
1989-01-01
For space-based propellant production, automation of the process is needed. Currently, all phases of terrestrial production have some form of human interaction. A mixer was acquired to help perform the tasks of automation. A heating system to be used with the mixer was designed, built, and installed. Tests performed on the heating system verify design criteria. An IBM PS/2 personal computer was acquired for the future automation work. It is hoped that some the mixing process itself will be automated. This is a concept demonstration task; proving that propellant production can be automated reliably.
Automated Test-Form Generation
van der Linden, Wim J.; Diao, Qi
2011-01-01
In automated test assembly (ATA), the methodology of mixed-integer programming is used to select test items from an item bank to meet the specifications for a desired test form and optimize its measurement accuracy. The same methodology can be used to automate the formatting of the set of selected items into the actual test form. Three different…
Context-Aware user interfaces in automation
DEFF Research Database (Denmark)
Olsen, Mikkel Holm
2007-01-01
Automation is deployed in a great range of different domains such as the chemical industry, the production of consumer goods, the production of energy (both in terms of power plants and in the petrochemical industry), transportation and several others. Through several decades the complexity...... of automation systems and the level of automation have been rising. This has caused problems regarding the operator's ability to comprehend the overall situation and state of the automation system, in particular in abnormal situations. The amount of data available to the operator results in information overload....... Since context-aware applications have been developed in other research areas it seems natural to analyze the findings of this research and examine how this can be applied to the domain of automation systems. By evaluating existing architectures for the development of context-aware applications we find...
Automated transit planning, operation, and applications
Liu, Rongfang
2016-01-01
This book analyzes the successful implementations of automated transit in various international locations, such as Paris, Toronto, London, and Kuala Lumpur, and investigates the apparent lack of automated transit applications in the urban environment in the United States. The book begins with a brief definition of automated transit and its historical development. After a thorough description of the technical specifications, the author highlights a few applications from each sub-group of the automated transit spectrum. International case studies display various technologies and their applications, and identify vital factors that affect each system and performance evaluations of existing applications. The book then discusses the planning and operation of automated transit applications at both macro and micro levels. Finally, the book covers a number of less successful concepts, as well as the lessons learned, allow ng readers to gain a comprehensive understanding of the topic.
Participation through Automation: Fully Automated Critical PeakPricing in Commercial Buildings
Energy Technology Data Exchange (ETDEWEB)
Piette, Mary Ann; Watson, David S.; Motegi, Naoya; Kiliccote,Sila; Linkugel, Eric
2006-06-20
California electric utilities have been exploring the use of dynamic critical peak prices (CPP) and other demand response programs to help reduce peaks in customer electric loads. CPP is a tariff design to promote demand response. Levels of automation in DR can be defined as follows: Manual Demand Response involves a potentially labor-intensive approach such as manually turning off or changing comfort set points at each equipment switch or controller. Semi-Automated Demand Response involves a pre-programmed demand response strategy initiated by a person via centralized control system. Fully Automated Demand Response does not involve human intervention, but is initiated at a home, building, or facility through receipt of an external communications signal. The receipt of the external signal initiates pre-programmed demand response strategies. They refer to this as Auto-DR. This paper describes the development, testing, and results from automated CPP (Auto-CPP) as part of a utility project in California. The paper presents the project description and test methodology. This is followed by a discussion of Auto-DR strategies used in the field test buildings. They present a sample Auto-CPP load shape case study, and a selection of the Auto-CPP response data from September 29, 2005. If all twelve sites reached their maximum saving simultaneously, a total of approximately 2 MW of DR is available from these twelve sites that represent about two million ft{sup 2}. The average DR was about half that value, at about 1 MW. These savings translate to about 0.5 to 1.0 W/ft{sup 2} of demand reduction. They are continuing field demonstrations and economic evaluations to pursue increasing penetrations of automated DR that has demonstrated ability to provide a valuable DR resource for California.
Managing laboratory automation
Saboe, Thomas J.
1995-01-01
This paper discusses the process of managing automated systems through their life cycles within the quality-control (QC) laboratory environment. The focus is on the process of directing and managing the evolving automation of a laboratory; system examples are given. The author shows how both task and data systems have evolved, and how they interrelate. A BIG picture, or continuum view, is presented and some of the reasons for success or failure of the various examples cited are explored. Fina...
A thermo-degradable hydrogel with light-tunable degradation and drug release.
Hu, Jingjing; Chen, Yihua; Li, Yunqi; Zhou, Zhengjie; Cheng, Yiyun
2017-01-01
The development of thermo-degradable hydrogels is of great importance in drug delivery. However, it still remains a huge challenge to prepare thermo-degradable hydrogels with inherent degradation, reproducible, repeated and tunable dosing. Here, we reported a thermo-degradable hydrogel that is rapidly degraded above 44 °C by a facile chemistry. Besides thermo-degradability, the hydrogel also undergoes rapid photolysis with ultraviolet light. By embedding photothermal nanoparticles or upconversion nanoparticles into the gel, it can release the entrapped cargoes such as dyes, enzymes and anticancer drugs in an on-demand and dose-tunable fashion upon near-infrared light exposure. The smart hydrogel works well both in vitro and in vivo without involving sophisticated syntheses, and is well suited for clinical cancer therapy due to the high transparency and non-invasiveness features of near-infrared light. Copyright © 2016 Elsevier Ltd. All rights reserved.
Organic matter degradation in Chilean sediments - following nature's own degradation experiment
DEFF Research Database (Denmark)
Langerhuus, Alice Thoft; Niggemann, Jutta; Lomstein, Bente Aagaard
ORGANIC MATTER DEGRADATION IN CHILEAN SEDIMENTS – FOLLOWING NATURE’S OWN DEGRADATION EXPERIMENT Degradation of sedimentary organic matter was studied at two stations from the shelf of the Chilean upwelling region. Sediment cores were taken at 1200 m and 800 m water depth and were 4.5 m and 7.5 m...... in length, respectively. The objective of this study was to assess the degradability of the organic matter from the sediment surface to the deep sediments. This was done by analysing amino acids (both L- and D-isomers) and amino sugars in the sediment cores, covering a timescale of 15.000 years. Diagenetic...... indicators (percentage of carbon and nitrogen present as amino acid carbon and nitrogen, the ratio between a protein precursor and its non-protein degradation product and the percentage of D-amino acids) revealed ongoing degradation in these sediments, indicating that microorganisms were still active in 15...
LIBRARY AUTOMATION IN NIGERAN UNIVERSITIES
African Journals Online (AJOL)
facilitate services and access to information in libraries is widely acceptable. ... Moreover, Ugah (2001) reports that the automation process at the. Abubakar ... blueprint in 1987 and a turn-key system of automation was suggested for the library.
International Nuclear Information System (INIS)
Austin, H.C.; Gray, L.M.
1982-01-01
OASIS has been providing for Oak Ridge National Laboratory's total safeguards needs since being place on line in April 1980. The system supports near real-time nuclear materials safeguards and accountability control. The original design of OASIS called for an automated facsimile of a 741 document to be prepared as a functional by-product of updating the inventory. An attempt was made to utilize, intact, DOE-Albuquerque's automated 741 system to generate the facsimile; however, the five page document produced proved too cumbersome. Albuquerque's programs were modified to print an original 741 document utilizing standard DOE/NRC 741 forms. It is felt that the best features of both the automated and manually generated 741 documents have been incorporated. Automation of the source data for 741 shipping documents produces greater efficiency while reducing possible errors. Through utilization of the standard DOE/NRC form, continuity within the NMMSS system is maintained, thus minimizing the confusion and redundancy associated with facsimiles. OASIS now fulfills the original concept of near real-time accountability by furnishing a viable 741 document as a function of updating the inventory
Individual differences in the calibration of trust in automation.
Pop, Vlad L; Shrewsbury, Alex; Durso, Francis T
2015-06-01
The objective was to determine whether operators with an expectancy that automation is trustworthy are better at calibrating their trust to changes in the capabilities of automation, and if so, why. Studies suggest that individual differences in automation expectancy may be able to account for why changes in the capabilities of automation lead to a substantial change in trust for some, yet only a small change for others. In a baggage screening task, 225 participants searched for weapons in 200 X-ray images of luggage. Participants were assisted by an automated decision aid exhibiting different levels of reliability. Measures of expectancy that automation is trustworthy were used in conjunction with subjective measures of trust and perceived reliability to identify individual differences in trust calibration. Operators with high expectancy that automation is trustworthy were more sensitive to changes (both increases and decreases) in automation reliability. This difference was eliminated by manipulating the causal attribution of automation errors. Attributing the cause of automation errors to factors external to the automation fosters an understanding of tasks and situations in which automation differs in reliability and may lead to more appropriate trust. The development of interventions can lead to calibrated trust in automation. © 2014, Human Factors and Ergonomics Society.
Directory of Open Access Journals (Sweden)
Jaroslav Bursík
2017-01-01
Full Text Available The article focuses on the possibility of automation of taxiing, which is the part of a flight, which, under adverse weather conditions, greatly reduces the operational usability of an airport, and is the only part of a flight that has not been affected by automation, yet. Taxiing is currently handled manually by the pilot, who controls the airplane based on information from visual perception. The article primarily deals with possible ways of obtaining navigational information, and its automatic transfer to the controls. Analyzed wand assessed were currently available technologies such as computer vision, Light Detection and Ranging and Global Navigation Satellite System, which are useful for navigation and their general implementation into an airplane was designed. Obstacles to the implementation were identified, too. The result is a proposed combination of systems along with their installation into airplane’s systems so that it is possible to use the automated taxiing.
Programmable automation systems in PSA
International Nuclear Information System (INIS)
Pulkkinen, U.
1997-06-01
The Finnish safety authority (STUK) requires plant specific PSAs, and quantitative safety goals are set on different levels. The reliability analysis is more problematic when critical safety functions are realized by applying programmable automation systems. Conventional modeling techniques do not necessarily apply to the analysis of these systems, and the quantification seems to be impossible. However, it is important to analyze contribution of programmable automation systems to the plant safety and PSA is the only method with system analytical view over the safety. This report discusses the applicability of PSA methodology (fault tree analyses, failure modes and effects analyses) in the analysis of programmable automation systems. The problem of how to decompose programmable automation systems for reliability modeling purposes is discussed. In addition to the qualitative analysis and structural reliability modeling issues, the possibility to evaluate failure probabilities of programmable automation systems is considered. One solution to the quantification issue is the use of expert judgements, and the principles to apply expert judgements is discussed in the paper. A framework to apply expert judgements is outlined. Further, the impacts of subjective estimates on the interpretation of PSA results are discussed. (orig.) (13 refs.)
How to assess sustainability in automated manufacturing
DEFF Research Database (Denmark)
Dijkman, Teunis Johannes; Rödger, Jan-Markus; Bey, Niki
2015-01-01
The aim of this paper is to describe how sustainability in automation can be assessed. The assessment method is illustrated using a case study of a robot. Three aspects of sustainability assessment in automation are identified. Firstly, we consider automation as part of a larger system...... that fulfills the market demand for a given functionality. Secondly, three aspects of sustainability have to be assessed: environment, economy, and society. Thirdly, automation is part of a system with many levels, with different actors on each level, resulting in meeting the market demand. In this system......, (sustainability) specifications move top-down, which helps avoiding sub-optimization and problem shifting. From these three aspects, sustainable automation is defined as automation that contributes to products that fulfill a market demand in a more sustainable way. The case study presents the carbon footprints...
Automation of coal mining equipment
Energy Technology Data Exchange (ETDEWEB)
Yamada, Ryuji
1986-12-25
Major machines used in the working face include the shearer and the self-advancing frame. The shearer has been changed from the radio-controlled model to the microcomputer operated machine, while automating various functions. In addition, a system for comprehensively examining operating conditions and natural conditions in the working face for further automation. The selfadvancing frame has been modified from the sequence controlled model to the microcomputer aided electrohydraulic control system. In order to proceed further with automation and introduce robotics, detectors, control units and valves must be made smaller in higher reliability. The system will be controlled above the ground in the future, provided that the machines in the working face are remote controlled at the gate while transmitting relevant data above the ground from this system. Thus, automated working face will be realized. (2 figs, 1 photo)
Controls and automation in the SPIRAL project
International Nuclear Information System (INIS)
Bothner, U.; Boulot, A.; Maherault, J.; Martial, L.
1999-01-01
The control and automation team of the R and D of Accelerator-Exotic Beam Department has had in the framework of SPIRAL collaboration the following tasks: 1. automation of the resonator high frequency equipment of the CIME cyclotron; 2. automation of the vacuum equipment, i.e. the low energy line (TBE), the CIME cyclotron, the low energy line (BE); 3. automation of load safety for power supply; 4. for each of these tasks a circuitry file based on the SCHEMA software has been worked out. The programs required in the automation of load safety for power supply (STEP5, PROTOOL, DESIGNER 4.1) were developed and implemented for PC
Automated controlled-potential coulometric determination of uranium
International Nuclear Information System (INIS)
Knight, C.H.; Clegg, D.E.; Wright, K.D.; Cassidy, R.M.
1982-06-01
A controlled-potential coulometer has been automated in our laboratory for routine determination of uranium in solution. The CRNL-designed automated system controls degassing, prereduction, and reduction of the sample. The final result is displayed on a digital coulometer readout. Manual and automated modes of operation are compared to show the precision and accuracy of the automated system. Results are also shown for the coulometric titration of typical uranium-aluminum alloy samples
Office automation: a look beyond word processing
DuBois, Milan Ephriam, Jr.
1983-01-01
Approved for public release; distribution is unlimited Word processing was the first of various forms of office automation technologies to gain widespread acceptance and usability in the business world. For many, it remains the only form of office automation technology. Office automation, however, is not just word processing, although it does include the function of facilitating and manipulating text. In reality, office automation is not one innovation, or one office system, or one tech...
The Employment-Impact of Automation in Canada
McLean, Colin Alexander
2015-01-01
Standard neoclassical models of labour demand predict that automation does not produce long-term increases in unemployment. Supporting evidence in Canada between 1970 and 2008 is explained by the reallocation of labour from industries with high levels of automation such as Manufacturing to industries with low levels of automation such as Retail and Wholesale Trade, and Business Services. Recent evidence indicates however that on-going technological advances are now driving labour automation i...
Energy Technology Data Exchange (ETDEWEB)
Leinders, Suzanne M. [Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands); Delft University of Technology, Delft (Netherlands); Breedveld, Sebastiaan; Méndez Romero, Alejandra [Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands); Schaart, Dennis [Delft University of Technology, Delft (Netherlands); Seppenwoolde, Yvette, E-mail: y.seppenwoolde@erasmusmc.nl [Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands); Heijmen, Ben J.M. [Erasmus Medical Center-Daniel den Hoed Cancer Center, Rotterdam (Netherlands)
2013-12-01
Purpose: To investigate how dose distributions for liver stereotactic body radiation therapy (SBRT) can be improved by using automated, daily plan reoptimization to account for anatomy deformations, compared with setup corrections only. Methods and Materials: For 12 tumors, 3 strategies for dose delivery were simulated. In the first strategy, computed tomography scans made before each treatment fraction were used only for patient repositioning before dose delivery for correction of detected tumor setup errors. In adaptive second and third strategies, in addition to the isocenter shift, intensity modulated radiation therapy beam profiles were reoptimized or both intensity profiles and beam orientations were reoptimized, respectively. All optimizations were performed with a recently published algorithm for automated, multicriteria optimization of both beam profiles and beam angles. Results: In 6 of 12 cases, violations of organs at risk (ie, heart, stomach, kidney) constraints of 1 to 6 Gy in single fractions occurred in cases of tumor repositioning only. By using the adaptive strategies, these could be avoided (<1 Gy). For 1 case, this needed adaptation by slightly underdosing the planning target volume. For 2 cases with restricted tumor dose in the planning phase to avoid organ-at-risk constraint violations, fraction doses could be increased by 1 and 2 Gy because of more favorable anatomy. Daily reoptimization of both beam profiles and beam angles (third strategy) performed slightly better than reoptimization of profiles only, but the latter required only a few minutes of computation time, whereas full reoptimization took several hours. Conclusions: This simulation study demonstrated that replanning based on daily acquired computed tomography scans can improve liver stereotactic body radiation therapy dose delivery.
Complex Automated Negotiations Theories, Models, and Software Competitions
Zhang, Minjie; Robu, Valentin; Matsuo, Tokuro
2013-01-01
Complex Automated Negotiations are a widely studied, emerging area in the field of Autonomous Agents and Multi-Agent Systems. In general, automated negotiations can be complex, since there are a lot of factors that characterize such negotiations. For this book, we solicited papers on all aspects of such complex automated negotiations, which are studied in the field of Autonomous Agents and Multi-Agent Systems. This book includes two parts, which are Part I: Agent-based Complex Automated Negotiations and Part II: Automated Negotiation Agents Competition. Each chapter in Part I is an extended version of ACAN 2011 papers after peer reviews by three PC members. Part II includes ANAC 2011 (The Second Automated Negotiating Agents Competition), in which automated agents who have different negotiation strategies and implemented by different developers are automatically negotiate in the several negotiation domains. ANAC is an international competition in which automated negotiation strategies, submitted by a number of...
Assessing the degradation of compliant electrodes for soft actuators
Rosset, Samuel; de Saint-Aubin, Christine; Poulin, Alexandre; Shea, Herbert R.
2017-10-01
We present an automated system to measure the degradation of compliant electrodes used in dielectric elastomer actuators (DEAs) over millions of cycles. Electrodes for DEAs generally experience biaxial linear strains of more than 10%. The decrease in electrode conductivity induced by this repeated fast mechanical deformation impacts the bandwidth of the actuator and its strain homogeneity. Changes in the electrode mechanical properties lead to reduced actuation strain. Rather than using an external actuator to periodically deform the electrodes, our measurement method consists of measuring the properties of an electrode in an expanding circle DEA. A programmable high voltage power supply drives the actuator with a square signal up to 1 kHz, periodically actuating the DEA, and thus stretching the electrodes. The DEA strain is monitored with a universal serial bus camera, while the resistance of the ground electrode is measured with a multimeter. The system can be used for any type of electrode. We validated the test setup by characterising a carbon black/silicone composite that we commonly use as compliant electrode. Although the composite is well-suited for tens of millions of cycles of actuation below 5%, we observe important degradation for higher deformations. When activated at a 20% radial strain, the electrodes suffer from important damage after a few thousand cycles, and an inhomogeneous actuation is observed, with the strain localised in a sub-region of the actuator only.
Automated Methods of Corrosion Measurements
DEFF Research Database (Denmark)
Andersen, Jens Enevold Thaulov
1997-01-01
. Mechanical control, recording, and data processing must therefore be automated to a high level of precision and reliability. These general techniques and the apparatus involved have been described extensively. The automated methods of such high-resolution microscopy coordinated with computerized...
Human-centered automation: Development of a philosophy
Graeber, Curtis; Billings, Charles E.
1990-01-01
Information on human-centered automation philosophy is given in outline/viewgraph form. It is asserted that automation of aircraft control will continue in the future, but that automation should supplement, not supplant the human management and control function in civil air transport.
A system-level approach to automation research
Harrison, F. W.; Orlando, N. E.
1984-01-01
Automation is the application of self-regulating mechanical and electronic devices to processes that can be accomplished with the human organs of perception, decision, and actuation. The successful application of automation to a system process should reduce man/system interaction and the perceived complexity of the system, or should increase affordability, productivity, quality control, and safety. The expense, time constraints, and risk factors associated with extravehicular activities have led the Automation Technology Branch (ATB), as part of the NASA Automation Research and Technology Program, to investigate the use of robots and teleoperators as automation aids in the context of space operations. The ATB program addresses three major areas: (1) basic research in autonomous operations, (2) human factors research on man-machine interfaces with remote systems, and (3) the integration and analysis of automated systems. This paper reviews the current ATB research in the area of robotics and teleoperators.
International Conference Automation : Challenges in Automation, Robotics and Measurement Techniques
Zieliński, Cezary; Kaliczyńska, Małgorzata
2016-01-01
This book presents the set of papers accepted for presentation at the International Conference Automation, held in Warsaw, 2-4 March of 2016. It presents the research results presented by top experts in the fields of industrial automation, control, robotics and measurement techniques. Each chapter presents a thorough analysis of a specific technical problem which is usually followed by numerical analysis, simulation, and description of results of implementation of the solution of a real world problem. The presented theoretical results, practical solutions and guidelines will be valuable for both researchers working in the area of engineering sciences and for practitioners solving industrial problems. .
Comparison of Automated Graphical User Interface Testing Tools
Gaber, Domen
2018-01-01
The thesis presents the analysis of modern tools for automated testing of various web based user interfaces. The purpose of the work is to compare specific test automation solutions and point out the most suitable test automation tool amongst them. One of the main goals of test automation is to gain faster execution when compared to manual testing and overall cost deduction. There are multiple test automation solutions available on the market, which differ in complexity of use, type of o...
Degradation of microbial polyesters.
Tokiwa, Yutaka; Calabia, Buenaventurada P
2004-08-01
Microbial polyhydroxyalkanoates (PHAs), one of the largest groups of thermoplastic polyesters are receiving much attention as biodegradable substitutes for non-degradable plastics. Poly(D-3-hydroxybutyrate) (PHB) is the most ubiquitous and most intensively studied PHA. Microorganisms degrading these polyesters are widely distributed in various environments. Although various PHB-degrading microorganisms and PHB depolymerases have been studied and characterized, there are still many groups of microorganisms and enzymes with varying properties awaiting various applications. Distributions of PHB-degrading microorganisms, factors affecting the biodegradability of PHB, and microbial and enzymatic degradation of PHB are discussed in this review. We also propose an application of a new isolated, thermophilic PHB-degrading microorganism, Streptomyces strain MG, for producing pure monomers of PHA and useful chemicals, including D-3-hydroxycarboxylic acids such as D-3-hydroxybutyric acid, by enzymatic degradation of PHB.
Automated Visual Inspection of Ship Hull Surfaces Using the Wavelet Transform
Directory of Open Access Journals (Sweden)
Carlos Fernández-Isla
2013-01-01
Full Text Available A new online visual inspection technique is proposed, based on a wavelet reconstruction scheme over images obtained from the hull. This type of visual inspection to detect defects in hull surfaces is commonly carried out at shipyards by human inspectors before the hull repair task starts. We propose the use of Shannon entropy for automatic selection of the band for image reconstruction which provides a low decomposition level, thus avoiding excessive degradation of the image, allowing more precise defect segmentation. The proposed method here is capable of on-line assisting to a robotic system to perform grit blasting operations over damage areas of ship hulls. This solution allows a reliable and cost-effective operation for hull grit spot blasting. A prototype of the automated blasting system has been developed and tested in the Spanish NAVANTIA shipyards.
Wireless Android Based Home Automation System
Directory of Open Access Journals (Sweden)
Muhammad Tanveer Riaz
2017-01-01
Full Text Available This manuscript presents a prototype and design implementation of an advance home automation system that uses Wi-Fi technology as a network infrastructure connecting its parts. The proposed system consists of two main components; the first part is the server, which presents system core that manages and controls user’s home. Users and system administrator can locally (Local Area Network or remotely (internet manage and control the system. Second part is the hardware interface module, which provides appropriate interface to sensors and actuator of home automation system. Unlike most of the available home automation system in the market, the proposed system is scalable that one server can manage many hardware interface modules as long as it exists within network coverage. System supports a wide range of home automation devices like appliances, power management components, and security components. The proposed system is better in terms of the flexibility and scalability than the commercially available home automation systems
Automated processing of endoscopic surgical instruments.
Roth, K; Sieber, J P; Schrimm, H; Heeg, P; Buess, G
1994-10-01
This paper deals with the requirements for automated processing of endoscopic surgical instruments. After a brief analysis of the current problems, solutions are discussed. Test-procedures have been developed to validate the automated processing, so that the cleaning results are guaranteed and reproducable. Also a device for testing and cleaning was designed together with Netzsch Newamatic and PCI, called TC-MIC, to automate processing and reduce manual work.
Highway Electrification And Automation
Shladover, Steven E.
1992-01-01
This report addresses how the California Department of Transportation and the California PATH Program have made efforts to evaluate the feasibility and applicability of highway electrification and automation technologies. In addition to describing how the work was conducted, the report also describes the findings on highway electrification and highway automation, with experimental results, design study results, and a region-wide application impacts study for Los Angeles.
Automated Status Notification System
2005-01-01
NASA Lewis Research Center's Automated Status Notification System (ASNS) was born out of need. To prevent "hacker attacks," Lewis' telephone system needed to monitor communications activities 24 hr a day, 7 days a week. With decreasing staff resources, this continuous monitoring had to be automated. By utilizing existing communications hardware, a UNIX workstation, and NAWK (a pattern scanning and processing language), we implemented a continuous monitoring system.
Hättenschwiler, Nicole; Sterchi, Yanik; Mendes, Marcia; Schwaninger, Adrian
2018-10-01
Bomb attacks on civil aviation make detecting improvised explosive devices and explosive material in passenger baggage a major concern. In the last few years, explosive detection systems for cabin baggage screening (EDSCB) have become available. Although used by a number of airports, most countries have not yet implemented these systems on a wide scale. We investigated the benefits of EDSCB with two different levels of automation currently being discussed by regulators and airport operators: automation as a diagnostic aid with an on-screen alarm resolution by the airport security officer (screener) or EDSCB with an automated decision by the machine. The two experiments reported here tested and compared both scenarios and a condition without automation as baseline. Participants were screeners at two international airports who differed in both years of work experience and familiarity with automation aids. Results showed that experienced screeners were good at detecting improvised explosive devices even without EDSCB. EDSCB increased only their detection of bare explosives. In contrast, screeners with less experience (tenure automated decision provided better human-machine detection performance than on-screen alarm resolution and no automation. This came at the cost of slightly higher false alarm rates on the human-machine system level, which would still be acceptable from an operational point of view. Results indicate that a wide-scale implementation of EDSCB would increase the detection of explosives in passenger bags and automated decision instead of automation as diagnostic aid with on screen alarm resolution should be considered. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.
21 CFR 864.5600 - Automated hematocrit instrument.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated hematocrit instrument. 864.5600 Section 864.5600 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
21 CFR 862.2900 - Automated urinalysis system.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated urinalysis system. 862.2900 Section 862....2900 Automated urinalysis system. (a) Identification. An automated urinalysis system is a device... that duplicate manual urinalysis systems. This device is used in conjunction with certain materials to...
Resins production: batch plant automation
International Nuclear Information System (INIS)
Banti, M.; Mauri, G.
1996-01-01
Companies that look for automation in their plants without external resources, have at their disposal flexible, custom and easy to use DCS, open towards PLC. In this article it is explained why Hoechts has followed this way of new plants for resins production automation
Small cities face greater impact from automation
Sun, Lijun; Cebrian, Manuel; Rahwan, Iyad
2018-01-01
The city has proved to be the most successful form of human agglomeration and provides wide employment opportunities for its dwellers. As advances in robotics and artificial intelligence revive concerns about the impact of automation on jobs, a question looms: how will automation affect employment in cities? Here, we provide a comparative picture of the impact of automation across US urban areas. Small cities will undertake greater adjustments, such as worker displacement and job content substitutions. We demonstrate that large cities exhibit increased occupational and skill specialization due to increased abundance of managerial and technical professions. These occupations are not easily automatable, and, thus, reduce the potential impact of automation in large cities. Our results pass several robustness checks including potential errors in the estimation of occupational automation and subsampling of occupations. Our study provides the first empirical law connecting two societal forces: urban agglomeration and automation's impact on employment. PMID:29436514
Small cities face greater impact from automation.
Frank, Morgan R; Sun, Lijun; Cebrian, Manuel; Youn, Hyejin; Rahwan, Iyad
2018-02-01
The city has proved to be the most successful form of human agglomeration and provides wide employment opportunities for its dwellers. As advances in robotics and artificial intelligence revive concerns about the impact of automation on jobs, a question looms: how will automation affect employment in cities? Here, we provide a comparative picture of the impact of automation across US urban areas. Small cities will undertake greater adjustments, such as worker displacement and job content substitutions. We demonstrate that large cities exhibit increased occupational and skill specialization due to increased abundance of managerial and technical professions. These occupations are not easily automatable, and, thus, reduce the potential impact of automation in large cities. Our results pass several robustness checks including potential errors in the estimation of occupational automation and subsampling of occupations. Our study provides the first empirical law connecting two societal forces: urban agglomeration and automation's impact on employment. © 2018 The Authors.
Space power subsystem automation technology
Graves, J. R. (Compiler)
1982-01-01
The technology issues involved in power subsystem automation and the reasonable objectives to be sought in such a program were discussed. The complexities, uncertainties, and alternatives of power subsystem automation, along with the advantages from both an economic and a technological perspective were considered. Whereas most spacecraft power subsystems now use certain automated functions, the idea of complete autonomy for long periods of time is almost inconceivable. Thus, it seems prudent that the technology program for power subsystem automation be based upon a growth scenario which should provide a structured framework of deliberate steps to enable the evolution of space power subsystems from the current practice of limited autonomy to a greater use of automation with each step being justified on a cost/benefit basis. Each accomplishment should move toward the objectives of decreased requirement for ground control, increased system reliability through onboard management, and ultimately lower energy cost through longer life systems that require fewer resources to operate and maintain. This approach seems well-suited to the evolution of more sophisticated algorithms and eventually perhaps even the use of some sort of artificial intelligence. Multi-hundred kilowatt systems of the future will probably require an advanced level of autonomy if they are to be affordable and manageable.
International Nuclear Information System (INIS)
O'Hara, Matthew J.; Durst, Philip C.; Grate, Jay W.; Devol, Timothy A.; Egorov, Oleg; Clements, John P.
2008-01-01
Identification and quantification of specific alpha- and beta-emitting radionuclides in complex liquid matrices is highly challenging, and is typically accomplished through laborious wet chemical sample preparation and separations followed by analysis using a variety of detection methodologies (e.g., liquid scintillation, gas proportional counting, alpha energy analysis, mass spectrometry). Analytical results may take days or weeks to report. Chains of custody and sample security measures may also complicate or slow the analytical process. When an industrial process-scale plant requires the monitoring of specific radionuclides as an indication of the composition of its feed stream or of plant performance, radiochemical measurements must be fast, accurate, and reliable. Scientists at Pacific Northwest National Laboratory have assembled a fully automated prototype Process Monitor instrument capable of a variety of tasks: automated sampling directly from a feed stream, sample digestion/analyte redox adjustment, chemical separations, radiochemical detection and data analysis/reporting. The system is compact, its components are fluidically inter-linked, and analytical results could be immediately transmitted to on- or off-site locations. The development of a rapid radiochemical Process Monitor for 99Tc in Hanford tank waste processing streams, capable of performing several measurements per hour, will be discussed in detail. More recently, the automated platform was modified to perform measurements of 90Sr in Hanford tank waste stimulant. The system exemplifies how automation could be integrated into reprocessing facilities to support international nuclear safeguards needs
Vieira, Gabriela A L; Magrini, Mariana Juventina; Bonugli-Santos, Rafaella C; Rodrigues, Marili V N; Sette, Lara D
2018-05-03
Pyrene and benzo[a]pyrene (BaP) are high molecular weight polycyclic aromatic hydrocarbons (PAHs) recalcitrant to microbial attack. Although studies related to the microbial degradation of PAHs have been carried out in the last decades, little is known about degradation of these environmental pollutants by fungi from marine origin. Therefore, this study aimed to select one PAHs degrader among three marine-derived basidiomycete fungi and to study its pyrene detoxification/degradation. Marasmiellus sp. CBMAI 1062 showed higher levels of pyrene and BaP degradation and was subjected to studies related to pyrene degradation optimization using experimental design, acute toxicity, organic carbon removal (TOC), and metabolite evaluation. The experimental design resulted in an efficient pyrene degradation, reducing the experiment time while the PAH concentration applied in the assays was increased. The selected fungus was able to degrade almost 100% of pyrene (0.08mgmL -1 ) after 48h of incubation under saline condition, without generating toxic compounds and with a TOC reduction of 17%. Intermediate metabolites of pyrene degradation were identified, suggesting that the fungus degraded the compound via the cytochrome P450 system and epoxide hydrolases. These results highlight the relevance of marine-derived fungi in the field of PAH bioremediation, adding value to the blue biotechnology. Copyright © 2018. Published by Elsevier Editora Ltda.
21 CFR 864.5620 - Automated hemoglobin system.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated hemoglobin system. 864.5620 Section 864.5620 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices § 864...
21 CFR 864.5200 - Automated cell counter.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated cell counter. 864.5200 Section 864.5200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices § 864...
21 CFR 864.5680 - Automated heparin analyzer.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated heparin analyzer. 864.5680 Section 864.5680 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices § 864...
21 CFR 864.5850 - Automated slide spinner.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated slide spinner. 864.5850 Section 864.5850 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices § 864...
Novel insights in agent-based complex automated negotiation
Lopez-Carmona, Miguel; Ito, Takayuki; Zhang, Minjie; Bai, Quan; Fujita, Katsuhide
2014-01-01
This book focuses on all aspects of complex automated negotiations, which are studied in the field of autonomous agents and multi-agent systems. This book consists of two parts. I: Agent-Based Complex Automated Negotiations, and II: Automated Negotiation Agents Competition. The chapters in Part I are extended versions of papers presented at the 2012 international workshop on Agent-Based Complex Automated Negotiation (ACAN), after peer reviews by three Program Committee members. Part II examines in detail ANAC 2012 (The Third Automated Negotiating Agents Competition), in which automated agents that have different negotiation strategies and are implemented by different developers are automatically negotiated in the several negotiation domains. ANAC is an international competition in which automated negotiation strategies, submitted by a number of universities and research institutes across the world, are evaluated in tournament style. The purpose of the competition is to steer the research in the area of bilate...
ERP processes automation in corporate environments
Antonoaie Victor; Irimeş Adrian; Chicoş Lucia-Antoneta
2017-01-01
The automation processes are used in organizations to speed up analyses processes and reduce manual labour. Robotic Automation of IT processes implemented in a modern corporate workspace provides an excellent tool for assisting professionals in making decisions, saving resources and serving as a know-how repository. This study presents the newest trends in process automation, its benefits such as security, ease of use, reduction of overall process duration, and provide examples of SAPERP proj...
Powder handling for automated fuel processing
International Nuclear Information System (INIS)
Frederickson, J.R.; Eschenbaum, R.C.; Goldmann, L.H.
1989-01-01
Installation of the Secure Automated Fabrication (SAF) line has been completed. It is located in the Fuel Cycle Plant (FCP) at the Department of Energy's (DOE) Hanford site near Richland, Washington. The SAF line was designed to fabricate advanced reactor fuel pellets and assemble fuel pins by automated, remote operation. This paper describes powder handling equipment and techniques utilized for automated powder processing and powder conditioning systems in this line. 9 figs
Automation Revolutionize the Business Service Industry
Marciniak, Róbert
2017-01-01
In the last decades significant disruptive changes began with the extended use of automation. Many jobs are changed or disappeared and others were born totally with the automation. Together with the progress of technology, the automation was primarily spread in the industrial sector, mostly in the production and assembly lines. The growth maycontinue in the future further, researchers expect more than 35 million industrial robots globally by 2018.But it shades the situati...
Automated diagnostics scoping study. Final report
Energy Technology Data Exchange (ETDEWEB)
Quadrel, R.W.; Lash, T.A.
1994-06-01
The objective of the Automated Diagnostics Scoping Study was to investigate the needs for diagnostics in building operation and to examine some of the current technologies in automated diagnostics that can address these needs. The study was conducted in two parts. In the needs analysis, the authors interviewed facility managers and engineers at five building sites. In the technology survey, they collected published information on automated diagnostic technologies in commercial and military applications as well as on technologies currently under research. The following describe key areas that the authors identify for the research, development, and deployment of automated diagnostic technologies: tools and techniques to aid diagnosis during building commissioning, especially those that address issues arising from integrating building systems and diagnosing multiple simultaneous faults; technologies to aid diagnosis for systems and components that are unmonitored or unalarmed; automated capabilities to assist cause-and-effect exploration during diagnosis; inexpensive, reliable sensors, especially those that expand the current range of sensory input; technologies that aid predictive diagnosis through trend analysis; integration of simulation and optimization tools with building automation systems to optimize control strategies and energy performance; integration of diagnostic, control, and preventive maintenance technologies. By relating existing technologies to perceived and actual needs, the authors reached some conclusions about the opportunities for automated diagnostics in building operation. Some of a building operator`s needs can be satisfied by off-the-shelf hardware and software. Other needs are not so easily satisfied, suggesting directions for future research. Their conclusions and suggestions are offered in the final section of this study.
Levels of automation and user control - evaluation of a turbine automation interface
Energy Technology Data Exchange (ETDEWEB)
Andersson, Jonas (Chalmers Univ. of Technology (Sweden))
2008-10-15
The study was performed during the annual operator training at the Studsvik nuclear power plant simulator facility in Nykoeping, Sweden. The participating operators came from the Oskarshamn 3 nuclear power plant. In the study, seven nuclear power plant turbine operators were interviewed concerning their use of the automatic turbine system. A field study approach together with a heuristic usability evaluation was made to assess how the operators are affected by use of automation in the control room setting. The purpose of the study was to examine how operator performance is affected by varying levels of automation in nuclear power plant turbine operation. The Automatic Turbine System (ATS) was evaluated to clarify how the ATS interface design supports the operators work. The results show that during manual control the operators experience loss of speed and accuracy in performing actions together with difficulty of dividing attention between performing a task and overall monitoring, as the major problems. The positive aspects of manual operations lie in increased feeling of being in control when performing actions by hand. With higher levels of automation the problems shift to issues concerning difficulty of following the automatic sequences and loosing track in procedures. As the level of automation gets higher, the need of feedback increases which means that information presentation also becomes more important. The use of the semiautomatic, step-mode is often preferred by the operators since it combines the speed and accuracy of the automation with the ability of maintaining the feeling of being in control. Further, a number of usability related concerns was found in the ATS interface. The operators especially experience the presentation of the conditions that manage the automatic sequences as difficult to perceive. (author)
Levels of automation and user control - evaluation of a turbine automation interface
International Nuclear Information System (INIS)
Andersson, Jonas
2008-10-01
The study was performed during the annual operator training at the Studsvik nuclear power plant simulator facility in Nykoeping, Sweden. The participating operators came from the Oskarshamn 3 nuclear power plant. In the study, seven nuclear power plant turbine operators were interviewed concerning their use of the automatic turbine system. A field study approach together with a heuristic usability evaluation was made to assess how the operators are affected by use of automation in the control room setting. The purpose of the study was to examine how operator performance is affected by varying levels of automation in nuclear power plant turbine operation. The Automatic Turbine System (ATS) was evaluated to clarify how the ATS interface design supports the operators work. The results show that during manual control the operators experience loss of speed and accuracy in performing actions together with difficulty of dividing attention between performing a task and overall monitoring, as the major problems. The positive aspects of manual operations lie in increased feeling of being in control when performing actions by hand. With higher levels of automation the problems shift to issues concerning difficulty of following the automatic sequences and loosing track in procedures. As the level of automation gets higher, the need of feedback increases which means that information presentation also becomes more important. The use of the semiautomatic, step-mode is often preferred by the operators since it combines the speed and accuracy of the automation with the ability of maintaining the feeling of being in control. Further, a number of usability related concerns was found in the ATS interface. The operators especially experience the presentation of the conditions that manage the automatic sequences as difficult to perceive. (au)
Future Autonomous and Automated Systems Testbed
National Aeronautics and Space Administration — Trust is the greatest obstacle to implementing greater autonomy and automation (A&A) in the human spaceflight program. The Future Autonomous and Automated...
Fatigue and voluntary utilization of automation in simulated driving.
Neubauer, Catherine; Matthews, Gerald; Langheim, Lisa; Saxby, Dyani
2012-10-01
A driving simulator was used to assess the impact on fatigue, stress, and workload of full vehicle automation that was initiated by the driver. Previous studies have shown that mandatory use of full automation induces a state of "passive fatigue" associated with loss of alertness. By contrast, voluntary use of automation may enhance the driver's perceptions of control and ability to manage fatigue. Participants were assigned to one of two experimental conditions, automation optional (AO) and nonautomation (NA), and then performed a 35 min, monotonous simulated drive. In the last 5 min, automation was unavailable and drivers were required to respond to an emergency event. Subjective state and workload were evaluated before and after the drive. Making automation available to the driver failed to alleviate fatigue and stress states induced by driving in monotonous conditions. Drivers who were fatigued prior to the drive were more likely to choose to use automation, but automation use increased distress, especially in fatigue-prone drivers. Drivers in the AO condition were slower to initiate steering responses to the emergency event, suggesting optional automation may be distracting. Optional, driver-controlled automation appears to pose the same dangers to task engagement and alertness as externally initiated automation. Drivers of automated vehicles may be vulnerable to fatigue that persists when normal vehicle control is restored. It is important to evaluate automated systems' impact on driver fatigue, to seek design solutions to the issue of maintaining driver engagement, and to address the vulnerabilities of fatigue-prone drivers.
Moreno, Antonio
1994-01-01
En este libro se introducen los conceptos básicos en una de las ramas más estudiadas actualmente dentro de la inteligencia artificial: el aprendizaje automático. Se estudian temas como el aprendizaje inductivo, el razonamiento analógico, el aprendizaje basado en explicaciones, las redes neuronales, los algoritmos genéticos, el razonamiento basado en casos o las aproximaciones teóricas al aprendizaje automático.
Instant Sikuli test automation
Lau, Ben
2013-01-01
Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks. A concise guide written in an easy-to follow style using the Starter guide approach.This book is aimed at automation and testing professionals who want to use Sikuli to automate GUI. Some Python programming experience is assumed.
Automated lattice data generation
Ayyar, Venkitesh; Hackett, Daniel C.; Jay, William I.; Neil, Ethan T.
2018-03-01
The process of generating ensembles of gauge configurations (and measuring various observables over them) can be tedious and error-prone when done "by hand". In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.
Designing and implementing test automation frameworks with QTP
Bhargava, Ashish
2013-01-01
A tutorial-based approach, showing basic coding and designing techniques to build test automation frameworks.If you are a beginner, an automation engineer, an aspiring test automation engineer, a manual tester, a test lead or a test architect who wants to learn, create, and maintain test automation frameworks, this book will accelerate your ability to develop and adapt the framework.
Automated data collection in single particle electron microscopy
Tan, Yong Zi; Cheng, Anchi; Potter, Clinton S.; Carragher, Bridget
2016-01-01
Automated data collection is an integral part of modern workflows in single particle electron microscopy (EM) research. This review surveys the software packages available for automated single particle EM data collection. The degree of automation at each stage of data collection is evaluated, and the capabilities of the software packages are described. Finally, future trends in automation are discussed. PMID:26671944
Generic Automated Multi-function Finger Design
Honarpardaz, M.; Tarkian, M.; Sirkett, D.; Ölvander, J.; Feng, X.; Elf, J.; Sjögren, R.
2016-11-01
Multi-function fingers that are able to handle multiple workpieces are crucial in improvement of a robot workcell. Design automation of multi-function fingers is highly demanded by robot industries to overcome the current iterative, time consuming and complex manual design process. However, the existing approaches for the multi-function finger design automation are unable to entirely meet the robot industries’ need. This paper proposes a generic approach for design automation of multi-function fingers. The proposed approach completely automates the design process and requires no expert skill. In addition, this approach executes the design process much faster than the current manual process. To validate the approach, multi-function fingers are successfully designed for two case studies. Further, the results are discussed and benchmarked with existing approaches.
Directory of Open Access Journals (Sweden)
Jay Lee
2013-01-01
Full Text Available As wind energy proliferates in onshore and offshore applications, it has become significantly important to predict wind turbine downtime and maintain operation uptime to ensure maximal yield. Two types of data systems have been widely adopted for monitoring turbine health condition: supervisory control and data acquisition (SCADA and condition monitoring system (CMS. Provided that research and development have focused on advancing analytical techniques based on these systems independently, an intelligent model that associates information from both systems is necessary and beneficial. In this paper, a systematic framework is designed to integrate CMS and SCADA data and assess drivetrain degradation over its lifecycle. Information reference and advanced feature extraction techniques are employed to procure heterogeneous health indicators. A pattern recognition algorithm is used to model baseline behavior and measure deviation of current behavior, where a Self-organizing Map (SOM and minimum quantization error (MQE method is selected to achieve degradation assessment. Eventually, the computation and ranking of component contribution to the detected degradation offers component-level fault localization. When validated and automated by various applications, the approach is able to incorporate diverse data resources and output actionable information to advise predictive maintenance with precise fault information. The approach is validated on a 3 MW offshore turbine, where an incipient fault is detected well before existing system shuts down the unit. A radar chart is used to illustrate the fault localization result.
Identifying Requirements for Effective Human-Automation Teamwork
Energy Technology Data Exchange (ETDEWEB)
Jeffrey C. Joe; John O' Hara; Heather D. Medema; Johanna H. Oxstrand
2014-06-01
Previous studies have shown that poorly designed human-automation collaboration, such as poorly designed communication protocols, often leads to problems for the human operators, such as: lack of vigilance, complacency, and loss of skills. These problems often lead to suboptimal system performance. To address this situation, a considerable amount of research has been conducted to improve human-automation collaboration and to make automation function better as a “team player.” Much of this research is based on an understanding of what it means to be a good team player from the perspective of a human team. However, the research is often based on a simplified view of human teams and teamwork. In this study, we sought to better understand the capabilities and limitations of automation from the standpoint of human teams. We first examined human teams to identify the principles for effective teamwork. We next reviewed the research on integrating automation agents and human agents into mixed agent teams to identify the limitations of automation agents to conform to teamwork principles. This research resulted in insights that can lead to more effective human-automation collaboration by enabling a more realistic set of requirements to be developed based on the strengths and limitations of all agents.
Advanced automation for in-space vehicle processing
Sklar, Michael; Wegerif, D.
1990-01-01
The primary objective of this 3-year planned study is to assure that the fully evolved Space Station Freedom (SSF) can support automated processing of exploratory mission vehicles. Current study assessments show that required extravehicular activity (EVA) and to some extent intravehicular activity (IVA) manpower requirements for required processing tasks far exceeds the available manpower. Furthermore, many processing tasks are either hazardous operations or they exceed EVA capability. Thus, automation is essential for SSF transportation node functionality. Here, advanced automation represents the replacement of human performed tasks beyond the planned baseline automated tasks. Both physical tasks such as manipulation, assembly and actuation, and cognitive tasks such as visual inspection, monitoring and diagnosis, and task planning are considered. During this first year of activity both the Phobos/Gateway Mars Expedition and Lunar Evolution missions proposed by the Office of Exploration have been evaluated. A methodology for choosing optimal tasks to be automated has been developed. Processing tasks for both missions have been ranked on the basis of automation potential. The underlying concept in evaluating and describing processing tasks has been the use of a common set of 'Primitive' task descriptions. Primitive or standard tasks have been developed both for manual or crew processing and automated machine processing.
Automated Assessment in Massive Open Online Courses
Ivaniushin, Dmitrii A.; Shtennikov, Dmitrii G.; Efimchick, Eugene A.; Lyamin, Andrey V.
2016-01-01
This paper describes an approach to use automated assessments in online courses. Open edX platform is used as the online courses platform. The new assessment type uses Scilab as learning and solution validation tool. This approach allows to use automated individual variant generation and automated solution checks without involving the course…
Automation trust and attention allocation in multitasking workspace.
Karpinsky, Nicole D; Chancey, Eric T; Palmer, Dakota B; Yamani, Yusuke
2018-07-01
Previous research suggests that operators with high workload can distrust and then poorly monitor automation, which has been generally inferred from automation dependence behaviors. To test automation monitoring more directly, the current study measured operators' visual attention allocation, workload, and trust toward imperfect automation in a dynamic multitasking environment. Participants concurrently performed a manual tracking task with two levels of difficulty and a system monitoring task assisted by an unreliable signaling system. Eye movement data indicate that operators allocate less visual attention to monitor automation when the tracking task is more difficult. Participants reported reduced levels of trust toward the signaling system when the tracking task demanded more focused visual attention. Analyses revealed that trust mediated the relationship between the load of the tracking task and attention allocation in Experiment 1, an effect that was not replicated in Experiment 2. Results imply a complex process underlying task load, visual attention allocation, and automation trust during multitasking. Automation designers should consider operators' task load in multitasking workspaces to avoid reduced automation monitoring and distrust toward imperfect signaling systems. Copyright © 2018. Published by Elsevier Ltd.
[Automated analyzer of enzyme immunoassay].
Osawa, S
1995-09-01
Automated analyzers for enzyme immunoassay can be classified by several points of view: the kind of labeled antibodies or enzymes, detection methods, the number of tests per unit time, analytical time and speed per run. In practice, it is important for us consider the several points such as detection limits, the number of tests per unit time, analytical range, and precision. Most of the automated analyzers on the market can randomly access and measure samples. I will describe the recent advance of automated analyzers reviewing their labeling antibodies and enzymes, the detection methods, the number of test per unit time and analytical time and speed per test.
Aviation Safety/Automation Program Conference
Morello, Samuel A. (Compiler)
1990-01-01
The Aviation Safety/Automation Program Conference - 1989 was sponsored by the NASA Langley Research Center on 11 to 12 October 1989. The conference, held at the Sheraton Beach Inn and Conference Center, Virginia Beach, Virginia, was chaired by Samuel A. Morello. The primary objective of the conference was to ensure effective communication and technology transfer by providing a forum for technical interchange of current operational problems and program results to date. The Aviation Safety/Automation Program has as its primary goal to improve the safety of the national airspace system through the development and integration of human-centered automation technologies for aircraft crews and air traffic controllers.
Programmable Automated Welding System (PAWS)
Kline, Martin D.
1994-01-01
An ambitious project to develop an advanced, automated welding system is being funded as part of the Navy Joining Center with Babcock & Wilcox as the prime integrator. This program, the Programmable Automated Welding System (PAWS), involves the integration of both planning and real-time control activities. Planning functions include the development of a graphical decision support system within a standard, portable environment. Real-time control functions include the development of a modular, intelligent, real-time control system and the integration of a number of welding process sensors. This paper presents each of these components of the PAWS and discusses how they can be utilized to automate the welding operation.
Kim, Sung Joon; Singh, Manmilan; Sharif, Shasad; Schaefer, Jacob
2017-03-14
We have used solid-state nuclear magnetic resonance to characterize the exact nature of the dual mode of action of oritavancin in preventing cell-wall assembly in Staphylococcus aureus. Measurements performed on whole cells labeled selectively in vivo have established that des-N-methylleucyl-N-4-(4-fluorophenyl)benzyl-chloroeremomycin, an Edman degradation product of [ 19 F]oritavancin, which has a damaged d-Ala-d-Ala binding aglycon, is a potent inhibitor of the transpeptidase activity of cell-wall biosynthesis. The desleucyl drug binds to partially cross-linked peptidoglycan by a cleft formed between the drug aglycon and its biphenyl hydrophobic side chain. This type of binding site is present in other oritavancin-like glycopeptides, which suggests that for these drugs a similar transpeptidase inhibition occurs.
Nonanalytic Laboratory Automation: A Quarter Century of Progress.
Hawker, Charles D
2017-06-01
Clinical laboratory automation has blossomed since the 1989 AACC meeting, at which Dr. Masahide Sasaki first showed a western audience what his laboratory had implemented. Many diagnostics and other vendors are now offering a variety of automated options for laboratories of all sizes. Replacing manual processing and handling procedures with automation was embraced by the laboratory community because of the obvious benefits of labor savings and improvement in turnaround time and quality. Automation was also embraced by the diagnostics vendors who saw automation as a means of incorporating the analyzers purchased by their customers into larger systems in which the benefits of automation were integrated to the analyzers.This report reviews the options that are available to laboratory customers. These options include so called task-targeted automation-modules that range from single function devices that automate single tasks (e.g., decapping or aliquoting) to multifunction workstations that incorporate several of the functions of a laboratory sample processing department. The options also include total laboratory automation systems that use conveyors to link sample processing functions to analyzers and often include postanalytical features such as refrigerated storage and sample retrieval.Most importantly, this report reviews a recommended process for evaluating the need for new automation and for identifying the specific requirements of a laboratory and developing solutions that can meet those requirements. The report also discusses some of the practical considerations facing a laboratory in a new implementation and reviews the concept of machine vision to replace human inspections. © 2017 American Association for Clinical Chemistry.
Measuring Technology and Mechatronics Automation in Electrical Engineering
2012-01-01
Measuring Technology and Mechatronics Automation in Electrical Engineering includes select presentations on measuring technology and mechatronics automation related to electrical engineering, originally presented during the International Conference on Measuring Technology and Mechanatronics Automation (ICMTMA2012). This Fourth ICMTMA, held at Sanya, China, offered a prestigious, international forum for scientists, engineers, and educators to present the state of the art of measuring technology and mechatronics automation research.
Opening up Library Automation Software
Breeding, Marshall
2009-01-01
Throughout the history of library automation, the author has seen a steady advancement toward more open systems. In the early days of library automation, when proprietary systems dominated, the need for standards was paramount since other means of inter-operability and data exchange weren't possible. Today's focus on Application Programming…
Automation for mineral resource development
Energy Technology Data Exchange (ETDEWEB)
Norrie, A.W.; Turner, D.R. (eds.)
1986-01-01
A total of 55 papers were presented at the symposium under the following headings: automation and the future of mining; modelling and control of mining processes; transportation for mining; automation and the future of metallurgical processes; modelling and control of metallurgical processes; and general aspects. Fifteen papers have been abstracted separately.
Translation: Aids, Robots, and Automation.
Andreyewsky, Alexander
1981-01-01
Examines electronic aids to translation both as ways to automate it and as an approach to solve problems resulting from shortage of qualified translators. Describes the limitations of robotic MT (Machine Translation) systems, viewing MAT (Machine-Aided Translation) as the only practical solution and the best vehicle for further automation. (MES)
Automated packing systems: review of industrial implementations
Whelan, Paul F.; Batchelor, Bruce G.
1993-08-01
A rich theoretical background to the problems that occur in the automation of material handling can be found in operations research, production engineering, systems engineering and automation, more specifically machine vision, literature. This work has contributed towards the design of intelligent handling systems. This paper will review the application of these automated material handling and packing techniques to industrial problems. The discussion will also highlight the systems integration issues involved in these applications. An outline of one such industrial application, the automated placement of shape templates on to leather hides, is also discussed. The purpose of this system is to arrange shape templates on a leather hide in an efficient manner, so as to minimize the leather waste, before they are automatically cut from the hide. These pieces are used in the furniture and car manufacturing industries for the upholstery of high quality leather chairs and car seats. Currently this type of operation is semi-automated. The paper will outline the problems involved in the full automation of such a procedure.
2012-01-01
This volume Future Control and Automation- Volume 1 includes best papers selected from 2012 2nd International Conference on Future Control and Automation (ICFCA 2012) held on July 1-2, 2012, Changsha, China. Future control and automation is the use of control systems and information technologies to reduce the need for human work in the production of goods and services. This volume can be divided into five sessions on the basis of the classification of manuscripts considered, which is listed as follows: Identification and Control, Navigation, Guidance and Sensor, Simulation Technology, Future Telecommunications and Control
Automated lattice data generation
Directory of Open Access Journals (Sweden)
Ayyar Venkitesh
2018-01-01
Full Text Available The process of generating ensembles of gauge configurations (and measuring various observables over them can be tedious and error-prone when done “by hand”. In practice, most of this procedure can be automated with the use of a workflow manager. We discuss how this automation can be accomplished using Taxi, a minimal Python-based workflow manager built for generating lattice data. We present a case study demonstrating this technology.
International Nuclear Information System (INIS)
Massaiu, Salvatore; Skjerve, Ann Britt Miberg; Skraaning, Gyrd Jr.; Strand, Stine; Waeroe, Irene
2004-04-01
This report documents the methodological lessons learned from the Human Centred Automation (HCA) programme both in terms of psychometric evaluation of the measurement techniques developed for human-automation interaction study, and in terms of the application of advanced statistical methods for analysis of experiments. The psychometric evaluation is based on data from the four experiments performed within the HCA programme. The result is a single-source reference text of measurement instruments for the study of human-automation interaction, part of which were specifically developed by the programme. The application of advanced statistical techniques is exemplified by additional analyses performed on the IPSN-HCA experiment of 1998. Special importance is given to the statistical technique Structural Equation Modeling, for the possibility it offers to advance, and empirically test, comprehensive explanations about human-automation interactions. The additional analyses of the IPSN-HCA experiment investigated how the operators formed judgments about their own performance. The issue is of substantive interest for human automation interaction research because the operators' over- or underestimation of their own performance could be seen as a symptom of human-machine mismatch, and a potential latent failure. These analyses concluded that it is the interplay between (1) the level of automation and several factors that determines the operators' bias in performance self-estimation: (2) the nature of the task, (3) the level of scenario complexity, and (4) the level of trust in the automatic system. A structural model that expresses the interplay of all these factors was empirically evaluated and was found able to provide a concise and elegant explanation of the intricate pattern of relationships between the identified factors. (Author)
Comparison of vehicle types at an automated container terminal
Vis, I.F.A.; Harika, I.
2004-01-01
At automated container terminals, containers are transshipped from one mode of transportation to another. Automated vehicles transport containers from the stack to the ship and vice versa. Two different types of automated vehicles are studied in this paper, namely automated lifting vehicles and
Wickens, Christopher D; Sebok, Angelia; Li, Huiyang; Sarter, Nadine; Gacy, Andrew M
2015-09-01
The aim of this study was to develop and validate a computational model of the automation complacency effect, as operators work on a robotic arm task, supported by three different degrees of automation. Some computational models of complacency in human-automation interaction exist, but those are formed and validated within the context of fairly simplified monitoring failures. This research extends model validation to a much more complex task, so that system designers can establish, without need for human-in-the-loop (HITL) experimentation, merits and shortcomings of different automation degrees. We developed a realistic simulation of a space-based robotic arm task that could be carried out with three different levels of trajectory visualization and execution automation support. Using this simulation, we performed HITL testing. Complacency was induced via several trials of correctly performing automation and then was assessed on trials when automation failed. Following a cognitive task analysis of the robotic arm operation, we developed a multicomponent model of the robotic operator and his or her reliance on automation, based in part on visual scanning. The comparison of model predictions with empirical results revealed that the model accurately predicted routine performance and predicted the responses to these failures after complacency developed. However, the scanning models do not account for the entire attention allocation effects of complacency. Complacency modeling can provide a useful tool for predicting the effects of different types of imperfect automation. The results from this research suggest that focus should be given to supporting situation awareness in automation development. © 2015, Human Factors and Ergonomics Society.
Merat, Natasha; Lee, John D
2012-10-01
This special section brings together diverse research regarding driver interaction with advanced automotive technology to guide design of increasingly automated vehicles. Rapidly evolving vehicle automation will likely change cars and trucks more in the next 5 years than the preceding 50, radically redefining what it means to drive. This special section includes 10 articles from European and North American researchers reporting simulator and naturalistic driving studies. Little research has considered the consequences of fully automated driving, with most focusing on lane-keeping and speed control systems individually. The studies reveal two underlying design philosophies: automate driving versus support driving. Results of several studies, consistent with previous research in other domains, suggest that the automate philosophy can delay driver responses to incidents in which the driver has to intervene and take control from the automation. Understanding how to orchestrate the transfer or sharing of control between the system and the driver, particularly in critical incidents, emerges as a central challenge. Designers should not assume that automation can substitute seamlessly for a human driver, nor can they assume that the driver can safely accommodate the limitations of automation. Designers, policy makers, and researchers must give careful consideration to what role the person should have in highly automated vehicles and how to support the driver if the driver is to be responsible for vehicle control. As in other domains, driving safety increasingly depends on the combined performance of the human and automation, and successful designs will depend on recognizing and supporting the new roles of the driver.
Degradation Capability of n-hexadecane Degrading Bacteria from Petroleum Contaminated Soils
Directory of Open Access Journals (Sweden)
PENG Huai-li
2017-05-01
Full Text Available Samplings were performed in the petroleum contaminated soils of Dongying, Shandong Province of China. Degrading bacteria was isolated through enrichment in a Bushnel-Hass medium, with n-hexadecane as the sole source of carbon and energy. Then the isolated strains were identified by amplification of 16S rDNA gene and sequencing. The strain TZSX2 was selected as the powerful bacteria with stronger degradation ability, which was then identified as Rhodococcus hoagii genera based on the constructing results of the phylogenetic tree. The optimum temperature that allowed both high growth and efficient degradation ratio was in the scope of 28~36 ℃, and gas chromatography results showed that approximately more than 30% of n-hexadecane could be degraded in one week of incubation within the temperature range. Moreover, the strain TZSX2 was able to grow in high concentrations of n-hexadecane. The degradation rate reached 79% when the initial n-hexadecane concentration was 2 mL·L-1,while it still achieved 12% with n-hexadecane concentration of 20 mL·L-1. The optimal pH was 9 that allowed the highest growth and the greatest degradation rate of 91%. Above all, the screened strain TZSX2 showed high capabilities of alkali tolerance with excellent degradation efficiency for even high concentration of n-hexadecane, and thus it would be quite suitable for the remediation of petroleum contaminated soils especially in the extreme environment.
Automation of orders in taxi service
Simčič, Matej
2012-01-01
Automation is rapidly growing in the last years. The advantages it brings are cost reduction, faster and better performance of tasks that would be otherwise done by humas. It began in the manufacturing industry and later expanded to other sectors. Today's technology allows the implementation of automation in a wide range of areas. The thesis deals with the implementation of a system that allows automated ordering of a taxi. The system consists of four components. They are two mobile app...
Migration monitoring with automated technology
Rhonda L. Millikin
2005-01-01
Automated technology can supplement ground-based methods of migration monitoring by providing: (1) unbiased and automated sampling; (2) independent validation of current methods; (3) a larger sample area for landscape-level analysis of habitat selection for stopover, and (4) an opportunity to study flight behavior. In particular, radar-acoustic sensor fusion can...
Automated evaluation of ultrasonic indications
International Nuclear Information System (INIS)
Hansch, M.K.T.; Stegemann, D.
1994-01-01
Future requirements of reliability and reproducibility in quality assurance demand computer evaluation of defect indications. The ultrasonic method with its large field of applications and a high potential for automation provides all preconditions for fully automated inspection. The survey proposes several desirable hardware improvements, data acquisition requirements and software configurations. (orig.) [de
Nielsen, Patricia Switten; Riber-Hansen, Rikke; Schmidt, Henrik; Steiniche, Torben
2016-04-09
Staging of melanoma includes quantification of a proliferation index, i.e., presumed melanocytic mitoses of H&E stains are counted manually in hot spots. Yet, its reproducibility and prognostic impact increases by immunohistochemical dual staining for phosphohistone H3 (PHH3) and MART1, which also may enable fully automated quantification by image analysis. To ensure manageable workloads and repeatable measurements in modern pathology, the study aimed to present an automated quantification of proliferation with automated hot-spot selection in PHH3/MART1-stained melanomas. Formalin-fixed, paraffin-embedded tissue from 153 consecutive stage I/II melanoma patients was immunohistochemically dual-stained for PHH3 and MART1. Whole slide images were captured, and the number of PHH3/MART1-positive cells was manually and automatically counted in the global tumor area and in a manually and automatically selected hot spot, i.e., a fixed 1-mm(2) square. Bland-Altman plots and hypothesis tests compared manual and automated procedures, and the Cox proportional hazards model established their prognostic impact. The mean difference between manual and automated global counts was 2.9 cells/mm(2) (P = 0.0071) and 0.23 cells per hot spot (P = 0.96) for automated counts in manually and automatically selected hot spots. In 77 % of cases, manual and automated hot spots overlapped. Fully manual hot-spot counts yielded the highest prognostic performance with an adjusted hazard ratio of 5.5 (95 % CI, 1.3-24, P = 0.024) as opposed to 1.3 (95 % CI, 0.61-2.9, P = 0.47) for automated counts with automated hot spots. The automated index and automated hot-spot selection were highly correlated to their manual counterpart, but altogether their prognostic impact was noticeably reduced. Because correct recognition of only one PHH3/MART1-positive cell seems important, extremely high sensitivity and specificity of the algorithm is required for prognostic purposes. Thus, automated
Adaptive Automation Based on Air Traffic Controller Decision-Making
IJtsma (Student TU Delft), Martijn; Borst, C.; Mercado Velasco, G.A.; Mulder, M.; van Paassen, M.M.; Tsang, P.S.; Vidulich, M.A.
2017-01-01
Through smart scheduling and triggering of automation support, adaptive automation has the potential to balance air traffic controller workload. The challenge in the design of adaptive automation systems is to decide how and when the automation should provide support. This paper describes the design
van Ree, R; Hoffman, D R; van Dijk, W; Brodard, V; Mahieu, K; Koeleman, C A; Grande, M; van Leeuwen, W A; Aalberse, R C
1995-05-01
Monoclonal antibodies were obtained against an unknown allergen from Lolium perenne grass pollen. The allergen had an apparent molecular mass of 18 kd on sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Earlier immunoblotting studies had shown that carbohydrate-specific IgG antibodies recognize an antigen of similar size. We sought to characterize the allergen biochemically and immunologically. The amino acid sequence of the allergen was determined by automated Edman degradation, and its monosaccharide composition was determined by gas chromatographic analysis. A panel of 270 grass pollen-positive sera was assessed in a RAST with the purified allergen. Protease digestion (proteinase K) and chemical deglycosylation (trifluoromethane sulfonic acid) were used to distinguish between carbohydrate and peptide epitopes for IgE antibodies. The allergen was shown to be a glycoprotein with a molecular mass of 16 kd, of which 8% is carbohydrate. Its amino acid sequence shares 32% homology with soybean trypsin inhibitor (Kunitz) but lacks its active site. No homology was found with known grass pollen allergens, hence it was designated Lol p XI. A high degree of homology (44%) was found with a tree pollen allergen, Ole e I, the major allergen of olive pollen. More than 65% of grass pollen-positive sera had IgE against Lol p XI. IgE reactivity was demonstrated both with the carbohydrate moiety and the peptide backbone. Lol p XI is a new major grass pollen allergen carrying an IgE-binding carbohydrate determinant. Lol p XI is structurally related to the major allergen from olive pollen.
International Nuclear Information System (INIS)
Thim, L.; Bjoern, S.; Christensen, M.; Nicolaisen, E.M.; Lund-Hansen, T.; Pedersen, A.H.; Hedner, U.
1988-01-01
Blood coagulation factor VII is a vitamin K dependent glycoprotein which in its activated form, factor VII a , participates in the coagulation process by activating factor X and/or factor IX in the presence of Ca 2+ and tissue factor. Three types of potential posttranslational modifications exist in the human factor VII a molecule, namely, 10 γ-carboxylated, N-terminally located glutamic acid residues, 1 β-hydroxylated aspartic acid residue, and 2 N-glycosylated asparagine residues. In the present study, the amino acid sequence and posttranslational modifications of recombinant factor VII a as purified from the culture medium of a transfected baby hamster kidney cell line have been compared to human plasma factor VII a . By use of HPLC, amino acid analysis, peptide mapping, and automated Edman degradation, the protein backbone of recombinant factor VII a was found to be identical with human factor VII a . Asparagine residues 145 and 322 were found to be fully N-glycosylated in human plasma factor VII a . In the recombinant factor VII a , asparagine residue 322 was fully glycosylated whereas asparagine residue 145 was only partially (approximately 66%) glycosylated. Besides minor differences in the sialic acid and fucose contents, the overall carbohydrate compositions were nearly identical in recombinant factor VII a and human plasma factor VII a . These results show that factor VII a as produced in the transfected baby hamster kidney cells is very similar to human plasma factor VII a and that this cell line thus might represent an alternative source for human factor VII a
An Intelligent Automation Platform for Rapid Bioprocess Design.
Wu, Tianyi; Zhou, Yuhong
2014-08-01
Bioprocess development is very labor intensive, requiring many experiments to characterize each unit operation in the process sequence to achieve product safety and process efficiency. Recent advances in microscale biochemical engineering have led to automated experimentation. A process design workflow is implemented sequentially in which (1) a liquid-handling system performs high-throughput wet lab experiments, (2) standalone analysis devices detect the data, and (3) specific software is used for data analysis and experiment design given the user's inputs. We report an intelligent automation platform that integrates these three activities to enhance the efficiency of such a workflow. A multiagent intelligent architecture has been developed incorporating agent communication to perform the tasks automatically. The key contribution of this work is the automation of data analysis and experiment design and also the ability to generate scripts to run the experiments automatically, allowing the elimination of human involvement. A first-generation prototype has been established and demonstrated through lysozyme precipitation process design. All procedures in the case study have been fully automated through an intelligent automation platform. The realization of automated data analysis and experiment design, and automated script programming for experimental procedures has the potential to increase lab productivity. © 2013 Society for Laboratory Automation and Screening.
Inventory management and reagent supply for automated chemistry.
Kuzniar, E
1999-08-01
Developments in automated chemistry have kept pace with developments in HTS such that hundreds of thousands of new compounds can be rapidly synthesized in the belief that the greater the number and diversity of compounds that can be screened, the more successful HTS will be. The increasing use of automation for Multiple Parallel Synthesis (MPS) and the move to automated combinatorial library production is placing an overwhelming burden on the management of reagents. Although automation has improved the efficiency of the processes involved in compound synthesis, the bottleneck has shifted to ordering, collating and preparing reagents for automated chemistry resulting in loss of time, materials and momentum. Major efficiencies have already been made in the area of compound management for high throughput screening. Most of these efficiencies have been achieved with sophisticated library management systems using advanced engineering and data handling for the storage, tracking and retrieval of millions of compounds. The Automation Partnership has already provided many of the top pharmaceutical companies with modular automated storage, preparation and retrieval systems to manage compound libraries for high throughput screening. This article describes how these systems may be implemented to solve the specific problems of inventory management and reagent supply for automated chemistry.
Automated methods of corrosion measurement
DEFF Research Database (Denmark)
Andersen, Jens Enevold Thaulov; Bech-Nielsen, Gregers; Reeve, John Ch
1997-01-01
to revise assumptions regarding the basis of the method, which sometimes leads to the discovery of as-yet unnoticed phenomena. The present selection of automated methods for corrosion measurements is not motivated simply by the fact that a certain measurement can be performed automatically. Automation...... is applied to nearly all types of measurements today....
AUTOMATING ASSET KNOWLEDGE WITH MTCONNECT.
Venkatesh, Sid; Ly, Sidney; Manning, Martin; Michaloski, John; Proctor, Fred
2016-01-01
In order to maximize assets, manufacturers should use real-time knowledge garnered from ongoing and continuous collection and evaluation of factory-floor machine status data. In discrete parts manufacturing, factory machine monitoring has been difficult, due primarily to closed, proprietary automation equipment that make integration difficult. Recently, there has been a push in applying the data acquisition concepts of MTConnect to the real-time acquisition of machine status data. MTConnect is an open, free specification aimed at overcoming the "Islands of Automation" dilemma on the shop floor. With automated asset analysis, manufacturers can improve production to become lean, efficient, and effective. The focus of this paper will be on the deployment of MTConnect to collect real-time machine status to automate asset management. In addition, we will leverage the ISO 22400 standard, which defines an asset and quantifies asset performance metrics. In conjunction with these goals, the deployment of MTConnect in a large aerospace manufacturing facility will be studied with emphasis on asset management and understanding the impact of machine Overall Equipment Effectiveness (OEE) on manufacturing.
Automated ultrasonic inspection using PULSDAT
International Nuclear Information System (INIS)
Naybour, P.J.
1992-01-01
PULSDAT (Portable Ultrasonic Data Acquisition Tool) is a system for recording the data from single probe automated ultrasonic inspections. It is one of a range of instruments and software developed by Nuclear Electric to carry out a wide variety of high quality ultrasonic inspections. These vary from simple semi-automated inspections through to multi-probe, highly automated ones. PULSDAT runs under the control of MIPS software, and collects data which is compatible with the GUIDE data display system. PULSDAT is therefore fully compatible with Nuclear Electric's multi-probe inspection systems and utilises all the reliability and quality assurance of the software. It is a rugged, portable system that can be used in areas of difficult access. The paper discusses the benefits of automated inspection and gives an outline of the main features of PULSDAT. Since April 1990 PULSDAT has been used in several applications within Nuclear Electric and this paper presents two examples: the first is a ferritic set-through nozzle and the second is an austenitic fillet weld. (Author)
Marketing automation supporting sales
Sandell, Niko
2016-01-01
The past couple of decades has been a time of major changes in marketing. Digitalization has become a permanent part of marketing and at the same time enabled efficient collection of data. Personalization and customization of content are playing a crucial role in marketing when new customers are acquired. This has also created a need for automation to facilitate the distribution of targeted content. As a result of successful marketing automation more information of the customers is gathered ...
Fatigue analysis through automated cycle counting using ThermAND
International Nuclear Information System (INIS)
Burton, G.R.; Ding, Y.; Scovil, A.; Yetisir, M.
2008-01-01
The potential for fatigue damage due to thermal transients is one of the degradation mechanisms that needs to be managed for plant components. The original design of CANDU stations accounts for projected fatigue usage for specific components over a specified design lifetime. Fatigue design calculations were based on estimates of the number and severity of expected transients for 30 years operation at 80% power. Many CANDU plants are now approaching the end of their design lives and are being considered for extended operation. Industry practice is to have a comprehensive fatigue management program in place for extended operation beyond the original design life. A CANDU-specific framework for fatigue management has recently been developed to identify the options for implementation, and the critical components and locations requiring long-term fatigue monitoring. An essential element of fatigue monitoring is to identify, count and monitor the number of plant transients to ensure that the number assumed in the original design is not exceeded. The number and severity of actual CANDU station thermal transients at key locations in critical systems have been assessed using ThermAND, AECL's health monitor for systems and components, based on archived station operational data. The automated cycle counting has demonstrated that actual transients are generally less numerous than the quantity assumed in the design basis, and are almost always significantly less severe. This paper will discuss the methodology to adapt ThermAND for automated cycle counting of specific system transients, illustrate and test this capability for cycle-based fatigue monitoring using CANDU station data, report the results, and provide data for stress-based fatigue calculations. (author)
ERP processes automation in corporate environments
Directory of Open Access Journals (Sweden)
Antonoaie Victor
2017-01-01
Full Text Available The automation processes are used in organizations to speed up analyses processes and reduce manual labour. Robotic Automation of IT processes implemented in a modern corporate workspace provides an excellent tool for assisting professionals in making decisions, saving resources and serving as a know-how repository. This study presents the newest trends in process automation, its benefits such as security, ease of use, reduction of overall process duration, and provide examples of SAPERP projects where this technology was implemented and meaningful impact was obtained.
Bennett, Sarah M; Arumugam, Meera; Wilberforce, Samuel; Enea, Davide; Rushton, Neil; Zhang, Xiang C; Best, Serena M; Cameron, Ruth E; Brooks, Roger A
2016-11-01
This paper reports the effect of particle size within a resorbable composite on the in vivo degradation rate and host response. Resorbable composites based on poly(d,l-lactide-co-glycolide) (PLGA) reinforced with tricalcium phosphate (TCP) have shown suitable degradation, biological and mechanical properties for bone repair. Composites with nano-sized TCP particles degrade more homogenously in vitro than equivalent composites with micro-sized particles. In this study, PLGA and PLGA/TCP composites containing micro- or nano-sized α-TCP particles were implanted into an ovine distal femoral condyle defect and harvested at 6, 12, 18 and 24weeks. An intimate interface was observed between the new bone tissue and degrading implants. Visual scoring of histological images and semi-automated segmentation of X-ray images were used to quantify implant degradation and the growth of new bone tissue in the implant site. Bone growth into the implant site occurred at a similar rate for both composites and the PLGA control. However, the in vivo degradation rate of the nanocomposite was slower than that of the microcomposite and consequently more closely matched the rate of bone growth. For the first 6weeks, the rate of in vivo degradation matched that of in vitro degradation, but lagged significantly at longer time points. These results point to the potential use of ceramic particle size in controlling composite degradation whilst maintaining good bone formation. This paper concerns degradable composites for orthopaedic application. The effect of particle size on implant degradation in vivo is not yet well characterised and these results give the first opportunity to directly compare in vitro and in vivo degradation rates for composites with micro- and nano-sized particles. This type of data is vital for the validation of models of composite degradation behaviour, which will lead to the design and manufacture of composites with a tailored, predictable degradation profile. The
International Nuclear Information System (INIS)
D. Kicker
2004-01-01
Degradation of underground openings as a function of time is a natural and expected occurrence for any subsurface excavation. Over time, changes occur to both the stress condition and the strength of the rock mass due to several interacting factors. Once the factors contributing to degradation are characterized, the effects of drift degradation can typically be mitigated through appropriate design and maintenance of the ground support system. However, for the emplacement drifts of the geologic repository at Yucca Mountain, it is necessary to characterize drift degradation over a 10,000-year period, which is well beyond the functional period of the ground support system. This document provides an analysis of the amount of drift degradation anticipated in repository emplacement drifts for discrete events and time increments extending throughout the 10,000-year regulatory period for postclosure performance. This revision of the drift degradation analysis was developed to support the license application and fulfill specific agreement items between the U.S. Nuclear Regulatory Commission (NRC) and the U.S. Department of Energy (DOE). The earlier versions of ''Drift Degradation Analysis'' (BSC 2001 [DIRS 156304]) relied primarily on the DRKBA numerical code, which provides for a probabilistic key-block assessment based on realistic fracture patterns determined from field mapping in the Exploratory Studies Facility (ESF) at Yucca Mountain. A key block is defined as a critical block in the surrounding rock mass of an excavation, which is removable and oriented in an unsafe manner such that it is likely to move into an opening unless support is provided. However, the use of the DRKBA code to determine potential rockfall data at the repository horizon during the postclosure period has several limitations: (1) The DRKBA code cannot explicitly apply dynamic loads due to seismic ground motion. (2) The DRKBA code cannot explicitly apply loads due to thermal stress. (3) The DRKBA
Energy Technology Data Exchange (ETDEWEB)
D. Kicker
2004-09-16
Degradation of underground openings as a function of time is a natural and expected occurrence for any subsurface excavation. Over time, changes occur to both the stress condition and the strength of the rock mass due to several interacting factors. Once the factors contributing to degradation are characterized, the effects of drift degradation can typically be mitigated through appropriate design and maintenance of the ground support system. However, for the emplacement drifts of the geologic repository at Yucca Mountain, it is necessary to characterize drift degradation over a 10,000-year period, which is well beyond the functional period of the ground support system. This document provides an analysis of the amount of drift degradation anticipated in repository emplacement drifts for discrete events and time increments extending throughout the 10,000-year regulatory period for postclosure performance. This revision of the drift degradation analysis was developed to support the license application and fulfill specific agreement items between the U.S. Nuclear Regulatory Commission (NRC) and the U.S. Department of Energy (DOE). The earlier versions of ''Drift Degradation Analysis'' (BSC 2001 [DIRS 156304]) relied primarily on the DRKBA numerical code, which provides for a probabilistic key-block assessment based on realistic fracture patterns determined from field mapping in the Exploratory Studies Facility (ESF) at Yucca Mountain. A key block is defined as a critical block in the surrounding rock mass of an excavation, which is removable and oriented in an unsafe manner such that it is likely to move into an opening unless support is provided. However, the use of the DRKBA code to determine potential rockfall data at the repository horizon during the postclosure period has several limitations: (1) The DRKBA code cannot explicitly apply dynamic loads due to seismic ground motion. (2) The DRKBA code cannot explicitly apply loads due to thermal
12 CFR 205.16 - Disclosures at automated teller machines.
2010-01-01
... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Disclosures at automated teller machines. 205... SYSTEM ELECTRONIC FUND TRANSFERS (REGULATION E) § 205.16 Disclosures at automated teller machines. (a) Definition. Automated teller machine operator means any person that operates an automated teller machine at...
Ji, Xiangyu; Xu, Jing; Ning, Shuxiang; Li, Nan; Tan, Liang; Shi, Shengnan
2017-12-01
Comamonas sp. JB was used to investigate the cometabolic degradation of dibenzofuran (DBF) and dibenzothiophene (DBT) with naphthalene as the primary substrate. Dehydrogenase and ATPase activity of the growing system with the presence of DBF and DBT were decreased when compared to only naphthalene in the growing system, indicating that the presence of DBF and DBT inhibited the metabolic activity of strain JB. The pathways and enzymes involved in the cometabolic degradation were tested. Examination of metabolites elucidated that strain JB cometabolically degraded DBF to 1,2-dihydroxydibenzofuran, subsequently to 2-hydroxy-4-(3'-oxo-3'H-benzofuran-2'-yliden)but-2-enoic acid, and finally to catechol. Meanwhile, strain JB cometabolically degraded DBT to 1,2-dihydroxydibenzothiophene and subsequently to the ring cleavage product. A series of naphthalene-degrading enzymes including naphthalene dioxygenase, 1,2-dihydroxynaphthalene dioxygenase, salicylaldehyde dehydrogenase, salicylate hydroxylase, and catechol 2,3-oxygenase have been detected, confirming that naphthalene was the real inducer of expression the degradation enzymes and metabolic pathways were controlled by naphthalene-degrading enzymes.
Automated data acquisition technology development:Automated modeling and control development
Romine, Peter L.
1995-01-01
This report documents the completion of, and improvements made to, the software developed for automated data acquisition and automated modeling and control development on the Texas Micro rackmounted PC's. This research was initiated because a need was identified by the Metal Processing Branch of NASA Marshall Space Flight Center for a mobile data acquisition and data analysis system, customized for welding measurement and calibration. Several hardware configurations were evaluated and a PC based system was chosen. The Welding Measurement System (WMS), is a dedicated instrument strickly for use of data acquisition and data analysis. In addition to the data acquisition functions described in this thesis, WMS also supports many functions associated with process control. The hardware and software requirements for an automated acquisition system for welding process parameters, welding equipment checkout, and welding process modeling were determined in 1992. From these recommendations, NASA purchased the necessary hardware and software. The new welding acquisition system is designed to collect welding parameter data and perform analysis to determine the voltage versus current arc-length relationship for VPPA welding. Once the results of this analysis are obtained, they can then be used to develop a RAIL function to control welding startup and shutdown without torch crashing.
Logistic control in automated transportation networks
Ebben, Mark
2001-01-01
Increasing congestion problems lead to a search for alternative transportation systems. Automated transportation networks, possibly underground, are an option. Logistic control systems are essential for future implementations of such automated transportation networks. This book contributes to the
Automated Methods Of Corrosion Measurements
DEFF Research Database (Denmark)
Bech-Nielsen, Gregers; Andersen, Jens Enevold Thaulov; Reeve, John Ch
1997-01-01
The chapter describes the following automated measurements: Corrosion Measurements by Titration, Imaging Corrosion by Scanning Probe Microscopy, Critical Pitting Temperature and Application of the Electrochemical Hydrogen Permeation Cell.......The chapter describes the following automated measurements: Corrosion Measurements by Titration, Imaging Corrosion by Scanning Probe Microscopy, Critical Pitting Temperature and Application of the Electrochemical Hydrogen Permeation Cell....
Aviation safety/automation program overview
Morello, Samuel A.
1990-01-01
The goal is to provide a technology base leading to improved safety of the national airspace system through the development and integration of human-centered automation technologies for aircraft crews and air traffic controllers. Information on the problems, specific objectives, human-automation interaction, intelligent error-tolerant systems, and air traffic control/cockpit integration is given in viewgraph form.
Lighting Automation Flying an Earthlike Habitat
Clark, Toni A.; Kolomenski, Andrei
2017-01-01
Currently, spacecraft lighting systems are not demonstrating innovations in automation due to perceived costs in designing circuitry for the communication and automation of lights. The majority of spacecraft lighting systems employ lamps or zone specific manual switches and dimmers. This type of 'hardwired' solution does not easily convert to automation. With advances in solid state lighting, the potential to enhance a spacecraft habitat is lost if the communication and automation problem is not tackled. If we are to build long duration environments, which provide earth-like habitats, minimize crew time, and optimize spacecraft power reserves, innovation in lighting automation is a must. This project researched the use of the DMX512 communication protocol originally developed for high channel count lighting systems. DMX512 is an internationally governed, industry-accepted, lighting communication protocol with wide industry support. The lighting industry markets a wealth of hardware and software that utilizes DMX512, and there may be incentive to space certify the system. Our goal in this research is to enable the development of automated spacecraft habitats for long duration missions. To transform how spacecraft lighting environments are automated, our project conducted a variety of tests to determine a potential scope of capability. We investigated utilization and application of an industry accepted lighting control protocol, DMX512 by showcasing how the lighting system could help conserve power, assist with lighting countermeasures, and utilize spatial body tracking. We hope evaluation and the demonstrations we built will inspire other NASA engineers, architects and researchers to consider employing DMX512 "smart lighting" capabilities into their system architecture. By using DMX512 we will prove the 'wheel' does not need to be reinvented in terms of smart lighting and future spacecraft can use a standard lighting protocol to produce an effective, optimized and
Lighting Automation - Flying an Earthlike Habitat
Clark, Tori A. (Principal Investigator); Kolomenski, Andrei
2017-01-01
Currently, spacecraft lighting systems are not demonstrating innovations in automation due to perceived costs in designing circuitry for the communication and automation of lights. The majority of spacecraft lighting systems employ lamps or zone specific manual switches and dimmers. This type of 'hardwired' solution does not easily convert to automation. With advances in solid state lighting, the potential to enhance a spacecraft habitat is lost if the communication and automation problem is not tackled. If we are to build long duration environments, which provide earth-like habitats, minimize crew time, and optimize spacecraft power reserves, innovation in lighting automation is a must. This project researched the use of the DMX512 communication protocol originally developed for high channel count lighting systems. DMX512 is an internationally governed, industry-accepted, lighting communication protocol with wide industry support. The lighting industry markets a wealth of hardware and software that utilizes DMX512, and there may be incentive to space certify the system. Our goal in this research is to enable the development of automated spacecraft habitats for long duration missions. To transform how spacecraft lighting environments are automated, our project conducted a variety of tests to determine a potential scope of capability. We investigated utilization and application of an industry accepted lighting control protocol, DMX512 by showcasing how the lighting system could help conserve power, assist with lighting countermeasures, and utilize spatial body tracking. We hope evaluation and the demonstrations we built will inspire other NASA engineers, architects and researchers to consider employing DMX512 "smart lighting" capabilities into their system architecture. By using DMX512 we will prove the 'wheel' does not need to be reinvented in terms of smart lighting and future spacecraft can use a standard lighting protocol to produce an effective, optimized and
Automated exchange transfusion and exchange rate.
Funato, M; Shimada, S; Tamai, H; Taki, H; Yoshioka, Y
1989-10-01
An automated blood exchange transfusion (BET) with a two-site technique has been devised by Goldmann et al and by us, using an infusion pump. With this method, we successfully performed exchange transfusions 189 times in the past four years on 110 infants with birth weights ranging from 530 g to 4,000 g. The exchange rate by the automated method was compared with the rate by Diamond's method. Serum bilirubin (SB) levels before and after BET and the maximal SB rebound within 24 hours after BET were: 21.6 +/- 2.4, 11.5 +/- 2.2, and 15.0 +/- 1.5 mg/dl in the automated method, and 22.0 +/- 2.9, 11.2 +/- 2.5, and 17.7 +/- 3.2 mg/dl in Diamond's method, respectively. The result showed that the maximal rebound of the SB level within 24 hours after BET was significantly lower in the automated method than in Diamond's method (p less than 0.01), though SB levels before and after BET were not significantly different between the two methods. The exchange rate was also measured by means of staining the fetal red cells (F cells) both in the automated method and in Diamond's method, and comparing them. The exchange rate of F cells in Diamond's method went down along the theoretical exchange curve proposed by Diamond, while the rate in the automated method was significantly better than in Diamond's, especially in the early stage of BET (p less than 0.01). We believe that the use of this automated method may give better results than Diamond's method in the rate of exchange, because this method is performed with a two-site technique using a peripheral artery and vein.
Lighting Automation - Flying an Earthlike Habit Project
Falker, Jay; Howard, Ricky; Culbert, Christopher; Clark, Toni Anne; Kolomenski, Andrei
2017-01-01
Our proposal will enable the development of automated spacecraft habitats for long duration missions. Majority of spacecraft lighting systems employ lamps or zone specific switches and dimmers. Automation is not in the "picture". If we are to build long duration environments, which provide earth-like habitats, minimize crew time, and optimize spacecraft power reserves, innovation in lighting automation is a must. To transform how spacecraft lighting environments are automated, we will provide performance data on a standard lighting communication protocol. We will investigate utilization and application of an industry accepted lighting control protocol, DMX512. We will demonstrate how lighting automation can conserve power, assist with lighting countermeasures, and utilize spatial body tracking. By using DMX512 we will prove the "wheel" does not need to be reinvented in terms of smart lighting and future spacecraft can use a standard lighting protocol to produce an effective, optimized and potentially earthlike habitat.
Home automation as an example of construction innovation
Vlies, R.D. van der; Bronswijk, J.E.M.H. van
2009-01-01
Home automation can contribute to the health of (older) adults. Home automation covers a broad field of ‘intelligent’ electronic or mechanical devices in the home (domestic) environment. Realizing home automation is technically possible, though still not common. In this paper main influential
Implementing The Automated Phases Of The Partially-Automated Digital Triage Process Model
Directory of Open Access Journals (Sweden)
Gary D Cantrell
2012-12-01
Full Text Available Digital triage is a pre-digital-forensic phase that sometimes takes place as a way of gathering quick intelligence. Although effort has been undertaken to model the digital forensics process, little has been done to date to model digital triage. This work discuses the further development of a model that does attempt to address digital triage the Partially-automated Crime Specific Digital Triage Process model. The model itself will be presented along with a description of how its automated functionality was implemented to facilitate model testing.
Intermittent degradation and schizotypy
Directory of Open Access Journals (Sweden)
Matthew W. Roché
2015-06-01
Full Text Available Intermittent degradation refers to transient detrimental disruptions in task performance. This phenomenon has been repeatedly observed in the performance data of patients with schizophrenia. Whether intermittent degradation is a feature of the liability for schizophrenia (i.e., schizotypy is an open question. Further, the specificity of intermittent degradation to schizotypy has yet to be investigated. To address these questions, 92 undergraduate participants completed a battery of self-report questionnaires assessing schizotypy and psychological state variables (e.g., anxiety, depression, and their reaction times were recorded as they did so. Intermittent degradation was defined as the number of times a subject’s reaction time for questionnaire items met or exceeded three standard deviations from his or her mean reaction time after controlling for each item’s information processing load. Intermittent degradation scores were correlated with questionnaire scores. Our results indicate that intermittent degradation is associated with total scores on measures of positive and disorganized schizotypy, but unrelated to total scores on measures of negative schizotypy and psychological state variables. Intermittent degradation is interpreted as potentially derivative of schizotypy and a candidate endophenotypic marker worthy of continued research.
Computerized automated remote inspection system
International Nuclear Information System (INIS)
The automated inspection system utilizes a computer to control the location of the ultrasonic transducer, the actual inspection process, the display of the data, and the storage of the data on IBM magnetic tape. This automated inspection equipment provides two major advantages. First, it provides a cost savings, because of the reduced inspection time, made possible by the automation of the data acquisition, processing, and storage equipment. This reduced inspection time is also made possible by a computerized data evaluation aid which speeds data interpretation. In addition, the computer control of the transducer location drive allows the exact duplication of a previously located position or flaw. The second major advantage is that the use of automated inspection equipment also allows a higher-quality inspection, because of the automated data acquisition, processing, and storage. This storage of data, in accurate digital form on IBM magnetic tape, for example, facilitates retrieval for comparison with previous inspection data. The equipment provides a multiplicity of scan data which will provide statistical information on any questionable volume or flaw. An automatic alarm for location of all reportable flaws reduces the probability of operator error. This system has the ability to present data on a cathode ray tube as numerical information, a three-dimensional picture, or ''hard-copy'' sheet. One important advantage of this system is the ability to store large amounts of data in compact magnetic tape reels
Design and Implementation of Company Tailored Automated Material Handling
DEFF Research Database (Denmark)
Langer, Gilad; Bilberg, Arne
1996-01-01
This article focuses on the problems of analysing automation of material handling systems in order to develop an efficient automated solution that is specifically tailored to the company. The research has resulted in development of new methods for evaluating factory automation from design...... to implementation. The goals of the research were to analyse and evaluate automation in order to obtain an advantageous combination of human and automated resources. The idea is to asses different solutions in a virtual environment, where experiments and analyses can be performed so that the company can justify...... for their application with computer aided information processing tools. The framework is named the "Automated Material Handling (AMH) Preference GuideLine". The research has been carried out in close co-operation with Danish and European industry, where implementations of automation can be referred to. It is our...
Laboratory automation in clinical bacteriology: what system to choose?
Croxatto, A; Prod'hom, G; Faverjon, F; Rochais, Y; Greub, G
2016-03-01
Automation was introduced many years ago in several diagnostic disciplines such as chemistry, haematology and molecular biology. The first laboratory automation system for clinical bacteriology was released in 2006, and it rapidly proved its value by increasing productivity, allowing a continuous increase in sample volumes despite limited budgets and personnel shortages. Today, two major manufacturers, BD Kiestra and Copan, are commercializing partial or complete laboratory automation systems for bacteriology. The laboratory automation systems are rapidly evolving to provide improved hardware and software solutions to optimize laboratory efficiency. However, the complex parameters of the laboratory and automation systems must be considered to determine the best system for each given laboratory. We address several topics on laboratory automation that may help clinical bacteriologists to understand the particularities and operative modalities of the different systems. We present (a) a comparison of the engineering and technical features of the various elements composing the two different automated systems currently available, (b) the system workflows of partial and complete laboratory automation, which define the basis for laboratory reorganization required to optimize system efficiency, (c) the concept of digital imaging and telebacteriology, (d) the connectivity of laboratory automation to the laboratory information system, (e) the general advantages and disadvantages as well as the expected impacts provided by laboratory automation and (f) the laboratory data required to conduct a workflow assessment to determine the best configuration of an automated system for the laboratory activities and specificities. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.
Karp, William
The 74th Illinois General Assembly created the Illinois Commission on Automation and Technological Progress to study and analyze the economic and social effects of automation and other technological changes on industry, commerce, agriculture, education, manpower, and society in Illinois. Commission members visited industrial plants and business…
Shielded cells transfer automation
International Nuclear Information System (INIS)
Fisher, J.J.
1984-01-01
Nuclear waste from shielded cells is removed, packaged, and transferred manually in many nuclear facilities. Radiation exposure is absorbed by operators during these operations and limited only through procedural controls. Technological advances in automation using robotics have allowed a production waste removal operation to be automated to reduce radiation exposure. The robotic system bags waste containers out of glove box and transfers them to a shielded container. Operators control the system outside the system work area via television cameras. 9 figures
Automation of Educational Tasks for Academic Radiology.
Lamar, David L; Richardson, Michael L; Carlson, Blake
2016-07-01
The process of education involves a variety of repetitious tasks. We believe that appropriate computer tools can automate many of these chores, and allow both educators and their students to devote a lot more of their time to actual teaching and learning. This paper details tools that we have used to automate a broad range of academic radiology-specific tasks on Mac OS X, iOS, and Windows platforms. Some of the tools we describe here require little expertise or time to use; others require some basic knowledge of computer programming. We used TextExpander (Mac, iOS) and AutoHotKey (Win) for automated generation of text files, such as resident performance reviews and radiology interpretations. Custom statistical calculations were performed using TextExpander and the Python programming language. A workflow for automated note-taking was developed using Evernote (Mac, iOS, Win) and Hazel (Mac). Automated resident procedure logging was accomplished using Editorial (iOS) and Python. We created three variants of a teaching session logger using Drafts (iOS) and Pythonista (iOS). Editorial and Drafts were used to create flashcards for knowledge review. We developed a mobile reference management system for iOS using Editorial. We used the Workflow app (iOS) to automatically generate a text message reminder for daily conferences. Finally, we developed two separate automated workflows-one with Evernote (Mac, iOS, Win) and one with Python (Mac, Win)-that generate simple automated teaching file collections. We have beta-tested these workflows, techniques, and scripts on several of our fellow radiologists. All of them expressed enthusiasm for these tools and were able to use one or more of them to automate their own educational activities. Appropriate computer tools can automate many educational tasks, and thereby allow both educators and their students to devote a lot more of their time to actual teaching and learning. Copyright © 2016 The Association of University Radiologists
Automation U.S.A.: Overcoming Barriers to Automation.
Brody, Herb
1985-01-01
Although labor unions and inadequate technology play minor roles, the principal barrier to factory automation is "fear of change." Related problems include long-term benefits, nontechnical executives, and uncertainty of factory cost accounting. Industry support for university programs is helping to educate engineers to design, implement, and…
Litt, Jonathan S.; Simo, Donald L.
2007-01-01
This paper presents a preliminary demonstration of an automated health assessment tool, capable of real-time on-board operation using existing engine control hardware. The tool allows operators to discern how rapidly individual turboshaft engines are degrading. As the compressor erodes, performance is lost, and with it the ability to generate power. Thus, such a tool would provide an instant assessment of the engine s fitness to perform a mission, and would help to pinpoint any abnormal wear or performance anomalies before they became serious, thereby decreasing uncertainty and enabling improved maintenance scheduling. The research described in the paper utilized test stand data from a T700-GE-401 turboshaft engine that underwent sand-ingestion testing to scale a model-based compressor efficiency degradation estimation algorithm. This algorithm was then applied to real-time Health Usage and Monitoring System (HUMS) data from a T700-GE-701C to track compressor efficiency on-line. The approach uses an optimal estimator called a Kalman filter. The filter is designed to estimate the compressor efficiency using only data from the engine s sensors as input.
DEFF Research Database (Denmark)
Stangegaard, Michael; Olsen, Addie Nina; Frøslev, Tobias G.
2009-01-01
We have implemented and validated automated methods for washing FTA Card punches containing buccal samples and subsequent PCR setup using a Sias Xantus automated liquid handler. The automated methods were controlled by worklists generated by our LabWare Laboratory Information Management System...
Balseiro-Romero, María; Gkorezis, Panagiotis; Kidd, Petra S; Van Hamme, Jonathan; Weyens, Nele; Monterroso, Carmen; Vangronsveld, Jaco
2017-10-03
Bioremediation of polluted soils is a promising technique with low environmental impact, which uses soil organisms to degrade soil contaminants. In this study, 19 bacterial strains isolated from a diesel-contaminated soil were screened for their diesel-degrading potential, biosurfactant (BS) production, and biofilm formation abilities, all desirable characteristics when selecting strains for re-inoculation into hydrocarbon-contaminated soils. Diesel-degradation rates were determined in vitro in minimal medium with diesel as the sole carbon source. The capacity to degrade diesel range organics (DROs) of strains SPG23 (Arthobacter sp.) and PF1 (Acinetobacter oleivorans) reached 17-26% of total DROs after 10 days, and 90% for strain GK2 (Acinetobacter calcoaceticus). The amount and rate of alkane degradation decreased significantly with increasing carbon number for strains SPG23 and PF1. Strain GK2, which produced BSs and biofilms, exhibited a greater extent, and faster rate of alkane degradation compared to SPG23 and PF1. Based on the outcomes of degradation experiments, in addition to BS production, biofilm formation capacities, and previous genome characterizations, strain GK2 is a promising candidate for microbial-assisted phytoremediation of diesel-contaminated soils. These results are of particular interest to select suitable strains for bioremediation, not only presenting high diesel-degradation rates, but also other characteristics which could improve rhizosphere colonization.
International Nuclear Information System (INIS)
Astakhova, N.V.; Beskrovnyj, A.I.; Bogdzel', A.A.; Butorin, P.E.; Vasilovskij, S.G.; Gundorin, N.A.; Zlokazov, V.B.; Kutuzov, S.A.; Salamatin, I.M.; Shvetsov, V.N.
2003-01-01
An instrumental software complex for automation of spectrometry (AS) that enables prompt realization of experiment automation systems for spectrometers, which use data buferisation, has been developed. In the development new methods of programming and building of automation systems together with novel net technologies were employed. It is suggested that programs to schedule and conduct experiments should be based on the parametric model of the spectrometer, the approach that will make it possible to write programs suitable for any FLNP (Frank Laboratory of Neutron Physics) spectrometer and experimental technique applied and use different hardware interfaces for introducing the spectrometric data into the data acquisition system. The article describes the possibilities provided to the user in the field of scheduling and control of the experiment, data viewing, and control of the spectrometer parameters. The possibility of presenting the current spectrometer state, programs and the experimental data in the Internet in the form of dynamically formed protocols and graphs, as well as of the experiment control via the Internet is realized. To use the means of the Internet on the side of the client, applied programs are not needed. It suffices to know how to use the two programs to carry out experiments in the automated mode. The package is designed for experiments in condensed matter and nuclear physics and is ready for using. (author)
Home Automation and Security System Using Android ADK
Deepali Javale; Mohd. Mohsin; Shreerang Nandanwar; Mayur Shingate
2013-01-01
Today we are living in 21st century where automation is playing important role in human life. Home automation allows us to control household appliances like light, door, fan, AC etc. It also provides home security and emergency system to be activated. Home automation not only refers to reduce human efforts but also energy efficiency and time saving. The main objective of home automation and security is to help handicapped and old aged people which will enable them to control home appliances a...
Flexible automation and the loss of pooling synergy
Slomp, Jannes; Zee, Durk-Jouke van der
2001-01-01
This paper focuses on the effects of flexible automation on the performance of a job shop. Flexible automated machines may significantly improve the delivery performance and the flow time of jobs. The insertion of a flexible automated system in a job shop, however, also has a counter effect on the manufacturing performance. This is caused by the reduction of pooling synergy due to the dedication implied by flexible automated machines. This paper investigates by means of a simulation study to ...
Automated Planning and Scheduling for Planetary Rover Distributed Operations
Backes, Paul G.; Rabideau, Gregg; Tso, Kam S.; Chien, Steve
1999-01-01
Automated planning and Scheduling, including automated path planning, has been integrated with an Internet-based distributed operations system for planetary rover operations. The resulting prototype system enables faster generation of valid rover command sequences by a distributed planetary rover operations team. The Web Interface for Telescience (WITS) provides Internet-based distributed collaboration, the Automated Scheduling and Planning Environment (ASPEN) provides automated planning and scheduling, and an automated path planner provided path planning. The system was demonstrated on the Rocky 7 research rover at JPL.
Computer automation and artificial intelligence
International Nuclear Information System (INIS)
Hasnain, S.B.
1992-01-01
Rapid advances in computing, resulting from micro chip revolution has increased its application manifold particularly for computer automation. Yet the level of automation available, has limited its application to more complex and dynamic systems which require an intelligent computer control. In this paper a review of Artificial intelligence techniques used to augment automation is presented. The current sequential processing approach usually adopted in artificial intelligence has succeeded in emulating the symbolic processing part of intelligence, but the processing power required to get more elusive aspects of intelligence leads towards parallel processing. An overview of parallel processing with emphasis on transputer is also provided. A Fuzzy knowledge based controller for amination drug delivery in muscle relaxant anesthesia on transputer is described. 4 figs. (author)
Automated analysis of autoradiographic imagery
International Nuclear Information System (INIS)
Bisignani, W.T.; Greenhouse, S.C.
1975-01-01
A research programme is described which has as its objective the automated characterization of neurological tissue regions from autoradiographs by utilizing hybrid-resolution image processing techniques. An experimental system is discussed which includes raw imagery, scanning an digitizing equipments, feature-extraction algorithms, and regional characterization techniques. The parameters extracted by these algorithms are presented as well as the regional characteristics which are obtained by operating on the parameters with statistical sampling techniques. An approach is presented for validating the techniques and initial experimental results are obtained from an anlysis of an autoradiograph of a region of the hypothalamus. An extension of these automated techniques to other biomedical research areas is discussed as well as the implications of applying automated techniques to biomedical research problems. (author)
21 CFR 864.5700 - Automated platelet aggregation system.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated platelet aggregation system. 864.5700 Section 864.5700 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
21 CFR 864.5220 - Automated differential cell counter.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated differential cell counter. 864.5220 Section 864.5220 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
21 CFR 864.5260 - Automated cell-locating device.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated cell-locating device. 864.5260 Section 864.5260 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
21 CFR 864.5800 - Automated sedimentation rate device.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated sedimentation rate device. 864.5800 Section 864.5800 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
Radiographic examination takes on an automated image
International Nuclear Information System (INIS)
Aman, J.
1988-01-01
Automation can be effectively applied to nondestructive testing (NDT). Until recently, film radiography used in NDT was largely a manual process, involving the shooting of a series of x-rays, manually positioned and manually processed. In other words, much radiographic work is being done the way it was over 50 years ago. Significant advances in automation have changed the face of manufacturing, and industry has shared in the benefits brought by such progress. The handling of parts, which was once responsible for a large measure of labor costs, is now assigned to robotic equipment. In nondestructive testing processes, some progress has been achieved in automation - for example, in real-time imaging systems. However, only recently have truly automated NDT begun to emerge. There are two major reasons to introduce automation into NDT - reliability and productivity. Any process or technique that can improve the reliability of parts testing could easily justify the capital investments required
Preliminary Framework for Human-Automation Collaboration
International Nuclear Information System (INIS)
Oxstrand, Johanna Helene; Le Blanc, Katya Lee; Spielman, Zachary Alexander
2015-01-01
The Department of Energy's Advanced Reactor Technologies Program sponsors research, development and deployment activities through its Next Generation Nuclear Plant, Advanced Reactor Concepts, and Advanced Small Modular Reactor (aSMR) Programs to promote safety, technical, economical, and environmental advancements of innovative Generation IV nuclear energy technologies. The Human Automation Collaboration (HAC) Research Project is located under the aSMR Program, which identifies developing advanced instrumentation and controls and human-machine interfaces as one of four key research areas. It is expected that the new nuclear power plant designs will employ technology significantly more advanced than the analog systems in the existing reactor fleet as well as utilizing automation to a greater extent. Moving towards more advanced technology and more automation does not necessary imply more efficient and safer operation of the plant. Instead, a number of concerns about how these technologies will affect human performance and the overall safety of the plant need to be addressed. More specifically, it is important to investigate how the operator and the automation work as a team to ensure effective and safe plant operation, also known as the human-automation collaboration (HAC). The focus of the HAC research is to understand how various characteristics of automation (such as its reliability, processes, and modes) effect an operator's use and awareness of plant conditions. In other words, the research team investigates how to best design the collaboration between the operators and the automated systems in a manner that has the greatest positive impact on overall plant performance and reliability. This report addresses the Department of Energy milestone M4AT-15IN2302054, Complete Preliminary Framework for Human-Automation Collaboration, by discussing the two phased development of a preliminary HAC framework. The framework developed in the first phase was used as
Preliminary Framework for Human-Automation Collaboration
Energy Technology Data Exchange (ETDEWEB)
Oxstrand, Johanna Helene [Idaho National Lab. (INL), Idaho Falls, ID (United States); Le Blanc, Katya Lee [Idaho National Lab. (INL), Idaho Falls, ID (United States); Spielman, Zachary Alexander [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-09-01
The Department of Energy’s Advanced Reactor Technologies Program sponsors research, development and deployment activities through its Next Generation Nuclear Plant, Advanced Reactor Concepts, and Advanced Small Modular Reactor (aSMR) Programs to promote safety, technical, economical, and environmental advancements of innovative Generation IV nuclear energy technologies. The Human Automation Collaboration (HAC) Research Project is located under the aSMR Program, which identifies developing advanced instrumentation and controls and human-machine interfaces as one of four key research areas. It is expected that the new nuclear power plant designs will employ technology significantly more advanced than the analog systems in the existing reactor fleet as well as utilizing automation to a greater extent. Moving towards more advanced technology and more automation does not necessary imply more efficient and safer operation of the plant. Instead, a number of concerns about how these technologies will affect human performance and the overall safety of the plant need to be addressed. More specifically, it is important to investigate how the operator and the automation work as a team to ensure effective and safe plant operation, also known as the human-automation collaboration (HAC). The focus of the HAC research is to understand how various characteristics of automation (such as its reliability, processes, and modes) effect an operator’s use and awareness of plant conditions. In other words, the research team investigates how to best design the collaboration between the operators and the automated systems in a manner that has the greatest positive impact on overall plant performance and reliability. This report addresses the Department of Energy milestone M4AT-15IN2302054, Complete Preliminary Framework for Human-Automation Collaboration, by discussing the two phased development of a preliminary HAC framework. The framework developed in the first phase was used as the
Automated Subsystem Control for Life Support System (ASCLSS)
Block, Roger F.
1987-01-01
The Automated Subsystem Control for Life Support Systems (ASCLSS) program has successfully developed and demonstrated a generic approach to the automation and control of space station subsystems. The automation system features a hierarchical and distributed real-time control architecture which places maximum controls authority at the lowest or process control level which enhances system autonomy. The ASCLSS demonstration system pioneered many automation and control concepts currently being considered in the space station data management system (DMS). Heavy emphasis is placed on controls hardware and software commonality implemented in accepted standards. The approach demonstrates successfully the application of real-time process and accountability with the subsystem or process developer. The ASCLSS system completely automates a space station subsystem (air revitalization group of the ASCLSS) which moves the crew/operator into a role of supervisory control authority. The ASCLSS program developed over 50 lessons learned which will aide future space station developers in the area of automation and controls..
Cost Accounting in the Automated Manufacturing Environment
1988-06-01
1 NAVAL POSTGRADUATE SCHOOL M terey, California 0 DTIC II ELECTE R AD%$° NO 0,19880 -- THESIS COST ACCOUNTING IN THE AUTOMATED MANUFACTURING...PROJECT TASK WORK UNIT ELEMENT NO. NO NO ACCESSION NO 11. TITLE (Include Security Classification) E COST ACCOUNTING IN THE AUTOMATED MANUFACTURING...GROUP ’" Cost Accounting ; Product Costing ; Automated Manufacturing; CAD/CAM- CIM 19 ABSTRACT (Continue on reverse if necessary and identify by blo
An Automation Interface for Kappa PC
DEFF Research Database (Denmark)
Hartvig, Susanne C
1999-01-01
The reports documents an automation interface for Kappa PC. The automation interface can be used to embed Kappa applications in 32-bit Windowsapplications.The interface includes functions for initialising Kappa, for loading an application, for settingvalues, for getting values, and for stopping...
Automated Inadvertent Intruder Application
International Nuclear Information System (INIS)
Koffman, Larry D.; Lee, Patricia L.; Cook, James R.; Wilhite, Elmer L.
2008-01-01
The Environmental Analysis and Performance Modeling group of Savannah River National Laboratory (SRNL) conducts performance assessments of the Savannah River Site (SRS) low-level waste facilities to meet the requirements of DOE Order 435.1. These performance assessments, which result in limits on the amounts of radiological substances that can be placed in the waste disposal facilities, consider numerous potential exposure pathways that could occur in the future. One set of exposure scenarios, known as inadvertent intruder analysis, considers the impact on hypothetical individuals who are assumed to inadvertently intrude onto the waste disposal site. Inadvertent intruder analysis considers three distinct scenarios for exposure referred to as the agriculture scenario, the resident scenario, and the post-drilling scenario. Each of these scenarios has specific exposure pathways that contribute to the overall dose for the scenario. For the inadvertent intruder analysis, the calculation of dose for the exposure pathways is a relatively straightforward algebraic calculation that utilizes dose conversion factors. Prior to 2004, these calculations were performed using an Excel spreadsheet. However, design checks of the spreadsheet calculations revealed that errors could be introduced inadvertently when copying spreadsheet formulas cell by cell and finding these errors was tedious and time consuming. This weakness led to the specification of functional requirements to create a software application that would automate the calculations for inadvertent intruder analysis using a controlled source of input parameters. This software application, named the Automated Inadvertent Intruder Application, has undergone rigorous testing of the internal calculations and meets software QA requirements. The Automated Inadvertent Intruder Application was intended to replace the previous spreadsheet analyses with an automated application that was verified to produce the same calculations and
Sensors and Automated Analyzers for Radionuclides
International Nuclear Information System (INIS)
Grate, Jay W.; Egorov, Oleg B.
2003-01-01
The production of nuclear weapons materials has generated large quantities of nuclear waste and significant environmental contamination. We have developed new, rapid, automated methods for determination of radionuclides using sequential injection methodologies to automate extraction chromatographic separations, with on-line flow-through scintillation counting for real time detection. This work has progressed in two main areas: radionuclide sensors for water monitoring and automated radiochemical analyzers for monitoring nuclear waste processing operations. Radionuclide sensors have been developed that collect and concentrate radionuclides in preconcentrating minicolumns with dual functionality: chemical selectivity for radionuclide capture and scintillation for signal output. These sensors can detect pertechnetate to below regulatory levels and have been engineered into a prototype for field testing. A fully automated process monitor has been developed for total technetium in nuclear waste streams. This instrument performs sample acidification, speciation adjustment, separation and detection in fifteen minutes or less
Automation of analytical systems in power cycles
International Nuclear Information System (INIS)
Staub Lukas
2008-01-01
'Automation' is a widely used term in instrumentation and is often applied to signal exchange, PLC and SCADA systems. Common use, however, does not necessarily described autonomous operation of analytical devices. We define an automated analytical system as a black box with an input (sample) and an output (measured value). In addition we need dedicated status lines for assessing the validities of the input for our black box and the output for subsequent systems. We will discuss input parameters, automated analytical processes and output parameters. Further considerations will be given to signal exchange and integration into the operating routine of a power plant. Local control loops (chemical dosing) and the automation of sampling systems are not discussed here. (author)
Peripheral refractive correction and automated perimetric profiles.
Wild, J M; Wood, J M; Crews, S J
1988-06-01
The effect of peripheral refractive error correction on the automated perimetric sensitivity profile was investigated on a sample of 10 clinically normal, experienced observers. Peripheral refractive error was determined at eccentricities of 0 degree, 20 degrees and 40 degrees along the temporal meridian of the right eye using the Canon Autoref R-1, an infra-red automated refractor, under the parametric conditions of the Octopus automated perimeter. Perimetric sensitivity was then undertaken at these eccentricities (stimulus sizes 0 and III) with and without the appropriate peripheral refractive correction using the Octopus 201 automated perimeter. Within the measurement limits of the experimental procedures employed, perimetric sensitivity was not influenced by peripheral refractive correction.
Developments in polymer degradation - 7
International Nuclear Information System (INIS)
Grassie, N.
1987-01-01
A selection of topics which are representative of the continually expanding area of polymer degradation is presented. The aspects emphasised include the products of degradation of specific polymers, degradation by high energy radiation and mechanical forces, fire retardant studies and the special role of small radicals in degradation processes. (author)
Records Management Handbook; Source Data Automation Equipment Guide.
National Archives and Records Service (GSA), Washington, DC. Office of Records Management.
A detailed guide to selecting appropriate source data automation equipment is presented. Source data automation equipment is used to prepare data for electronic data processing or computerized recordkeeping. The guide contains specifications, performance data cost, and pictures of the major types of machines used in source data automation.…
21 CFR 866.2170 - Automated colony counter.
2010-04-01
...) MEDICAL DEVICES IMMUNOLOGY AND MICROBIOLOGY DEVICES Microbiology Devices § 866.2170 Automated colony counter. (a) Identification. An automated colony counter is a mechanical device intended for medical...
Husby, Ole
1990-01-01
The challenges and potential benefits of automating university libraries are reviewed, with special attention given to cooperative systems. Aspects discussed include database size, the role of the university computer center, storage modes, multi-institutional systems, resource sharing, cooperative system management, networking, and intelligent…
Automation in a material processing/storage facility
International Nuclear Information System (INIS)
Peterson, K.; Gordon, J.
1997-01-01
The Savannah River Site (SRS) is currently developing a new facility, the Actinide Packaging and Storage Facility (APSF), to process and store legacy materials from the United States nuclear stockpile. A variety of materials, with a variety of properties, packaging and handling/storage requirements, will be processed and stored at the facility. Since these materials are hazardous and radioactive, automation will be used to minimize worker exposure. Other benefits derived from automation of the facility include increased throughput capacity and enhanced security. The diversity of materials and packaging geometries to be handled poses challenges to the automation of facility processes. In addition, the nature of the materials to be processed underscores the need for safety, reliability and serviceability. The application of automation in this facility must, therefore, be accomplished in a rational and disciplined manner to satisfy the strict operational requirements of the facility. Among the functions to be automated are the transport of containers between process and storage areas via an Automatic Guided Vehicle (AGV), and various processes in the Shipping Package Unpackaging (SPU) area, the Accountability Measurements (AM) area, the Special Isotope Storage (SIS) vault and the Special Nuclear Materials (SNM) vault. Other areas of the facility are also being automated, but are outside the scope of this paper
Social aspects of automation: Some critical insights
Nouzil, Ibrahim; Raza, Ali; Pervaiz, Salman
2017-09-01
Sustainable development has been recognized globally as one of the major driving forces towards the current technological innovations. To achieve sustainable development and attain its associated goals, it is very important to properly address its concerns in different aspects of technological innovations. Several industrial sectors have enjoyed productivity and economic gains due to advent of automation technology. It is important to characterize sustainability for the automation technology. Sustainability is key factor that will determine the future of our neighbours in time and it must be tightly wrapped around the double-edged sword of technology. In this study, different impacts of automation have been addressed using the ‘Circles of Sustainability’ approach as a framework, covering economic, political, cultural and ecological aspects and their implications. A systematic literature review of automation technology from its inception is outlined and plotted against its many outcomes covering a broad spectrum. The study is more focused towards the social aspects of the automation technology. The study also reviews literature to analyse the employment deficiency as one end of the social impact spectrum. On the other end of the spectrum, benefits to society through technological advancements, such as the Internet of Things (IoT) coupled with automation are presented.
International Nuclear Information System (INIS)
Tallent, O.K.; Mailen, J.C.; Pannell, K.D.
1984-02-01
The chemical degradation of normal paraffin hydrocarbon (NPH) diluents both in the pure state and mixed with 30% tributyl phosphate (TBP) was investigated in a series of experiments. The results show that degradation of NPH in the TBP-NPH-HNO 3 system is consistent with the active chemical agent being a radical-like nitrogen dioxide (NO 2 ) molecule, not HNO 3 as such. Spectrophotometric, gas chromatographic, mass spectrographic, and titrimetric methods were used to identify the degradation products, which included alkane nitro and nitrate compounds, alcohols, unsaturated alcohols, nitro alcohols, nitro alkenes, ketones, and carboxylic acids. The degradation rate was found to increase with increases in the HNO 3 concentration and the temperature. The rate was decreased by argon sparging to remove NO 2 and by the addition of butanol, which probably acts as a NO 2 scavenger. 13 references, 11 figures
Workflow Automation: A Collective Case Study
Harlan, Jennifer
2013-01-01
Knowledge management has proven to be a sustainable competitive advantage for many organizations. Knowledge management systems are abundant, with multiple functionalities. The literature reinforces the use of workflow automation with knowledge management systems to benefit organizations; however, it was not known if process automation yielded…
49 CFR 238.237 - Automated monitoring.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Automated monitoring. 238.237 Section 238.237 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.237 Automated monitoring. (a) Except as further specified in this paragraph, on or after...
Solís-Marcos, Ignacio; Ahlström, Christer; Kircher, Katja
2018-05-01
To investigate the influence of prior experience with Level 2 automation on additional task performance during manual and Level 2 partially automated driving. Level 2 automation is now on the market, but its effects on driver behavior remain unclear. Based on previous studies, we could expect an increase in drivers' engagement in secondary tasks during Level 2 automated driving, but it is yet unknown how drivers will integrate all the ongoing demands in such situations. Twenty-one drivers (12 without, 9 with Level 2 automation experience) drove on a highway manually and with Level 2 automation (exemplified by Volvo Pilot Assist generation 2; PA2) while performing an additional task. In half of the conditions, the task could be interrupted (self-paced), and in the other half, it could not (system-paced). Drivers' visual attention, additional task performance, and other compensatory strategies were analyzed. Driving with PA2 led to decreased scores in the additional task and more visual attention to the dashboard. In the self-paced condition, all drivers looked more to the task and perceived a lower mental demand. The drivers experienced with PA2 used the system and the task more than the novice group and performed more overtakings. The additional task interfered more with Level 2 automation than with manual driving. The drivers, particularly the automation novice drivers, used some compensatory strategies. Automation designers need to consider these potential effects in the development of future automated systems.
Iodinated contrast media electro-degradation: process performance and degradation pathways.
Del Moro, Guido; Pastore, Carlo; Di Iaconi, Claudio; Mascolo, Giuseppe
2015-02-15
The electrochemical degradation of six of the most widely used iodinated contrast media was investigated. Batch experiments were performed under constant current conditions using two DSA® electrodes (titanium coated with a proprietary and patented mixed metal oxide solution of precious metals such as iridium, ruthenium, platinum, rhodium and tantalum). The degradation removal never fell below 85% (at a current density of 64 mA/cm(2) with a reaction time of 150 min) when perchlorate was used as the supporting electrolyte; however, when sulphate was used, the degradation performance was above 80% (at a current density of 64 mA/cm(2) with a reaction time of 150 min) for all of the compounds studied. Three main degradation pathways were identified, namely, the reductive de-iodination of the aromatic ring, the reduction of alkyl aromatic amides to simple amides and the de-acylation of N-aromatic amides to produce aromatic amines. However, as amidotrizoate is an aromatic carboxylate, this is added via the decarboxylation reaction. The investigation did not reveal toxicity except for the lower current density used, which has shown a modest toxicity, most likely for some reaction intermediates that are not further degraded. In order to obtain total removal of the contrast media, it was necessary to employ a current intensity between 118 and 182 mA/cm(2) with energy consumption higher than 370 kWh/m(3). Overall, the electrochemical degradation was revealed to be a reliable process for the treatment of iodinated contrast media that can be found in contaminated waters such as hospital wastewater or pharmaceutical waste-contaminated streams. Copyright © 2014 Elsevier B.V. All rights reserved.
Designing a Software Test Automation Framework
Directory of Open Access Journals (Sweden)
Sabina AMARICAI
2014-01-01
Full Text Available Testing is an art and science that should ultimately lead to lower cost businesses through increasing control and reducing risk. Testing specialists should thoroughly understand the system or application from both the technical and the business perspective, and then design, build and implement the minimum-cost, maximum-coverage validation framework. Test Automation is an important ingredient for testing large scale applications. In this paper we discuss several test automation frameworks, their advantages and disadvantages. We also propose a custom automation framework model that is suited for applications with very complex business requirements and numerous interfaces.
Flexible automation and the loss of pooling synergy
Slomp, Jannes; Zee, Durk-Jouke van der
This paper focuses on the effects of flexible automation on the performance of a job shop. Flexible automated machines may significantly improve the delivery performance and the flow time of jobs. The insertion of a flexible automated system in a job shop, however, also has a counter effect on the
Standard IEC 61850 substation automation
Energy Technology Data Exchange (ETDEWEB)
Bricchi, A.; Mezzadri, D. [Selta, Tortoreto (Italy)
2008-07-01
The International Electrotechnical Commission (IEC) 61850 standard is the reference communication protocol for all electrical substations protection and control systems. It creates models of all the elements and functionalities of an electrical substation, including physical elements such as switches or circuit breakers, as well as protection, control and monitoring functionalities. Network managers need to renew power substation automation and control systems in order to improve the efficiency and quality of services offered by electric utilities. Selta has proposed a new integrated solution for the automation of power substations which is fully compliant with the IEC 61850 norms. The solution involves the integration of control, automation, protection, monitoring and maintenance functions and applies leading edge technology to its systems, particularly for the TERNA network. The system is based on the use of many electronic devices at a power plant, each one with a specialized function, and all interconnected via a Station LAN. This solution, was tested on the TERNA network in Italy, in VHV and HV stations. It was shown to offer many advantages, such as an architecture based on full interoperability between control, monitoring and protection equipment; centralized and distributed automation; a LAN station that allows full interoperability between different bay units and protection relays in order to integrate equipment from various suppliers; the integration of automation systems in existing bay units and protection relays equipped with standard communication buses or with proprietary interfaces; and time synchronization for the entire system through a station GPS reception system. 10 refs., 1 tab., 7 figs.
Interoperability between OPC UA and AutomationML
Henßen, Robert; Schleipen, Miriam
2014-01-01
OPC UA (OPC Unified Architecture) is a platform-independent standard series (IEC 62541) [1], [2] for communication of industrial automation devices and systems. The OPC Unified Architecture is an advanced communication technology for process control. Certainly the launching costs for the initial information model are quite high. AutomationML (Automation Markup Language) is an upcoming open standard series (IEC 62714) [3], [4] for describing production plants or plant components. The goal of t...
Evolution of Home Automation Technology
Mohd. Rihan; M. Salim Beg
2009-01-01
In modern society home and office automation has becomeincreasingly important, providing ways to interconnectvarious home appliances. This interconnection results infaster transfer of information within home/offices leading tobetter home management and improved user experience.Home Automation, in essence, is a technology thatintegrates various electrical systems of a home to provideenhanced comfort and security. Users are grantedconvenient and complete control over all the electrical homeappl...
Energy Technology Data Exchange (ETDEWEB)
Barabasch, Uwe [Zentralstab Kernbereich, RAG Deutsche Steinkohle AG, Herne (Germany); Weiss, Hans-Juergen [Bergwerk Prosper-Haniel, RAG Deutsche Steinkohle AG, Bottrop (Germany); Kotke, Frank [Elektrotechnik unter Tage, Zentralstab Kernbereich der RAG Deutsche Steinkohle AG, Herne (Germany)
2009-11-05
The improvement of processes specific to mining in the collieries of RAG and the improvement of the ergonomic conditions in the deep coal mining deposits of Germany require a higher degree of automation and control of the processes in progress. A higher degree of automation is also re-quired here for the machinery and systems used. RAG will be consolidating its engineering and research activities in these areas over the coming years. (orig.)
Akhlaghi, Shahin; Pourrahimi, A. M.; Christian, Sjöstedt; Martin, Bellander; Mikael S., Hedenqvist; Ulf W., Gedde
2017-01-01
The degradation of acrylonitrile butadiene rubber (NBR) after exposure to biodiesel at different oxygen partial pressures in an automated ageing equipment at 80 °C, and in a high-pressure autoclave at 150 °C was studied. The oxidation of biodiesel was promoted by an increase in oxygen concentration, resulting in a larger uptake of fuel in the rubber due to internal cavitation, a greater decrease in the strain-at-break of NBR due to the coalescence of cavity, and a faster increase in the cross...
Energy Technology Data Exchange (ETDEWEB)
Gribok, Andrei [Idaho National Lab. (INL), Idaho Falls, ID (United States); Patnaik, Sobhan [Idaho National Lab. (INL), Idaho Falls, ID (United States); Williams, Christian [Idaho National Lab. (INL), Idaho Falls, ID (United States); Pattanaik, Marut [Idaho National Lab. (INL), Idaho Falls, ID (United States); Kanakala, Raghunath [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-09-01
This report describes the current state of research related to critical aspects of erosion and selected aspects of degradation of secondary components in nuclear power plants. The report also proposes a framework for online health monitoring of aging and degradation of secondary components. The framework consists of an integrated multi-sensor modality system which can be used to monitor different piping configurations under different degradation conditions. The report analyses the currently known degradation mechanisms and available predictive models. Based on this analysis, the structural health monitoring framework is proposed. The Light Water Reactor Sustainability Program began to evaluate technologies that could be used to perform online monitoring of piping and other secondary system structural components in commercial NPPs. These online monitoring systems have the potential to identify when a more detailed inspection is needed using real-time measurements, rather than at a pre-determined inspection interval. This transition to condition-based, risk informed automated maintenance will contribute to a significant reduction of operations and maintenance costs that account for the majority of nuclear power generation costs. There is unanimous agreement between industry experts and academic researchers that identifying and prioritizing inspection locations in secondary piping systems (for example, in raw water piping or diesel piping) would eliminate many excessive in-service inspections. The proposed structural health monitoring framework takes aim at answering this challenge by combining long-range guided wave technologies with other monitoring techniques, which can significantly increase the inspection length and pinpoint the locations that degraded the most. More widely, the report suggests research efforts aimed at developing, validating, and deploying online corrosion monitoring techniques for complex geometries, which are pervasive in NPPs.
International Nuclear Information System (INIS)
Gribok, Andrei; Patnaik, Sobhan; Williams, Christian; Pattanaik, Marut; Kanakala, Raghunath
2016-01-01
This report describes the current state of research related to critical aspects of erosion and selected aspects of degradation of secondary components in nuclear power plants. The report also proposes a framework for online health monitoring of aging and degradation of secondary components. The framework consists of an integrated multi-sensor modality system which can be used to monitor different piping configurations under different degradation conditions. The report analyses the currently known degradation mechanisms and available predictive models. Based on this analysis, the structural health monitoring framework is proposed. The Light Water Reactor Sustainability Program began to evaluate technologies that could be used to perform online monitoring of piping and other secondary system structural components in commercial NPPs. These online monitoring systems have the potential to identify when a more detailed inspection is needed using real-time measurements, rather than at a pre-determined inspection interval. This transition to condition-based, risk informed automated maintenance will contribute to a significant reduction of operations and maintenance costs that account for the majority of nuclear power generation costs. There is unanimous agreement between industry experts and academic researchers that identifying and prioritizing inspection locations in secondary piping systems (for example, in raw water piping or diesel piping) would eliminate many excessive in-service inspections. The proposed structural health monitoring framework takes aim at answering this challenge by combining long-range guided wave technologies with other monitoring techniques, which can significantly increase the inspection length and pinpoint the locations that degraded the most. More widely, the report suggests research efforts aimed at developing, validating, and deploying online corrosion monitoring techniques for complex geometries, which are pervasive in NPPs.
Building Strategic Conformal Automation for Air Traffic Control Using Machine Learning
Regtuit, Robert; Borst, C.; van Kampen, E.; van Paassen, M.M.
2018-01-01
Acceptance of automation has been a bottleneck for successful introduction of automation in Air Trac Control. Strategic conformal automation has been proven to increase automation acceptance, by creating a better match between automation and operator decision-making. In this paper strategic
An Intelligent Automation Platform for Rapid Bioprocess Design
Wu, Tianyi
2014-01-01
Bioprocess development is very labor intensive, requiring many experiments to characterize each unit operation in the process sequence to achieve product safety and process efficiency. Recent advances in microscale biochemical engineering have led to automated experimentation. A process design workflow is implemented sequentially in which (1) a liquid-handling system performs high-throughput wet lab experiments, (2) standalone analysis devices detect the data, and (3) specific software is used for data analysis and experiment design given the user’s inputs. We report an intelligent automation platform that integrates these three activities to enhance the efficiency of such a workflow. A multiagent intelligent architecture has been developed incorporating agent communication to perform the tasks automatically. The key contribution of this work is the automation of data analysis and experiment design and also the ability to generate scripts to run the experiments automatically, allowing the elimination of human involvement. A first-generation prototype has been established and demonstrated through lysozyme precipitation process design. All procedures in the case study have been fully automated through an intelligent automation platform. The realization of automated data analysis and experiment design, and automated script programming for experimental procedures has the potential to increase lab productivity. PMID:24088579
21 CFR 864.9300 - Automated Coombs test systems.
2010-04-01
... Blood and Blood Products § 864.9300 Automated Coombs test systems. (a) Identification. An automated Coombs test system is a device used to detect and identify antibodies in patient sera or antibodies bound... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated Coombs test systems. 864.9300 Section...
Recent advances in automated system model extraction (SME)
International Nuclear Information System (INIS)
Narayanan, Nithin; Bloomsburgh, John; He Yie; Mao Jianhua; Patil, Mahesh B; Akkaraju, Sandeep
2006-01-01
In this paper we present two different techniques for automated extraction of system models from FEA models. We discuss two different algorithms: for (i) automated N-DOF SME for electrostatically actuated MEMS and (ii) automated N-DOF SME for MEMS inertial sensors. We will present case studies for the two different algorithms presented
15 CFR 758.2 - Automated Export System (AES).
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Automated Export System (AES). 758.2... CLEARANCE REQUIREMENTS § 758.2 Automated Export System (AES). The Census Bureau's Foreign Trade Statistics...) electronically using the Automated Export System (AES). In order to use AES, you must apply directly to the...
Future of Automated Insulin Delivery Systems
Castle, Jessica R.; DeVries, J. Hans; Kovatchev, Boris
2017-01-01
Advances in continuous glucose monitoring (CGM) have brought on a paradigm shift in the management of type 1 diabetes. These advances have enabled the automation of insulin delivery, where an algorithm determines the insulin delivery rate in response to the CGM values. There are multiple automated
International Nuclear Information System (INIS)
Bauer, G; Darlea, G-L; Gomez-Ceballos, G; Bawej, T; Chaze, O; Coarasa, J A; Deldicque, C; Dobson, M; Dupont, A; Gigi, D; Glege, F; Gomez-Reino, R; Hartl, C; Hegeman, J; Masetti, L; Behrens, U; Branson, J; Cittolin, S; Holzner, A; Erhan, S
2014-01-01
We present the automation mechanisms that have been added to the Data Acquisition and Run Control systems of the Compact Muon Solenoid (CMS) experiment during Run 1 of the LHC, ranging from the automation of routine tasks to automatic error recovery and context-sensitive guidance to the operator. These mechanisms helped CMS to maintain a data taking efficiency above 90% and to even improve it to 95% towards the end of Run 1, despite an increase in the occurrence of single-event upsets in sub-detector electronics at high LHC luminosity.
Das Neves Borges, Patricia; Vincent, Tonia L; Marenzana, Massimo
2017-01-01
The degradation of articular cartilage, which characterises osteoarthritis (OA), is usually paired with excessive bone remodelling, including subchondral bone sclerosis, cysts, and osteophyte formation. Experimental models of OA are widely used to investigate pathogenesis, yet few validated methodologies for assessing periarticular bone morphology exist and quantitative measurements are limited by manual segmentation of micro-CT scans. The aim of this work was to chart the temporal changes in periarticular bone in murine OA by novel, automated micro-CT methods. OA was induced by destabilisation of the medial meniscus (DMM) in 10-week old male mice and disease assessed cross-sectionally from 1- to 20-weeks post-surgery. A novel approach was developed to automatically segment subchondral bone compartments into plate and trabecular bone in micro-CT scans of tibial epiphyses. Osteophyte volume, as assessed by shape differences using 3D image registration, and by measuring total epiphyseal volume was performed. Significant linear and volumetric structural modifications in subchondral bone compartments and osteophytes were measured from 4-weeks post-surgery and showed progressive changes at all time points; by 20 weeks, medial subchondral bone plate thickness increased by 160±19.5 μm and the medial osteophyte grew by 0.124±0.028 μm3. Excellent agreement was found when automated measurements were compared with manual assessments. Our automated methods for assessing bone changes in murine periarticular bone are rapid, quantitative, and highly accurate, and promise to be a useful tool in future preclinical studies of OA progression and treatment. The current approaches were developed specifically for cross-sectional micro-CT studies but could be applied to longitudinal studies.
Directory of Open Access Journals (Sweden)
Patricia Das Neves Borges
Full Text Available The degradation of articular cartilage, which characterises osteoarthritis (OA, is usually paired with excessive bone remodelling, including subchondral bone sclerosis, cysts, and osteophyte formation. Experimental models of OA are widely used to investigate pathogenesis, yet few validated methodologies for assessing periarticular bone morphology exist and quantitative measurements are limited by manual segmentation of micro-CT scans. The aim of this work was to chart the temporal changes in periarticular bone in murine OA by novel, automated micro-CT methods.OA was induced by destabilisation of the medial meniscus (DMM in 10-week old male mice and disease assessed cross-sectionally from 1- to 20-weeks post-surgery. A novel approach was developed to automatically segment subchondral bone compartments into plate and trabecular bone in micro-CT scans of tibial epiphyses. Osteophyte volume, as assessed by shape differences using 3D image registration, and by measuring total epiphyseal volume was performed.Significant linear and volumetric structural modifications in subchondral bone compartments and osteophytes were measured from 4-weeks post-surgery and showed progressive changes at all time points; by 20 weeks, medial subchondral bone plate thickness increased by 160±19.5 μm and the medial osteophyte grew by 0.124±0.028 μm3. Excellent agreement was found when automated measurements were compared with manual assessments.Our automated methods for assessing bone changes in murine periarticular bone are rapid, quantitative, and highly accurate, and promise to be a useful tool in future preclinical studies of OA progression and treatment. The current approaches were developed specifically for cross-sectional micro-CT studies but could be applied to longitudinal studies.
Launch Control System Software Development System Automation Testing
Hwang, Andrew
2017-01-01
The Spaceport Command and Control System (SCCS) is the National Aeronautics and Space Administration's (NASA) launch control system for the Orion capsule and Space Launch System, the next generation manned rocket currently in development. This system requires high quality testing that will measure and test the capabilities of the system. For the past two years, the Exploration and Operations Division at Kennedy Space Center (KSC) has assigned a group including interns and full-time engineers to develop automated tests to save the project time and money. The team worked on automating the testing process for the SCCS GUI that would use streamed simulated data from the testing servers to produce data, plots, statuses, etc. to the GUI. The software used to develop automated tests included an automated testing framework and an automation library. The automated testing framework has a tabular-style syntax, which means the functionality of a line of code must have the appropriate number of tabs for the line to function as intended. The header section contains either paths to custom resources or the names of libraries being used. The automation library contains functionality to automate anything that appears on a desired screen with the use of image recognition software to detect and control GUI components. The data section contains any data values strictly created for the current testing file. The body section holds the tests that are being run. The function section can include any number of functions that may be used by the current testing file or any other file that resources it. The resources and body section are required for all test files; the data and function sections can be left empty if the data values and functions being used are from a resourced library or another file. To help equip the automation team with better tools, the Project Lead of the Automated Testing Team, Jason Kapusta, assigned the task to install and train an optical character recognition (OCR
Network-based automation for SMEs
DEFF Research Database (Denmark)
Parizi, Mohammad Shahabeddini; Radziwon, Agnieszka
2017-01-01
The implementation of appropriate automation concepts which increase productivity in Small and Medium Sized Enterprises (SMEs) requires a lot of effort, due to their limited resources. Therefore, it is strongly recommended for small firms to open up for the external sources of knowledge, which...... could be obtained through network interaction. Based on two extreme cases of SMEs representing low-tech industry and an in-depth analysis of their manufacturing facilities this paper presents how collaboration between firms embedded in a regional ecosystem could result in implementation of new...... with other members of the same regional ecosystem. The findings highlight two main automation related areas where manufacturing SMEs could leverage on external sources on knowledge – these are assistance in defining automation problem as well as appropriate solution and provider selection. Consequently...
Manual versus automated blood sampling
DEFF Research Database (Denmark)
Teilmann, A C; Kalliokoski, Otto; Sørensen, Dorte B
2014-01-01
Facial vein (cheek blood) and caudal vein (tail blood) phlebotomy are two commonly used techniques for obtaining blood samples from laboratory mice, while automated blood sampling through a permanent catheter is a relatively new technique in mice. The present study compared physiological parameters......, glucocorticoid dynamics as well as the behavior of mice sampled repeatedly for 24 h by cheek blood, tail blood or automated blood sampling from the carotid artery. Mice subjected to cheek blood sampling lost significantly more body weight, had elevated levels of plasma corticosterone, excreted more fecal...... corticosterone metabolites, and expressed more anxious behavior than did the mice of the other groups. Plasma corticosterone levels of mice subjected to tail blood sampling were also elevated, although less significantly. Mice subjected to automated blood sampling were less affected with regard to the parameters...
Impact of automation on mass spectrometry.
Zhang, Yan Victoria; Rockwood, Alan
2015-10-23
Mass spectrometry coupled to liquid chromatography (LC-MS and LC-MS/MS) is an analytical technique that has rapidly grown in popularity in clinical practice. In contrast to traditional technology, mass spectrometry is superior in many respects including resolution, specificity, multiplex capability and has the ability to measure analytes in various matrices. Despite these advantages, LC-MS/MS remains high cost, labor intensive and has limited throughput. This specialized technology requires highly trained personnel and therefore has largely been limited to large institutions, academic organizations and reference laboratories. Advances in automation will be paramount to break through this bottleneck and increase its appeal for routine use. This article reviews these challenges, shares perspectives on essential features for LC-MS/MS total automation and proposes a step-wise and incremental approach to achieve total automation through reducing human intervention, increasing throughput and eventually integrating the LC-MS/MS system into the automated clinical laboratory operations. Copyright © 2015 Elsevier B.V. All rights reserved.
Safeguards Automated Facility Evaluation (SAFE) methodology
International Nuclear Information System (INIS)
Chapman, L.D.; Grady, L.M.; Bennett, H.A.; Sasser, D.W.; Engi, D.
1978-08-01
An automated approach to facility safeguards effectiveness evaluation has been developed. This automated process, called Safeguards Automated Facility Evaluation (SAFE), consists of a collection of a continuous stream of operational modules for facility characterization, the selection of critical paths, and the evaluation of safeguards effectiveness along these paths. The technique has been implemented on an interactive computer time-sharing system and makes use of computer graphics for the processing and presentation of information. Using this technique, a comprehensive evaluation of a safeguards system can be provided by systematically varying the parameters that characterize the physical protection components of a facility to reflect the perceived adversary attributes and strategy, environmental conditions, and site operational conditions. The SAFE procedure has broad applications in the nuclear facility safeguards field as well as in the security field in general. Any fixed facility containing valuable materials or components to be protected from theft or sabotage could be analyzed using this same automated evaluation technique
Automation, parallelism, and robotics for proteomics.
Alterovitz, Gil; Liu, Jonathan; Chow, Jijun; Ramoni, Marco F
2006-07-01
The speed of the human genome project (Lander, E. S., Linton, L. M., Birren, B., Nusbaum, C. et al., Nature 2001, 409, 860-921) was made possible, in part, by developments in automation of sequencing technologies. Before these technologies, sequencing was a laborious, expensive, and personnel-intensive task. Similarly, automation and robotics are changing the field of proteomics today. Proteomics is defined as the effort to understand and characterize proteins in the categories of structure, function and interaction (Englbrecht, C. C., Facius, A., Comb. Chem. High Throughput Screen. 2005, 8, 705-715). As such, this field nicely lends itself to automation technologies since these methods often require large economies of scale in order to achieve cost and time-saving benefits. This article describes some of the technologies and methods being applied in proteomics in order to facilitate automation within the field as well as in linking proteomics-based information with other related research areas.
Sinela, André; Rawat, Nadirah; Mertz, Christian; Achir, Nawel; Fulcrand, Hélène; Dornier, Manuel
2017-01-01
Degradation parameters of two main anthocyanins from roselle extract (Hibiscus sabdariffa L.) stored at different temperatures (4-37°C) over 60days were determined. Anthocyanins and some of their degradation products were monitored and quantified using HPLC-MS and DAD. Degradation of anthocyanins followed first-order kinetics and reaction rate constants (k values), which were obtained by non-linear regression, showed that the degradation rate of delphinidin 3-O-sambubioside was higher than that of cyanidin 3-O-sambubioside with k values of 9.2·10(-7)s(-1) and 8.4·10(-7)s(-1) at 37°C respectively. The temperature dependence of the rate of anthocyanin degradation was modeled by the Arrhenius equation. Degradation of delphinidin 3-O-sambubioside (Ea=90kJmol(-1)) tended to be significantly more sensitive to an increase in temperature than cyanidin 3-O-sambubioside (Ea=80kJmol(-1)). Degradation of these anthocyanins formed scission products (gallic and protocatechuic acids respectively) and was accompanied by an increase in polymeric color index. Copyright © 2016 Elsevier Ltd. All rights reserved.
Facilitating Automation Development in Internal Logistics Systems
Granlund, Anna
2014-01-01
The internal logistics system includes all activities connected with managing the flow of materials within the physical limits of a facility. This system is an important part of operations in need of increased focus and continuous improvements. Automation is one possible tool with a previously confirmed great potential to improve internal logistics. Despite this great potential and a growing trend of using automation in the area, internal logistics activities are still not automated to the sa...
Small cities face greater impact from automation
Frank, Morgan R.; Sun, Lijun; Cebrian, Manuel; Youn, Hyejin; Rahwan, Iyad
2017-01-01
The city has proven to be the most successful form of human agglomeration and provides wide employment opportunities for its dwellers. As advances in robotics and artificial intelligence revive concerns about the impact of automation on jobs, a question looms: How will automation affect employment in cities? Here, we provide a comparative picture of the impact of automation across U.S. urban areas. Small cities will undertake greater adjustments, such as worker displacement and job content su...
Proaño-Bolaños, Carolina; Zhou, Mei; Wang, Lei; Coloma, Luis A; Chen, Tianbao; Shaw, Chris
2016-09-02
Phyllomedusine frogs are an extraordinary source of biologically active peptides. At least 8 families of antimicrobial peptides have been reported in this frog clade, the dermaseptins being the most diverse. By a peptidomic approach, integrating molecular cloning, Edman degradation sequencing and tandem mass spectrometry, a new family of antimicrobial peptides has been identified in Cruziohyla calcarifer. These 15 novel antimicrobial peptides of 20-32 residues in length are named cruzioseptins. They are characterized by having a unique shared N-terminal sequence GFLD- and the sequence motifs -VALGAVSK- or -GKAAL(N/G/S) (V/A)V- in the middle of the peptide. Cruzioseptins have a broad spectrum of antimicrobial activity and low haemolytic effect. The most potent cruzioseptin was CZS-1 that had a MIC of 3.77μM against the Gram positive bacterium, Staphylococcus aureus and the yeast Candida albicans. In contrast, CZS-1 was 3-fold less potent against the Gram negative bacterium, Escherichia coli (MIC 15.11μM). CZS-1 reached 100% haemolysis at 120.87μM. Skin secretions from unexplored species such as C. calcarifer continue to demonstrate the enormous molecular diversity hidden in the amphibian skin. Some of these novel peptides may provide lead structures for the development of a new class of antibiotics and antifungals of therapeutic use. Through the combination of molecular cloning, Edman degradation sequencing, tandem mass spectrometry and MALDI-TOF MS we have identified a new family of 15 antimicrobial peptides in the skin secretion of Cruziohyla calcarifer. The novel family is named "Cruzioseptins" and contains cationic amphipathic peptides of 20-32 residues. They have a broad range of antimicrobial activity that also includes effective antifungals with low haemolytic activity. Therefore, C. calcarifer has proven to be a rich source of novel peptides, which could become leading structures for the development of novel antibiotics and antifungals of clinical
Automated Mobility Transitions: Governing Processes in the UK
Directory of Open Access Journals (Sweden)
Debbie Hopkins
2018-03-01
Full Text Available Contemporary systems of mobility are undergoing a transition towards automation. In the UK, this transition is being led by (often new partnerships between incumbent manufacturers and new entrants, in collaboration with national governments, local/regional councils, and research institutions. This paper first offers a framework for analyzing the governance of the transition, adapting ideas from the Transition Management (TM perspective, and then applies the framework to ongoing automated vehicle transition dynamics in the UK. The empirical analysis suggests that the UK has adopted a reasonably comprehensive approach to the governing of automated vehicle innovation but that this approach cannot be characterized as sufficiently inclusive, democratic, diverse and open. The lack of inclusivity, democracy, diversity and openness is symptomatic of the post-political character of how the UK’s automated mobility transition is being governed. The paper ends with a call for a reconfiguration of the automated vehicle transition in the UK and beyond, so that much more space is created for dissent and for reflexive and comprehensive big picture thinking on (automated mobility futures.
Distribution automation at BC Hydro : a case study
Energy Technology Data Exchange (ETDEWEB)
Siew, C. [BC Hydro, Vancouver, BC (Canada). Smart Grid Development Program
2009-07-01
This presentation discussed a distribution automation study conducted by BC Hydro to determine methods of improving grid performance by supporting intelligent transmission and distribution systems. The utility's smart grid program includes a number of utility-side and customer-side applications, including enabled demand response, microgrid, and operational efficiency applications. The smart grid program will improve reliability and power quality by 40 per cent, improve conservation and energy efficiency throughout the province, and provide enhanced customer service. Programs and initiatives currently underway at the utility include distribution management, smart metering, distribution automation, and substation automation programs. The utility's automation functionality will include fault interruption and locating, restoration capability, and restoration success. A decision support system has also been established to assist control room and field operating personnel with monitoring and control of the electric distribution system. Protection, control and monitoring (PCM) and volt VAR optimization upgrades are also planned. Reclosers are also being automated, and an automation guide has been developed for switches. tabs., figs.
The relationship between automation complexity and operator error
International Nuclear Information System (INIS)
Ogle, Russell A.; Morrison, Delmar 'Trey'; Carpenter, Andrew R.
2008-01-01
One of the objectives of process automation is to improve the safety of plant operations. Manual operation, it is often argued, provides too many opportunities for operator error. By this argument, process automation should decrease the risk of accidents caused by operator error. However, some accident theorists have argued that while automation may eliminate some types of operator error, it may create new varieties of error. In this paper we present six case studies of explosions involving operator error in an automated process facility. Taken together, these accidents resulted in six fatalities, 30 injuries and hundreds of millions of dollars in property damage. The case studies are divided into two categories: low and high automation complexity (three case studies each). The nature of the operator error was dependent on the level of automation complexity. For each case study, we also consider the contribution of the existing engineering controls such as safety instrumented systems (SIS) or safety critical devices (SCD) and explore why they were insufficient to prevent, or mitigate, the severity of the explosion
Workload Capacity: A Response Time-Based Measure of Automation Dependence.
Yamani, Yusuke; McCarley, Jason S
2016-05-01
An experiment used the workload capacity measure C(t) to quantify the processing efficiency of human-automation teams and identify operators' automation usage strategies in a speeded decision task. Although response accuracy rates and related measures are often used to measure the influence of an automated decision aid on human performance, aids can also influence response speed. Mean response times (RTs), however, conflate the influence of the human operator and the automated aid on team performance and may mask changes in the operator's performance strategy under aided conditions. The present study used a measure of parallel processing efficiency, or workload capacity, derived from empirical RT distributions as a novel gauge of human-automation performance and automation dependence in a speeded task. Participants performed a speeded probabilistic decision task with and without the assistance of an automated aid. RT distributions were used to calculate two variants of a workload capacity measure, COR(t) and CAND(t). Capacity measures gave evidence that a diagnosis from the automated aid speeded human participants' responses, and that participants did not moderate their own decision times in anticipation of diagnoses from the aid. Workload capacity provides a sensitive and informative measure of human-automation performance and operators' automation dependence in speeded tasks. © 2016, Human Factors and Ergonomics Society.
Automation, consolidation, and integration in autoimmune diagnostics.
Tozzoli, Renato; D'Aurizio, Federica; Villalta, Danilo; Bizzaro, Nicola
2015-08-01
Over the past two decades, we have witnessed an extraordinary change in autoimmune diagnostics, characterized by the progressive evolution of analytical technologies, the availability of new tests, and the explosive growth of molecular biology and proteomics. Aside from these huge improvements, organizational changes have also occurred which brought about a more modern vision of the autoimmune laboratory. The introduction of automation (for harmonization of testing, reduction of human error, reduction of handling steps, increase of productivity, decrease of turnaround time, improvement of safety), consolidation (combining different analytical technologies or strategies on one instrument or on one group of connected instruments) and integration (linking analytical instruments or group of instruments with pre- and post-analytical devices) opened a new era in immunodiagnostics. In this article, we review the most important changes that have occurred in autoimmune diagnostics and present some models related to the introduction of automation in the autoimmunology laboratory, such as automated indirect immunofluorescence and changes in the two-step strategy for detection of autoantibodies; automated monoplex immunoassays and reduction of turnaround time; and automated multiplex immunoassays for autoantibody profiling.
White, L; Terner, C
2001-01-01
The initial efforts of e-health have fallen far short of expectations. They were buoyed by the hype and excitement of the Internet craze but limited by their lack of understanding of important market and environmental factors. E-health now recognizes that legacy systems and processes are important, that there is a technology adoption process that needs to be followed, and that demonstrable value drives adoption. Initial e-health transaction solutions have targeted mostly low-cost problems. These solutions invariably are difficult to integrate into existing systems, typically requiring manual interfacing to supported processes. This limitation in particular makes them unworkable for large volume providers. To meet the needs of these providers, e-health companies must rethink their approaches, appropriately applying technology to seamlessly integrate all steps into existing business functions. E-automation is a transaction technology that automates steps, integration of steps, and information communication demands, resulting in comprehensive automation of entire business functions. We applied e-automation to create a billing management solution for clinical reference laboratories. Large volume, onerous regulations, small margins, and only indirect access to patients challenge large laboratories' billing departments. Couple these problems with outmoded, largely manual systems and it becomes apparent why most laboratory billing departments are in crisis. Our approach has been to focus on the most significant and costly problems in billing: errors, compliance, and system maintenance and management. The core of the design relies on conditional processing, a "universal" communications interface, and ASP technologies. The result is comprehensive automation of all routine processes, driving out errors and costs. Additionally, compliance management and billing system support and management costs are dramatically reduced. The implications of e-automated processes can extend
Automated measuring systems. Automatisierte Messsysteme
Energy Technology Data Exchange (ETDEWEB)
1985-01-01
Microprocessors have become a regular component of automated measuring systems. Experts offer their experience and basic information in 24 lectures and 10 poster presentations. The focus is on the following: Automated measuring, computer and microprocessor use, sensor technique, actuator technique, communication, interfaces, man-system interaction, distrubance tolerance and availability as well as uses. A discussion meeting is dedicated to the theme complex sensor digital signal, sensor interface and sensor bus.
Framtagning av en utvecklingsprocess för automation - baserat på konceptet Lean Automation
Carnbo, Linda
2012-01-01
Due to the globalization today the competition in the market has in- creased and it requires flexibility and produce according to customer demand. In order to reduce the cost of wages industrial companies are now considering moving the manufacturing to low-cost countries. To keep up with the competition in the market without moving the manu- facturing abroad, Lean Automation was developed. The concept of Lean Automation is to reduce the perceived complexity with automa- tion and make automati...
Safeguards through secure automated fabrication
International Nuclear Information System (INIS)
DeMerschman, A.W.; Carlson, R.L.
1982-01-01
Westinghouse Hanford Company, a prime contractor for the U.S. Department of Energy, is constructing the Secure Automated Fabrication (SAF) line for fabrication of mixed oxide breeder fuel pins. Fuel processing by automation, which provides a separation of personnel from fuel handling, will provide a means whereby advanced safeguards concepts will be introduced. Remote operations and the inter-tie between the process computer and the safeguards computer are discussed
Manned spacecraft automation and robotics
Erickson, Jon D.
1987-01-01
The Space Station holds promise of being a showcase user and driver of advanced automation and robotics technology. The author addresses the advances in automation and robotics from the Space Shuttle - with its high-reliability redundancy management and fault tolerance design and its remote manipulator system - to the projected knowledge-based systems for monitoring, control, fault diagnosis, planning, and scheduling, and the telerobotic systems of the future Space Station.
1984-01-01
The electroepitaxial process and the Very Large Scale Integration (VLSI) circuits (chips) facilities were chosen because each requires a very high degree of automation, and therefore involved extensive use of teleoperators, robotics, process mechanization, and artificial intelligence. Both cover a raw materials process and a sophisticated multi-step process and are therfore highly representative of the kinds of difficult operation, maintenance, and repair challenges which can be expected for any type of space manufacturing facility. Generic areas were identified which will require significant further study. The initial design will be based on terrestrial state-of-the-art hard automation. One hundred candidate missions were evaluated on the basis of automation portential and availability of meaning ful knowldege. The design requirements and unconstrained design concepts developed for the two missions are presented.
1984-01-01
Automation reuirements were developed for two manufacturing concepts: (1) Gallium Arsenide Electroepitaxial Crystal Production and Wafer Manufacturing Facility, and (2) Gallium Arsenide VLSI Microelectronics Chip Processing Facility. A functional overview of the ultimate design concept incoporating the two manufacturing facilities on the space station are provided. The concepts were selected to facilitate an in-depth analysis of manufacturing automation requirements in the form of process mechanization, teleoperation and robotics, sensors, and artificial intelligence. While the cost-effectiveness of these facilities was not analyzed, both appear entirely feasible for the year 2000 timeframe.
Automated Vehicle Regulation: An Energy and Emissions Perspective
Energy Technology Data Exchange (ETDEWEB)
Levine, Aaron
2016-05-18
This presentation provides a summary of the current automated vehicles polices in the United States and how they related to reducing greenhouse gas (GHG) emissions. The presentation then looks at future automated vehicle trends that will increase and reduce GHG emissions and what current policies utilized in other areas of law could be adapted for automated vehicle GHG emissions.
Bader, Michael; Rauscher, Dankwart; Geibel, Kurt; Angerer, Juergen
1993-03-01
We report the application of proteases for the total hydrolysis of globin with subsequent determination of amino acids. Optimization of the proteolysis was made with respect to enzyme concentration, time of incubation and type of protease. Ethylene oxide modified globin was used to compare the results of the analysis of the N-terminal amino acid valine after enzymatic cleavage to those obtained from the widely used modified Edman procedure. It is shown that the cleavage is of good reproducibility and yields more alkylated amino acid than the Edman procedure.
DOMOTICS Aplicability and home automation systems
Directory of Open Access Journals (Sweden)
César Luiz de Azevedo Dias
2010-05-01
Full Text Available This article discusses the benefits and applicability of domestic automation, also known as Domotics. According to Domotics Integration Project (DIP, Domotics or smart house technology is the integration of services and technologies applied to homes, flats, apartments, houses and small buildings with the purpose of automating them and obtaining and increasing safety and security, comfort, communication and technical management. This papper also presents a summary of the elements which may be part of a “smart home”, the advantages given by its integration and, illustrations of various systems and technologies applied to domestic automation that have achieved both national and international commercial relevance.
Autonomy, Automation, and Systems
Turner, Philip R.
1987-02-01
Aerospace industry interest in autonomy and automation, given fresh impetus by the national goal of establishing a Space Station, is becoming a major item of research and technology development. The promise of new technology arising from research in Artificial Intelligence (AI) has focused much attention on its potential in autonomy and automation. These technologies can improve performance in autonomous control functions that involve planning, scheduling, and fault diagnosis of complex systems. There are, however, many aspects of system and subsystem design in an autonomous system that impact AI applications, but do not directly involve AI technology. Development of a system control architecture, establishment of an operating system within the design, providing command and sensory data collection features appropriate to automated operation, and the use of design analysis tools to support system engineering are specific examples of major design issues. Aspects such as these must also receive attention and technology development support if we are to implement complex autonomous systems within the realistic limitations of mass, power, cost, and available flight-qualified technology that are all-important to a flight project.
Automated fault-management in a simulated spaceflight micro-world
Lorenz, Bernd; Di Nocera, Francesco; Rottger, Stefan; Parasuraman, Raja
2002-01-01
BACKGROUND: As human spaceflight missions extend in duration and distance from Earth, a self-sufficient crew will bear far greater onboard responsibility and authority for mission success. This will increase the need for automated fault management (FM). Human factors issues in the use of such systems include maintenance of cognitive skill, situational awareness (SA), trust in automation, and workload. This study examine the human performance consequences of operator use of intelligent FM support in interaction with an autonomous, space-related, atmospheric control system. METHODS: An expert system representing a model-base reasoning agent supported operators at a low level of automation (LOA) by a computerized fault finding guide, at a medium LOA by an automated diagnosis and recovery advisory, and at a high LOA by automate diagnosis and recovery implementation, subject to operator approval or veto. Ten percent of the experimental trials involved complete failure of FM support. RESULTS: Benefits of automation were reflected in more accurate diagnoses, shorter fault identification time, and reduced subjective operator workload. Unexpectedly, fault identification times deteriorated more at the medium than at the high LOA during automation failure. Analyses of information sampling behavior showed that offloading operators from recovery implementation during reliable automation enabled operators at high LOA to engage in fault assessment activities CONCLUSIONS: The potential threat to SA imposed by high-level automation, in which decision advisories are automatically generated, need not inevitably be counteracted by choosing a lower LOA. Instead, freeing operator cognitive resources by automatic implementation of recover plans at a higher LOA can promote better fault comprehension, so long as the automation interface is designed to support efficient information sampling.
Automated procedures for sizing aerospace vehicle structures /SAVES/
Giles, G. L.; Blackburn, C. L.; Dixon, S. C.
1972-01-01
Results from a continuing effort to develop automated methods for structural design are described. A system of computer programs presently under development called SAVES is intended to automate the preliminary structural design of a complete aerospace vehicle. Each step in the automated design process of the SAVES system of programs is discussed, with emphasis placed on use of automated routines for generation of finite-element models. The versatility of these routines is demonstrated by structural models generated for a space shuttle orbiter, an advanced technology transport,n hydrogen fueled Mach 3 transport. Illustrative numerical results are presented for the Mach 3 transport wing.
49 CFR 238.445 - Automated monitoring.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Automated monitoring. 238.445 Section 238.445... Equipment § 238.445 Automated monitoring. (a) Each passenger train shall be equipped to monitor the... limiting the speed of the train. (c) The monitoring system shall be designed with an automatic self-test...
Working toward Transparency in Library Automation
Breeding, Marshall
2007-01-01
In this article, the author argues the need for transparency with regard to the automation systems used in libraries. As librarians make decisions regarding automation software and services, they should have convenient access to information about the organizations it will potentially acquire technology from and about the collective experiences of…
Welding process automation in power machine building
International Nuclear Information System (INIS)
Mel'bard, S.N.; Shakhnov, A.F.; Shergov, I.V.
1977-01-01
The level of welding automation operations in power engineering and ways of its enhancement are highlighted. Used as the examples of comlex automation are an apparatus for the horizontal welding of turbine rotors, remotely controlled automatic machine for welding ring joint of large-sized vessels, equipment for the electron-beam welding of steam turbine assemblies of alloyed steels. The prospects of industrial robots are noted. The importance of the complex automation of technological process, including stocking, assemblying, transportation and auxiliary operations, is emphasized
Automating the radiographic NDT process
International Nuclear Information System (INIS)
Aman, J.K.
1988-01-01
Automation, the removal of the human element in inspection has not been generally applied to film radiographic NDT. The justification for automation is not only productivity but also reliability of results. Film remains in the automated system of the future because of its extremely high image content, approximately 3x10 (to the power of nine) bits per 14x17. This is equivalent to 2200 computer floppy disks parts handling systems and robotics applied for manufacturing and some NDT modalities, should now be applied to film radiographic NDT systems. Automatic film handling can be achieved with the daylight NDT film handling system. Automatic film processing is becoming the standard in industry and can be coupled to the daylight system. Robots offer the opportunity to automate fully the exposure step. Finally, a computer aided interpretation appears on the horizon. A unit which laser scans a 14x27 (inch) film in 6-8 seconds can digitize film in information for further manipulation and possible automatic interrogations (computer aided interpretation). The system called FDRS (for film digital radiography system) is moving toward 50 micron (16 lines/mm) resolution. This is believed to meet the need of the majority of image content needs. (Author). 4 refs.; 21 figs
International Nuclear Information System (INIS)
G.H. Nieder-Westermann
2005-01-01
The outputs from the drift degradation analysis support scientific analyses, models, and design calculations, including the following: (1) Abstraction of Drift Seepage; (2) Seismic Consequence Abstraction; (3) Structural Stability of a Drip Shield Under Quasi-Static Pressure; and (4) Drip Shield Structural Response to Rock Fall. This report has been developed in accordance with ''Technical Work Plan for: Regulatory Integration Modeling of Drift Degradation, Waste Package and Drip Shield Vibratory Motion and Seismic Consequences'' (BSC 2004 [DIRS 171520]). The drift degradation analysis includes the development and validation of rockfall models that approximate phenomenon associated with various components of rock mass behavior anticipated within the repository horizon. Two drift degradation rockfall models have been developed: the rockfall model for nonlithophysal rock and the rockfall model for lithophysal rock. These models reflect the two distinct types of tuffaceous rock at Yucca Mountain. The output of this modeling and analysis activity documents the expected drift deterioration for drifts constructed in accordance with the repository layout configuration (BSC 2004 [DIRS 172801])
AUTOMATION OF CHAMPAGNE WINES PROCESS IN SPARKLING WINE PRESSURE TANK
Directory of Open Access Journals (Sweden)
E. V. Lukyanchuk
2016-08-01
Full Text Available The wine industry is now successfully solved the problem for the implementation of automation receiving points of grapes, crushing and pressing departments installation continuous fermentation work, blend tanks, production lines ordinary Madeira continuously working plants for ethyl alcohol installations champagne wine in continuous flow, etc. With the development of automation of technological progress productivity winemaking process develops in the following areas: organization of complex avtomatization sites grape processing with bulk transportation of the latter; improving the quality and durability of wines by the processing of a wide applying wine cold and heat, as well as technical and microbiological control most powerful automation equipment; the introduction of automated production processes of continuous technical champagne, sherry wine and cognac alcohol madery; the use of complex automation auxiliary production sites (boilers, air conditioners, refrigeration unitsand other.; complex avtomatization creation of enterprises, and sites manufactory bottling wines. In the wine industry developed more sophisticated schemes of automation and devices that enable the transition to integrated production automation, will create, are indicative automated enterprise serving for laboratories to study of the main problems of automation of production processes of winemaking.
Test Automation Process Improvement A case study of BroadSoft
Gummadi, Jalendar
2016-01-01
This master thesis research is about improvement of test automation process at BroadSoft Finland as a case study. Test automation project recently started at BroadSoft but the project is not properly integrated in to existing process. Project is about converting manual test cases to automation test cases. The aim of this thesis is about studying existing BroadSoft test process and studying different test automation frameworks. In this thesis different test automation process are studied ...
Automated detection of retinal disease.
Helmchen, Lorens A; Lehmann, Harold P; Abràmoff, Michael D
2014-11-01
Nearly 4 in 10 Americans with diabetes currently fail to undergo recommended annual retinal exams, resulting in tens of thousands of cases of blindness that could have been prevented. Advances in automated retinal disease detection could greatly reduce the burden of labor-intensive dilated retinal examinations by ophthalmologists and optometrists and deliver diagnostic services at lower cost. As the current availability of ophthalmologists and optometrists is inadequate to screen all patients at risk every year, automated screening systems deployed in primary care settings and even in patients' homes could fill the current gap in supply. Expanding screens to all patients at risk by switching to automated detection systems would in turn yield significantly higher rates of detecting and treating diabetic retinopathy per dilated retinal examination. Fewer diabetic patients would develop complications such as blindness, while ophthalmologists could focus on more complex cases.
Remotely Piloted Aircraft Systems Panel (RPASP) Working Paper: Autonomy and Automation
Shively, Jay
2017-01-01
A significant level of debate and confusion has surrounded the meaning of the terms "autonomy" and "automation". Automation is a multi-dimensional concept, and we propose that RPAS automation should be described with reference to the specific system and task that has been automated, the context in which the automation functions, and other relevant dimensions. In this paper, we present a definition of "automation". We recommend that autonomy and autonomous operations are out of the scope of the RPAS panel. WG7 proposes to develop, in consultation with other workgroups, a taxonomy of "Levels of Automation" for RPAS.
Izquierdo, Esther; Wagner, Camille; Marchioni, Eric; Aoude-Werner, Dalal; Ennahar, Saïd
2009-01-01
Enterococcus faecalis WHE 96, a strain isolated from soft cheese based on its anti-Listeria activity, produced a 5,494-Da bacteriocin that was purified to homogeneity by ultrafiltration and cation-exchange and reversed-phase chromatographies. The amino acid sequence of this bacteriocin, named enterocin 96, was determined by Edman degradation, and its structural gene was sequenced, revealing a double-glycine leader peptide. After a comparison with other bacteriocins, it was shown that enterocin 96 was a new class II bacteriocin that showed very little similarity with known structures. Enterocin 96 was indeed a new bacteriocin belonging to class II bacteriocins. The activity spectrum of enterocin 96 covered a wide range of bacteria, with strong activity against most gram-positive strains but very little or no activity against gram-negative strains. PMID:19411428
Enterocin T, a novel class IIa bacteriocin produced by Enterococcus sp. 812.
Chen, Yi-Sheng; Yu, Chi-Rong; Ji, Si-Hua; Liou, Min-Shiuan; Leong, Kun-Hon; Pan, Shwu-Fen; Wu, Hui-Chung; Lin, Yu-Hsuan; Yu, Bi; Yanagida, Fujitoshi
2013-09-01
Enterococcus sp. 812, isolated from fresh broccoli, was previously found to produce a bacteriocin active against a number of Gram-positive bacteria, including Listeria monocytogenes. Bacteriocin activity decreased slightly after autoclaving (121 °C for 15 min), but was inactivated by protease K. Mass spectrometry analysis revealed the bacteriocin mass to be approximately 4,521.34 Da. N-terminal amino acid sequencing yielded a partial sequence, NH2-ATYYGNGVYXDKKKXWVEWGQA, by Edman degradation, which contained the consensus class IIa bacteriocin motif YGNGV in the N-terminal region. The obtained partial sequence showed high homology with some enterococcal bacteriocins; however, no identical peptide or protein was found. This peptide was therefore considered to be a novel bacteriocin produced by Enterococcus sp. 812 and was termed enterocin T.
Izquierdo, Esther; Wagner, Camille; Marchioni, Eric; Aoude-Werner, Dalal; Ennahar, Saïd
2009-07-01
Enterococcus faecalis WHE 96, a strain isolated from soft cheese based on its anti-Listeria activity, produced a 5,494-Da bacteriocin that was purified to homogeneity by ultrafiltration and cation-exchange and reversed-phase chromatographies. The amino acid sequence of this bacteriocin, named enterocin 96, was determined by Edman degradation, and its structural gene was sequenced, revealing a double-glycine leader peptide. After a comparison with other bacteriocins, it was shown that enterocin 96 was a new class II bacteriocin that showed very little similarity with known structures. Enterocin 96 was indeed a new bacteriocin belonging to class II bacteriocins. The activity spectrum of enterocin 96 covered a wide range of bacteria, with strong activity against most gram-positive strains but very little or no activity against gram-negative strains.
[Algorithm for the automated processing of rheosignals].
Odinets, G S
1988-01-01
Algorithm for rheosignals recognition for a microprocessing device with a representation apparatus and with automated and manual cursor control was examined. The algorithm permits to automate rheosignals registrating and processing taking into account their changeability.
Equipment available for automating rig operations
International Nuclear Information System (INIS)
McNair, W.L.
1990-01-01
Several manufacturers are producing automated rig equipment, from complete systems to individual functions for existing drilling rigs. Significant improvements in well site time, costs of operations, and improved drilling performance have led drilling contractors to install this equipment on their rigs. This paper details some of the equipment available for automating rigs
AUTOMATION, ITS MEANING FOR EDUCATIONAL ADMINISTRATION.
National Conference of Professors of Educational Administration.
A REPORT OF THE TENTH ANNUAL MEETING OF THE NATIONAL CONFERENCE OF PROFESSORS OF EDUCATIONAL ADMINISTRATION (NCPEA), WHICH WAS HELD TO DISCUSS AUTOMATION AND ITS IMPLICATIONS FOR THE PREPARATION OF SCHOOL ADMINISTRATORS, IS PRESENTED. THE CONFERENCE WAS UNDERTAKEN BECAUSE THE NCPEA BELIEVED THAT AUTOMATION IS SYMBOLIC OF VAST CHANGES AT WORK IN…
Approaches to automated protein crystal harvesting
Energy Technology Data Exchange (ETDEWEB)
Deller, Marc C., E-mail: mdeller@scripps.edu; Rupp, Bernhard, E-mail: mdeller@scripps.edu
2014-01-28
Approaches to automated and robot-assisted harvesting of protein crystals are critically reviewed. While no true turn-key solutions for automation of protein crystal harvesting are currently available, systems incorporating advanced robotics and micro-electromechanical systems represent exciting developments with the potential to revolutionize the way in which protein crystals are harvested.
Optimization-based Method for Automated Road Network Extraction
International Nuclear Information System (INIS)
Xiong, D
2001-01-01
Automated road information extraction has significant applicability in transportation. It provides a means for creating, maintaining, and updating transportation network databases that are needed for purposes ranging from traffic management to automated vehicle navigation and guidance. This paper is to review literature on the subject of road extraction and to describe a study of an optimization-based method for automated road network extraction
Development of design principles for automated systems in transport control.
Balfe, Nora; Wilson, John R; Sharples, Sarah; Clarke, Theresa
2012-01-01
This article reports the results of a qualitative study investigating attitudes towards and opinions of an advanced automation system currently used in UK rail signalling. In-depth interviews were held with 10 users, key issues associated with automation were identified and the automation's impact on the signalling task investigated. The interview data highlighted the importance of the signallers' understanding of the automation and their (in)ability to predict its outputs. The interviews also covered the methods used by signallers to interact with and control the automation, and the perceived effects on their workload. The results indicate that despite a generally low level of understanding and ability to predict the actions of the automation system, signallers have developed largely successful coping mechanisms that enable them to use the technology effectively. These findings, along with parallel work identifying desirable attributes of automation from the literature in the area, were used to develop 12 principles of automation which can be used to help design new systems which better facilitate cooperative working. The work reported in this article was completed with the active involvement of operational rail staff who regularly use automated systems in rail signalling. The outcomes are currently being used to inform decisions on the extent and type of automation and user interfaces in future generations of rail control systems.
Virtual Machine in Automation Projects
Xing, Xiaoyuan
2010-01-01
Virtual machine, as an engineering tool, has recently been introduced into automation projects in Tetra Pak Processing System AB. The goal of this paper is to examine how to better utilize virtual machine for the automation projects. This paper designs different project scenarios using virtual machine. It analyzes installability, performance and stability of virtual machine from the test results. Technical solutions concerning virtual machine are discussed such as the conversion with physical...
2015 Chinese Intelligent Automation Conference
Li, Hongbo
2015-01-01
Proceedings of the 2015 Chinese Intelligent Automation Conference presents selected research papers from the CIAC’15, held in Fuzhou, China. The topics include adaptive control, fuzzy control, neural network based control, knowledge based control, hybrid intelligent control, learning control, evolutionary mechanism based control, multi-sensor integration, failure diagnosis, reconfigurable control, etc. Engineers and researchers from academia, industry and the government can gain valuable insights into interdisciplinary solutions in the field of intelligent automation.
Lu, Xian; Shao, Yisheng; Gao, Naiyun; Chen, Juxiang; Zhang, Yansen; Xiang, Huiming; Guo, Youluo
2017-07-01
Diclofenac (DCF) is the frequently detected non-steroidal pharmaceuticals in the aquatic environment. In this study, the degradation of DCF was evaluated by UV-254nm activated persulfate (UV/PS). The degradation of DCF followed the pseudo first-order kinetics pattern. The degradation rate constant (k obs ) was accelerated by UV/PS compared to UV alone and PS alone. Increasing the initial PS dosage or solution pH significantly enhanced the degradation efficiency. Presence of various natural water constituents had different effects on DCF degradation, with an enhancement or inhibition in the presence of inorganic anions (HCO 3 - or Cl - ) and a significant inhibition in the presence of NOM. In addition, preliminary degradation mechanisms and major products were elucidated using LC-MS/MS. Hydroxylation, decarbonylation, ring-opening and cyclation reaction involving the attack of SO 4 • - or other substances, were the main degradation mechanism. TOC analyzer and Microtox bioassay were employed to evaluate the mineralization and cytotoxicity of solutions treated by UV/PS at different times, respectively. Limited elimination of TOC (32%) was observed during the mineralization of DCF. More toxic degradation products and their related intermediate species were formed, and the UV/PS process was suitable for removing the toxicity. Of note, longer degradation time may be considered for the final toxicity removal. Copyright © 2017. Published by Elsevier Inc.
Automated Critical Peak Pricing Field Tests: Program Descriptionand Results
Energy Technology Data Exchange (ETDEWEB)
Piette, Mary Ann; Watson, David; Motegi, Naoya; Kiliccote, Sila; Xu, Peng
2006-04-06
California utilities have been exploring the use of critical peak prices (CPP) to help reduce needle peaks in customer end-use loads. CPP is a form of price-responsive demand response (DR). Recent experience has shown that customers have limited knowledge of how to operate their facilities in order to reduce their electricity costs under CPP (Quantum 2004). While the lack of knowledge about how to develop and implement DR control strategies is a barrier to participation in DR programs like CPP, another barrier is the lack of automation of DR systems. During 2003 and 2004, the PIER Demand Response Research Center (DRRC) conducted a series of tests of fully automated electric demand response (Auto-DR) at 18 facilities. Overall, the average of the site-specific average coincident demand reductions was 8% from a variety of building types and facilities. Many electricity customers have suggested that automation will help them institutionalize their electric demand savings and improve their overall response and DR repeatability. This report focuses on and discusses the specific results of the Automated Critical Peak Pricing (Auto-CPP, a specific type of Auto-DR) tests that took place during 2005, which build on the automated demand response (Auto-DR) research conducted through PIER and the DRRC in 2003 and 2004. The long-term goal of this project is to understand the technical opportunities of automating demand response and to remove technical and market impediments to large-scale implementation of automated demand response (Auto-DR) in buildings and industry. A second goal of this research is to understand and identify best practices for DR strategies and opportunities. The specific objectives of the Automated Critical Peak Pricing test were as follows: (1) Demonstrate how an automated notification system for critical peak pricing can be used in large commercial facilities for demand response (DR). (2) Evaluate effectiveness of such a system. (3) Determine how customers
Control and automation systems
International Nuclear Information System (INIS)
Schmidt, R.; Zillich, H.
1986-01-01
A survey is given of the development of control and automation systems for energy uses. General remarks about control and automation schemes are followed by a description of modern process control systems along with process control processes as such. After discussing the particular process control requirements of nuclear power plants the paper deals with the reliability and availability of process control systems and refers to computerized simulation processes. The subsequent paragraphs are dedicated to descriptions of the operating floor, ergonomic conditions, existing systems, flue gas desulfurization systems, the electromagnetic influences on digital circuits as well as of light wave uses. (HAG) [de
Pérez-Estrada, Leónidas A; Malato, Sixto; Gernjak, Wolfgang; Agüera, Ana; Thurman, E Michael; Ferrer, Imma; Fernández-Alba, Amadeo R
2005-11-01
In recent years, the presence of pharmaceuticals in the aquatic environment has been of growing interest. These new contaminants are important because many of them are not degraded under the typical biological treatments applied in the wastewater treatment plants and represent a continuous input into the environment. Thus, compounds such as diclofenac are present in surface waters in all Europe and a crucial need for more enhanced technologies that can reduce its presence in the environment has become evident. In this sense, advanced oxidation processes (AOPs) represent a good choice for the treatment of hazardous nonbiodegradable pollutants. This work deals with the solar photodegradation of diclofenac, an antiinflammatory drug, in aqueous solutions by photo-Fenton reaction. A pilot-scale facility using a compound parabolic collector (CPC) reactor was used for this study. Results obtained show rapid and complete oxidation of diclofenac after 60 min, and total mineralization (disappearance of dissolved organic carbon, DOC) after 100 min of exposure to sunlight. Although diclofenac precipitates during the process at low pH, its degradation takes place in the homogeneous phase governed by a precipitation-redissolution-degradation process. Establishment of the reaction pathway was made possible by a thorough analysis of the reaction mixture identifying the main intermediate products generated. Gas chromatography-mass spectrometry (GC/ MS) and liquid chromatography coupled with time-of-flight mass spectrometry (LC/TOF-MS) were used to identify 18 intermediates, in two tentative degradation routes. The main one was based on the initial hydroxylation of the phenylacetic acid moiety in the C-4 position and subsequent formation of a quinone imine derivative that was the starting point for further multistep degradation involving hydroxylation, decarboxylation, and oxidation reactions. An alternative route was based on the transient preservation of the biphenyl amino moiety
Characterization of Methane Degradation and Methane-Degrading Microbes in Alaska Coastal Water
Energy Technology Data Exchange (ETDEWEB)
Kirchman, David L. [Univ. of Delaware, Lewes, DE (United States)
2012-03-29
The net flux of methane from methane hydrates and other sources to the atmosphere depends on methane degradation as well as methane production and release from geological sources. The goal of this project was to examine methane-degrading archaea and organic carbon oxidizing bacteria in methane-rich and methane-poor sediments of the Beaufort Sea, Alaska. The Beaufort Sea system was sampled as part of a multi-disciplinary expedition (Methane in the Arctic Shelf or MIDAS) in September 2009. Microbial communities were examined by quantitative PCR analyses of 16S rRNA genes and key methane degradation genes (pmoA and mcrA involved in aerobic and anaerobic methane degradation, respectively), tag pyrosequencing of 16S rRNA genes to determine the taxonomic make up of microbes in these sediments, and sequencing of all microbial genes (metagenomes ). The taxonomic and functional make-up of the microbial communities varied with methane concentrations, with some data suggesting higher abundances of potential methane-oxidizing archaea in methane-rich sediments. Sequence analysis of PCR amplicons revealed that most of the mcrA genes were from the ANME-2 group of methane oxidizers. According to metagenomic data, genes involved in methane degradation and other degradation pathways changed with sediment depth along with sulfate and methane concentrations. Most importantly, sulfate reduction genes decreased with depth while the anaerobic methane degradation gene (mcrA) increased along with methane concentrations. The number of potential methane degradation genes (mcrA) was low and inconsistent with other data indicating the large impact of methane on these sediments. The data can be reconciled if a small number of potential methane-oxidizing archaea mediates a large flux of carbon in these sediments. Our study is the first to report metagenomic data from sediments dominated by ANME-2 archaea and is one of the few to examine the entire microbial assemblage potentially involved in
Application of advanced technology to space automation
Schappell, R. T.; Polhemus, J. T.; Lowrie, J. W.; Hughes, C. A.; Stephens, J. R.; Chang, C. Y.
1979-01-01
Automated operations in space provide the key to optimized mission design and data acquisition at minimum cost for the future. The results of this study strongly accentuate this statement and should provide further incentive for immediate development of specific automtion technology as defined herein. Essential automation technology requirements were identified for future programs. The study was undertaken to address the future role of automation in the space program, the potential benefits to be derived, and the technology efforts that should be directed toward obtaining these benefits.
Co-creative design developments for accessibility and home automation
Taib, SM; De Coster, R; Sabri Tekantape, E
2017-01-01
The term “Home Automation” can be referred to a networked home, which provides electronically controlled security and convenience for its users. Home automation is also defined as the integration of home-based technology and services for a better quality of living (Quynh, et al., 2012). The main purpose of home automation technologies is to enhance home comfort for everyone through the automation of higher security, domestic tasks and easy communication. Home automation should be able to enha...
Energy Technology Data Exchange (ETDEWEB)
David Hainsworth; David Reid; Con Caris; J.C. Ralston; C.O. Hargrave; Ron McPhee; I.N. Hutchinson; A. Strange; C. Wesner [CSIRO (Australia)
2008-05-15
This report covers a nominal two-year extension to the Major Longwall Automation Project (C10100). Production standard implementation of Longwall Automation Steering Committee (LASC) automation systems has been achieved at Beltana and Broadmeadow mines. The systems are now used on a 24/7 basis and have provided production benefits to the mines. The LASC Information System (LIS) has been updated and has been implemented successfully in the IT environment of major coal mining houses. This enables 3D visualisation of the longwall environment and equipment to be accessed on line. A simulator has been specified and a prototype system is now ready for implementation. The Shearer Position Measurement System (SPMS) has been upgraded to a modular commercial production standard hardware solution.A compact hardware solution for visual face monitoring has been developed, an approved enclosure for a thermal infrared camera has been produced and software for providing horizon control through faulted conditions has been delivered. The incorporation of the LASC Cut Model information into OEM horizon control algorithms has been bench and underground tested. A prototype system for shield convergence monitoring has been produced and studies to identify techniques for coal flow optimisation and void monitoring have been carried out. Liaison with equipment manufacturers has been maintained and technology delivery mechanisms for LASC hardware and software have been established.
Realtime Automation Networks in moVing industrial Environments
Directory of Open Access Journals (Sweden)
Rafael Leidinger
2012-04-01
Full Text Available The radio-based wireless data communication has made the realization of new technical solutions possible in many fields of the automation technology (AT. For about ten years, a constant disproportionate growth of wireless technologies can be observed in the automation technology. However, it shows that especially for the AT, conven-tional technologies of office automation are unsuitable and/or not manageable. The employment of mobile ser-vices in the industrial automation technology has the potential of significant cost and time savings. This leads to an increased productivity in various fields of the AT, for example in the factory and process automation or in production logistics. In this paper technologies and solu-tions for an automation-suited supply of mobile wireless services will be introduced under the criteria of real time suitability, IT-security and service orientation. Emphasis will be put on the investigation and develop-ment of wireless convergence layers for different radio technologies, on the central provision of support services for an easy-to-use, central, backup enabled management of combined wired / wireless networks and on the study on integrability in a Profinet real-time Ethernet network [1].
Automated External Defibrillator
... leads to a 10 percent reduction in survival. Training To Use an Automated External Defibrillator Learning how to use an AED and taking a CPR (cardiopulmonary resuscitation) course are helpful. However, if trained ...
Statistical modeling for degradation data
Lio, Yuhlong; Ng, Hon; Tsai, Tzong-Ru
2017-01-01
This book focuses on the statistical aspects of the analysis of degradation data. In recent years, degradation data analysis has come to play an increasingly important role in different disciplines such as reliability, public health sciences, and finance. For example, information on products’ reliability can be obtained by analyzing degradation data. In addition, statistical modeling and inference techniques have been developed on the basis of different degradation measures. The book brings together experts engaged in statistical modeling and inference, presenting and discussing important recent advances in degradation data analysis and related applications. The topics covered are timely and have considerable potential to impact both statistics and reliability engineering.
Automated Liquibase Generator And ValidatorALGV
Directory of Open Access Journals (Sweden)
Manik Jain
2015-08-01
Full Text Available Abstract This paper presents an automation tool namely ALGV Automated Liquibase Generator and Validator for the automated generation and verification of liquibase scripts. Liquibase is one of the most efficient ways of applying and persisting changes to a database schema. Since its invention by Nathan Voxland 1 it has become de facto standard for database change management. The advantages of using liquibase scripts over traditional sql queries ranges from version control to reusing the same scripts over multiple database platforms. Irrespective of its advantages manual creation of liquibase scripts takes a lot of effort and sometimes is error-prone. ALGV helps to reduce the time consuming liquibase script generation manual typing efforts possible error occurrence and manual verification process and time by 75. Automating the liquibase generation process also helps to remove the burden of recollecting specific tags to be used for a particular change. Moreover developers can concentrate on the business logic and business data rather than wasting their precious efforts in writing files.
Automated MAD and MIR structure solution
International Nuclear Information System (INIS)
Terwilliger, Thomas C.; Berendzen, Joel
1999-01-01
A fully automated procedure for solving MIR and MAD structures has been developed using a scoring scheme to convert the structure-solution process into an optimization problem. Obtaining an electron-density map from X-ray diffraction data can be difficult and time-consuming even after the data have been collected, largely because MIR and MAD structure determinations currently require many subjective evaluations of the qualities of trial heavy-atom partial structures before a correct heavy-atom solution is obtained. A set of criteria for evaluating the quality of heavy-atom partial solutions in macromolecular crystallography have been developed. These have allowed the conversion of the crystal structure-solution process into an optimization problem and have allowed its automation. The SOLVE software has been used to solve MAD data sets with as many as 52 selenium sites in the asymmetric unit. The automated structure-solution process developed is a major step towards the fully automated structure-determination, model-building and refinement procedure which is needed for genomic scale structure determinations
Pyrochemical processing automation at Lawrence Livermore National Laboratory
International Nuclear Information System (INIS)
Dennison, D.K.; Domning, E.E.; Seivers, R.
1991-01-01
Lawrence Livermore National Laboratory (LLNL) is developing a fully automated system for pyrochemical processing of special nuclear materials (SNM). The system utilizes a glove box, an automated tilt-pour furnace (TPF), an IBM developed gantry robot, and specialized automation tooling. All material handling within the glove box (i.e., furnace loading, furnace unloading, product and slag separation, and product packaging) is performed automatically. The objectives of the effort are to increase process productivity, decrease operator radiation, reduce process wastes, and demonstrate system reliability and availability. This paper provides an overview of the automated system hardware, outlines the overall operations sequence, and discusses the current status
Moore, John
2007-01-01
In past years, higher education's financial management side has been riddled with manual processes and aging mainframe applications. This article discusses schools which had taken advantage of an array of technologies that automate billing, payment processing, and refund processing in the case of overpayment. The investments are well worth it:…
Development and Evaluation of a Measure of Library Automation.
Pungitore, Verna L.
1986-01-01
Construct validity and reliability estimates indicate that study designed to measure utilization of automation in public and academic libraries was successful in tentatively identifying and measuring three subdimensions of level of automation: quality of hardware, method of software development, and number of automation specialists. Questionnaire…
Bar-code automated waste tracking system
International Nuclear Information System (INIS)
Hull, T.E.
1994-10-01
The Bar-Code Automated Waste Tracking System was designed to be a site-Specific program with a general purpose application for transportability to other facilities. The system is user-friendly, totally automated, and incorporates the use of a drive-up window that is close to the areas dealing in container preparation, delivery, pickup, and disposal. The system features ''stop-and-go'' operation rather than a long, tedious, error-prone manual entry. The system is designed for automation but allows operators to concentrate on proper handling of waste while maintaining manual entry of data as a backup. A large wall plaque filled with bar-code labels is used to input specific details about any movement of waste
Adaptive Algorithms for Automated Processing of Document Images
2011-01-01
ABSTRACT Title of dissertation: ADAPTIVE ALGORITHMS FOR AUTOMATED PROCESSING OF DOCUMENT IMAGES Mudit Agrawal, Doctor of Philosophy, 2011...2011 4. TITLE AND SUBTITLE Adaptive Algorithms for Automated Processing of Document Images 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM...ALGORITHMS FOR AUTOMATED PROCESSING OF DOCUMENT IMAGES by Mudit Agrawal Dissertation submitted to the Faculty of the Graduate School of the University
Extensions and applications of degradation modeling
International Nuclear Information System (INIS)
Hsu, F.; Subudhi, M.; Samanta, P.K.; Vesely, W.E.
1991-01-01
Component degradation modeling being developed to understand the aging process can have many applications with potential advantages. Previous work has focused on developing the basic concepts and mathematical development of a simple degradation model. Using this simple model, times of degradations and failures occurrences were analyzed for standby components to detect indications of aging and to infer the effectiveness of maintenance in preventing age-related degradations from transforming to failures. Degradation modeling approaches can have broader applications in aging studies and in this paper, the authors discuss some of the extensions and applications of degradation modeling. The extensions and applications of the degradation modeling approaches discussed are: (a) theoretical developments to study reliability effects of different maintenance strategies and policies, (b) relating aging-failure rate to degradation rate, and (c) application to a continuously operating component
Biomek Cell Workstation: A Variable System for Automated Cell Cultivation.
Lehmann, R; Severitt, J C; Roddelkopf, T; Junginger, S; Thurow, K
2016-06-01
Automated cell cultivation is an important tool for simplifying routine laboratory work. Automated methods are independent of skill levels and daily constitution of laboratory staff in combination with a constant quality and performance of the methods. The Biomek Cell Workstation was configured as a flexible and compatible system. The modified Biomek Cell Workstation enables the cultivation of adherent and suspension cells. Until now, no commercially available systems enabled the automated handling of both types of cells in one system. In particular, the automated cultivation of suspension cells in this form has not been published. The cell counts and viabilities were nonsignificantly decreased for cells cultivated in AutoFlasks in automated handling. The proliferation of manual and automated bioscreening by the WST-1 assay showed a nonsignificant lower proliferation of automatically disseminated cells associated with a mostly lower standard error. The disseminated suspension cell lines showed different pronounced proliferations in descending order, starting with Jurkat cells followed by SEM, Molt4, and RS4 cells having the lowest proliferation. In this respect, we successfully disseminated and screened suspension cells in an automated way. The automated cultivation and dissemination of a variety of suspension cells can replace the manual method. © 2015 Society for Laboratory Automation and Screening.
Automation: is it really different this time?
Wajcman, Judy
2017-03-01
This review examines several recent books that deal with the impact of automation and robotics on the future of jobs. Most books in this genre predict that the current phase of digital technology will create massive job loss in an unprecedented way, that is, that this wave of automation is different from previous waves. Uniquely digital technology is said to automate professional occupations for the first time. This review critically examines these claims, puncturing some of the hyperbole about automation, robotics and Artificial Intelligence. The review argues for a more nuanced analysis of the politics of technology and provides some critical distance on Silicon Valley's futurist discourse. Only by insisting that futures are always social can public bodies, rather than autonomous markets and endogenous technologies, become central to disentangling, debating and delivering those futures. © London School of Economics and Political Science 2017.
Extensible and Efficient Automation Through Reflective Tactics
DEFF Research Database (Denmark)
Malecha, Gregory; Bengtson, Jesper
2016-01-01
Foundational proof assistants simultaneously offer both expressive logics and strong guarantees. The price they pay for this flexibility is often the need to build and check explicit proof objects which can be expensive. In this work we develop a collection of techniques for building reflective...... automation, where proofs are witnessed by verified decision procedures rather than verbose proof objects. Our techniques center around a verified domain specific language for proving, Rtac, written in Gallina, Coq’s logic. The design of tactics makes it easy to combine them into higher-level automation...... that can be proved sound in a mostly automated way. Furthermore, unlike traditional uses of reflection, Rtac tactics are independent of the underlying problem domain. This allows them to be re-tasked to automate new problems with very little effort. We demonstrate the usability of Rtac through several case...
Survey and comparison of automated UT systems
International Nuclear Information System (INIS)
Neeley, V.I.; Avioli, M.J.
1988-01-01
In the past decade, the limitations of manual UT inspections have become more severe and adverse. Perhaps the best evidence of this has been the problem of intergranular stress corrosion cracking (IGSCC) in boiling water reactors (BWR). The onset of this problem clearly showed that better and more sophisticated UT inspection methods must be developed to assure the industry that an appropriate level of inspection integrity could be maintained. While automated UT inspection systems have been under development for some time, this event certainly spurred this activity and has resulted in a variety of commercial systems. The intent of this project, sponsored by EPRI, is to develop a utility engineer's 'Buyer guide' to automated UT systems. Comparison of different automated UT systems along with results of questionnaires on manual UT versus automated UT costs and effectiveness are reviewed. (author)
Automated analysis of slitless spectra. II. Quasars
International Nuclear Information System (INIS)
Edwards, G.; Beauchemin, M.; Borra, F.
1988-01-01
Automated software have been developed to process slitless spectra. The software, described in a previous paper, automatically separates stars from extended objects and quasars from stars. This paper describes the quasar search techniques and discusses the results. The performance of the software is compared and calibrated with a plate taken in a region of SA 57 that has been extensively surveyed by others using a variety of techniques: the proposed automated software performs very well. It is found that an eye search of the same plate is less complete than the automated search: surveys that rely on eye searches suffer from incompleteness at least from a magnitude brighter than the plate limit. It is shown how the complete automated analysis of a plate and computer simulations are used to calibrate and understand the characteristics of the present data. 20 references
Automated sample analysis and remediation
International Nuclear Information System (INIS)
Hollen, R.; Settle, F.
1995-01-01
The Contaminant Analysis Automation Project is developing an automated chemical analysis system to address the current needs of the US Department of Energy (DOE). These needs focus on the remediation of large amounts of radioactive and chemically hazardous wastes stored, buried and still being processed at numerous DOE sites. This paper outlines the advantages of the system under development, and details the hardware and software design. A prototype system for characterizing polychlorinated biphenyls in soils is also described
Automation and Integration in Semiconductor Manufacturing
Liao, Da-Yin
2010-01-01
Semiconductor automation originates from the prevention and avoidance of frauds in daily fab operations. As semiconductor technology and business continuously advance and grow, manufacturing systems must aggressively evolve to meet the changing technical and business requirements in this industry. Semiconductor manufacturing has been suffering pains from islands of automation. The problems associated with these systems are limited
Application of magnetic sensors in automation control
Energy Technology Data Exchange (ETDEWEB)
Hou Chunhong [AMETEK Inc., Paoli, PA 19301 (United States); Qian Zhenghong, E-mail: zqian@hdu.edu.cn [Center For Integrated Spintronic Devices (CISD), Hangzhou Dianzi University, Hangzhou, ZJ 310018 (China)
2011-01-01
Controls in automation need speed and position feedback. The feedback device is often referred to as encoder. Feedback technology includes mechanical, optical, and magnetic, etc. All advance with new inventions and discoveries. Magnetic sensing as a feedback technology offers certain advantages over other technologies like optical one. With new discoveries like GMR (Giant Magneto-Resistance), TMR (Tunneling Magneto-Resistance) becoming feasible for commercialization, more and more applications will be using advanced magnetic sensors in automation. This paper offers a general review on encoder and applications of magnetic sensors in automation control.
Unmet needs in automated cytogenetics
International Nuclear Information System (INIS)
Bender, M.A.
1976-01-01
Though some, at least, of the goals of automation systems for analysis of clinical cytogenetic material seem either at hand, like automatic metaphase finding, or at least likely to be met in the near future, like operator-assisted semi-automatic analysis of banded metaphase spreads, important areas of cytogenetic analsis, most importantly the determination of chromosomal aberration frequencies in populations of cells or in samples of cells from people exposed to environmental mutagens, await practical methods of automation. Important as are the clinical diagnostic applications, it is apparent that increasing concern over the clastogenic effects of the multitude of potentially clastogenic chemical and physical agents to which human populations are being increasingly exposed, and the resulting emergence of extensive cytogenetic testing protocols, makes the development of automation not only economically feasible but almost mandatory. The nature of the problems involved, and acutal of possible approaches to their solution, are discussed
Examination of Automation-Induced Complacency and Individual Difference Variates
Prinzel, Lawrence J., III; DeVries, Holly; Freeman, Fred G.; Mikulka, Peter
2001-01-01
Automation-induced complacency has been documented as a cause or contributing factor in many airplane accidents throughout the last two decades. It is surmised that the condition results when a crew is working in highly reliable automated environments in which they serve as supervisory controllers monitoring system states for occasional automation failures. Although many reports have discussed the dangers of complacency, little empirical research has been produced to substantiate its harmful effects on performance as well as what factors produce complacency. There have been some suggestions, however, that individual characteristics could serve as possible predictors of performance in automated systems. The present study examined relationship between the individual differences of complacency potential, boredom proneness, and cognitive failure, automation-induced complacency. Workload and boredom scores were also collected and analyzed in relation to the three individual differences. The results of the study demonstrated that there are personality individual differences that are related to whether an individual will succumb to automation-induced complacency. Theoretical and practical implications are discussed.
Improving treatment plan evaluation with automation
Covington, Elizabeth L.; Chen, Xiaoping; Younge, Kelly C.; Lee, Choonik; Matuszak, Martha M.; Kessler, Marc L.; Keranen, Wayne; Acosta, Eduardo; Dougherty, Ashley M.; Filpansick, Stephanie E.
2016-01-01
The goal of this work is to evaluate the effectiveness of Plan‐Checker Tool (PCT) which was created to improve first‐time plan quality, reduce patient delays, increase the efficiency of our electronic workflow, and standardize and automate the physics plan review in the treatment planning system (TPS). PCT uses an application programming interface to check and compare data from the TPS and treatment management system (TMS). PCT includes a comprehensive checklist of automated and manual checks that are documented when performed by the user as part of a plan readiness check for treatment. Prior to and during PCT development, errors identified during the physics review and causes of patient treatment start delays were tracked to prioritize which checks should be automated. Nineteen of 33 checklist items were automated, with data extracted with PCT. There was a 60% reduction in the number of patient delays in the six months after PCT release. PCT was successfully implemented for use on all external beam treatment plans in our clinic. While the number of errors found during the physics check did not decrease, automation of checks increased visibility of errors during the physics check, which led to decreased patient delays. The methods used here can be applied to any TMS and TPS that allows queries of the database. PACS number(s): 87.55.‐x, 87.55.N‐, 87.55.Qr, 87.55.tm, 89.20.Bb PMID:27929478
Banks, Victoria A; Stanton, Neville A
2016-11-01
To the average driver, the concept of automation in driving infers that they can become completely 'hands and feet free'. This is a common misconception, however, one that has been shown through the application of Network Analysis to new Cruise Assist technologies that may feature on our roads by 2020. Through the adoption of a Systems Theoretic approach, this paper introduces the concept of driver-initiated automation which reflects the role of the driver in highly automated driving systems. Using a combination of traditional task analysis and the application of quantitative network metrics, this agent-based modelling paper shows how the role of the driver remains an integral part of the driving system implicating the need for designers to ensure they are provided with the tools necessary to remain actively in-the-loop despite giving increasing opportunities to delegate their control to the automated subsystems. Practitioner Summary: This paper describes and analyses a driver-initiated command and control system of automation using representations afforded by task and social networks to understand how drivers remain actively involved in the task. A network analysis of different driver commands suggests that such a strategy does maintain the driver in the control loop.
Automated image quality assessment for chest CT scans.
Reeves, Anthony P; Xie, Yiting; Liu, Shuang
2018-02-01
Medical image quality needs to be maintained at standards sufficient for effective clinical reading. Automated computer analytic methods may be applied to medical images for quality assessment. For chest CT scans in a lung cancer screening context, an automated quality assessment method is presented that characterizes image noise and image intensity calibration. This is achieved by image measurements in three automatically segmented homogeneous regions of the scan: external air, trachea lumen air, and descending aorta blood. Profiles of CT scanner behavior are also computed. The method has been evaluated on both phantom and real low-dose chest CT scans and results show that repeatable noise and calibration measures may be realized by automated computer algorithms. Noise and calibration profiles show relevant differences between different scanners and protocols. Automated image quality assessment may be useful for quality control for lung cancer screening and may enable performance improvements to automated computer analysis methods. © 2017 American Association of Physicists in Medicine.
Human-centered automation of testing, surveillance and maintenance
International Nuclear Information System (INIS)
Bhatt, S.C.; Sun, B.K.H.
1991-01-01
Manual surveillance and testing of instrumentation, control and protection systems at nuclear power plants involves system and human errors which can lead to substantial plant down time. Frequent manual testing can also contribute significantly to operation and maintenance cost. Automation technology offers potential for prudent applications at the power plant to reduce testing errors and cost. To help address the testing problems and to harness the benefit of automation application, input from utilities is obtained on suitable automation approaches. This paper includes lessens from successful past experience at a few plants where some island of automation exist. The results are summarized as a set of specifications for semi automatic testing. A human-centered automation methodology is proposed with the guidelines for optimal human/computer division of tasks given. Implementation obstacles for significant changes of testing practices are identified and methods acceptable to nuclear power plants for addressing these obstacles have been suggested
Synthesis of tracers using automated radiochemistry and robotics
International Nuclear Information System (INIS)
Dannals, R.F.
1992-07-01
Synthesis of high specific activity radiotracers labeled with short-lived positron-emitting radionuclides for positron emission tomography (PET) often requires handling large initial quantities of radioactivity. High specific activities are required when preparing tracers for use in PET studies of neuroreceptors. A fully automated approach for tracer synthesis is highly desirable. This proposal involves the development of a system for the Synthesis of Tracers using Automated Radiochemistry and Robotics (STARR) for this purpose. While the long range objective of the proposed research is the development of a totally automated radiochemistry system for the production of major high specific activity 11 C-radiotracers for use in PET, the specific short range objectives are the automation of 11 C-methyl iodide ( 11 CH 3 I) production via an integrated approach using both radiochemistry modular labstations and robotics, and the extension of this automated capability to the production of several radiotracers for PET (initially, 11 C-methionine, 3-N-[ 11 C-methyl]spiperone, and [ 11 C]-carfentanil)
Applications and extensions of degradation modeling
International Nuclear Information System (INIS)
Hsu, F.; Subudhi, M.; Samanta, P.K.; Vesely, W.E.
1991-01-01
Component degradation modeling being developed to understand the aging process can have many applications with potential advantages. Previous work has focused on developing the basic concepts and mathematical development of a simple degradation model. Using this simple model, times of degradations and failures occurrences were analyzed for standby components to detect indications of aging and to infer the effectiveness of maintenance in preventing age-related degradations from transforming to failures. Degradation modeling approaches can have broader applications in aging studies and in this paper, we discuss some of the extensions and applications of degradation modeling. The application and extension of degradation modeling approaches, presented in this paper, cover two aspects: (1) application to a continuously operating component, and (2) extension of the approach to analyze degradation-failure rate relationship. The application of the modeling approach to a continuously operating component (namely, air compressors) shows the usefulness of this approach in studying aging effects and the role of maintenance in this type component. In this case, aging effects in air compressors are demonstrated by the increase in both the degradation and failure rate and the faster increase in the failure rate compared to the degradation rate shows the ineffectiveness of the existing maintenance practices. Degradation-failure rate relationship was analyzed using data from residual heat removal system pumps. A simple linear model with a time-lag between these two parameters was studied. The application in this case showed a time-lag of 2 years for degradations to affect failure occurrences. 2 refs
Applications and extensions of degradation modeling
Energy Technology Data Exchange (ETDEWEB)
Hsu, F.; Subudhi, M.; Samanta, P.K. [Brookhaven National Lab., Upton, NY (United States); Vesely, W.E. [Science Applications International Corp., Columbus, OH (United States)
1991-12-31
Component degradation modeling being developed to understand the aging process can have many applications with potential advantages. Previous work has focused on developing the basic concepts and mathematical development of a simple degradation model. Using this simple model, times of degradations and failures occurrences were analyzed for standby components to detect indications of aging and to infer the effectiveness of maintenance in preventing age-related degradations from transforming to failures. Degradation modeling approaches can have broader applications in aging studies and in this paper, we discuss some of the extensions and applications of degradation modeling. The application and extension of degradation modeling approaches, presented in this paper, cover two aspects: (1) application to a continuously operating component, and (2) extension of the approach to analyze degradation-failure rate relationship. The application of the modeling approach to a continuously operating component (namely, air compressors) shows the usefulness of this approach in studying aging effects and the role of maintenance in this type component. In this case, aging effects in air compressors are demonstrated by the increase in both the degradation and failure rate and the faster increase in the failure rate compared to the degradation rate shows the ineffectiveness of the existing maintenance practices. Degradation-failure rate relationship was analyzed using data from residual heat removal system pumps. A simple linear model with a time-lag between these two parameters was studied. The application in this case showed a time-lag of 2 years for degradations to affect failure occurrences. 2 refs.
Applications and extensions of degradation modeling
Energy Technology Data Exchange (ETDEWEB)
Hsu, F.; Subudhi, M.; Samanta, P.K. (Brookhaven National Lab., Upton, NY (United States)); Vesely, W.E. (Science Applications International Corp., Columbus, OH (United States))
1991-01-01
Component degradation modeling being developed to understand the aging process can have many applications with potential advantages. Previous work has focused on developing the basic concepts and mathematical development of a simple degradation model. Using this simple model, times of degradations and failures occurrences were analyzed for standby components to detect indications of aging and to infer the effectiveness of maintenance in preventing age-related degradations from transforming to failures. Degradation modeling approaches can have broader applications in aging studies and in this paper, we discuss some of the extensions and applications of degradation modeling. The application and extension of degradation modeling approaches, presented in this paper, cover two aspects: (1) application to a continuously operating component, and (2) extension of the approach to analyze degradation-failure rate relationship. The application of the modeling approach to a continuously operating component (namely, air compressors) shows the usefulness of this approach in studying aging effects and the role of maintenance in this type component. In this case, aging effects in air compressors are demonstrated by the increase in both the degradation and failure rate and the faster increase in the failure rate compared to the degradation rate shows the ineffectiveness of the existing maintenance practices. Degradation-failure rate relationship was analyzed using data from residual heat removal system pumps. A simple linear model with a time-lag between these two parameters was studied. The application in this case showed a time-lag of 2 years for degradations to affect failure occurrences. 2 refs.
The Influence of Cultural Factors on Trust in Automation
Chien, Shih-Yi James
2016-01-01
Human interaction with automation is a complex process that requires both skilled operators and complex system designs to effectively enhance overall performance. Although automation has successfully managed complex systems throughout the world for over half a century, inappropriate reliance on automation can still occur, such as the recent…
A Framework for Evaluation and Use of Automated Scoring
Williamson, David M.; Xi, Xiaoming; Breyer, F. Jay
2012-01-01
A framework for evaluation and use of automated scoring of constructed-response tasks is provided that entails both evaluation of automated scoring as well as guidelines for implementation and maintenance in the context of constantly evolving technologies. Consideration of validity issues and challenges associated with automated scoring are…
21 CFR 864.5240 - Automated blood cell diluting apparatus.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Automated blood cell diluting apparatus. 864.5240 Section 864.5240 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES HEMATOLOGY AND PATHOLOGY DEVICES Automated and Semi-Automated Hematology Devices...
Neural Signatures of Trust During Human-Automation Interactions
2016-04-01
also automated devices such as a Global Positioning System. For instance, to provide advanced safety measures, the Transportation Safety...AFRL-AFOSR-VA-TR-2016-0160 Neural Signatures of Trust during Human- Automation Interactions Frank Krueger GEORGE MASON UNIVERSITY Final Report 04/01...SUBTITLE Neural Signatures of Trust during Human- Automation Interactions 5a. CONTRACT NUMBER FA9550-13-1-0017 5b. GRANT NUMBER 5c. PROGRAM ELEMENT
Automation in biological crystallization.
Stewart, Patrick Shaw; Mueller-Dieckmann, Jochen
2014-06-01
Crystallization remains the bottleneck in the crystallographic process leading from a gene to a three-dimensional model of the encoded protein or RNA. Automation of the individual steps of a crystallization experiment, from the preparation of crystallization cocktails for initial or optimization screens to the imaging of the experiments, has been the response to address this issue. Today, large high-throughput crystallization facilities, many of them open to the general user community, are capable of setting up thousands of crystallization trials per day. It is thus possible to test multiple constructs of each target for their ability to form crystals on a production-line basis. This has improved success rates and made crystallization much more convenient. High-throughput crystallization, however, cannot relieve users of the task of producing samples of high quality. Moreover, the time gained from eliminating manual preparations must now be invested in the careful evaluation of the increased number of experiments. The latter requires a sophisticated data and laboratory information-management system. A review of the current state of automation at the individual steps of crystallization with specific attention to the automation of optimization is given.
A control system verifier using automated reasoning software
International Nuclear Information System (INIS)
Smith, D.E.; Seeman, S.E.
1985-08-01
An on-line, automated reasoning software system for verifying the actions of other software or human control systems has been developed. It was demonstrated by verifying the actions of an automated procedure generation system. The verifier uses an interactive theorem prover as its inference engine with the rules included as logical axioms. Operation of the verifier is generally transparent except when the verifier disagrees with the actions of the monitored software. Testing with an automated procedure generation system demonstrates the successful application of automated reasoning software for verification of logical actions in a diverse, redundant manner. A higher degree of confidence may be placed in the verified actions of the combined system
Automated driving safer and more efficient future driving
Horn, Martin
2017-01-01
The main topics of this book include advanced control, cognitive data processing, high performance computing, functional safety, and comprehensive validation. These topics are seen as technological bricks to drive forward automated driving. The current state of the art of automated vehicle research, development and innovation is given. The book also addresses industry-driven roadmaps for major new technology advances as well as collaborative European initiatives supporting the evolvement of automated driving. Various examples highlight the state of development of automated driving as well as the way forward. The book will be of interest to academics and researchers within engineering, graduate students, automotive engineers at OEMs and suppliers, ICT and software engineers, managers, and other decision-makers.
Continuous Calibration of Trust in Automated Systems
2014-01-01
Airlines Flight 214 in San Francisco. Therefore, understanding how users form, lose, and recover trust in imperfect automation is of critical...1997). Misuse and disuse can have fatal consequences; for example, inappropriate automation reliance has been implicated in the recent crash of Asiana
Cockpit Automation Technology CSERIAC-CAT
1991-06-01
AD-A273 124 AL-TR-1991-0078 A R COCKPIT AUTOMATION TECHNOLOGY M CSERIAC- CAT S JULY 1989 - DEC 1990: FINAL REPORT T R Trudy S. Abrams Cindy D. Martin...TITLE AND SUBTITLE 5. FUNDING NUMBERS Cockpit Automation Technology CSERIAC- CAT JUL 89 - DEC 90 PE 62202F Final Report (U) PR 7184 ,___,TA 12 6. AUTHOR(S...Boeing-developed CAT software tools, and for facilitating their use by the cockpit design community. A brief description of the overall task is given
Anesthesiology, automation, and artificial intelligence.
Alexander, John C; Joshi, Girish P
2018-01-01
There have been many attempts to incorporate automation into the practice of anesthesiology, though none have been successful. Fundamentally, these failures are due to the underlying complexity of anesthesia practice and the inability of rule-based feedback loops to fully master it. Recent innovations in artificial intelligence, especially machine learning, may usher in a new era of automation across many industries, including anesthesiology. It would be wise to consider the implications of such potential changes before they have been fully realized.
Home Automation and Security System
Surinder Kaur,; Rashmi Singh; Neha Khairwal; Pratyk Jain
2016-01-01
Easy Home or Home automation plays a very important role in modern era because of its flexibility in using it at different places with high precision which will save money and time by decreasing human hard work. Prime focus of this technology is to control the household equipment’s like light, fan, door, AC etc. automatically. This research paper has detailed information on Home Automation and Security System using Arduino, GSM and how we can control home appliances using Android application....
Bacteria-mediated bisphenol A degradation.
Zhang, Weiwei; Yin, Kun; Chen, Lingxin
2013-07-01
Bisphenol A (BPA) is an important monomer in the manufacture of polycarbonate plastics, food cans, and other daily used chemicals. Daily and worldwide usage of BPA and BPA-contained products led to its ubiquitous distribution in water, sediment/soil, and atmosphere. Moreover, BPA has been identified as an environmental endocrine disruptor for its estrogenic and genotoxic activity. Thus, BPA contamination in the environment is an increasingly worldwide concern, and methods to efficiently remove BPA from the environment are urgently recommended. Although many factors affect the fate of BPA in the environment, BPA degradation is mainly depended on the metabolism of bacteria. Many BPA-degrading bacteria have been identified from water, sediment/soil, and wastewater treatment plants. Metabolic pathways of BPA degradation in specific bacterial strains were proposed, based on the metabolic intermediates detected during the degradation process. In this review, the BPA-degrading bacteria were summarized, and the (proposed) BPA degradation pathway mediated by bacteria were referred.
International Nuclear Information System (INIS)
Al'bitskij, L.L.; Brikker, I.N.; Bychkov, V.N.; Voronin, V.V.; Mirzoyan, A.R.; Rogozhin, A.S.; Sarkisyan, Yu.Kh.
1989-01-01
A system of automated control Aspect-2 was developed for automation of gamma therapy on units of the Rokus series. The system consists of the following hardware and software complexes: a complex of preirradiation preparation Centrator-imitator, a complex Accord for anatomotopographic data coding; a software complex and a gamma-therapeutic complex Rokus-AM. The Centrator-imitator and Rokus-AM complexes are fitted out with built-in microcomputers with specially developed systemic software. The Rokus-AM complex has automatic punch tape programmed control of 9 degrees of freedom of the gamma-unit and treatment table and ensures 5 modes of irradiation: positional, rotating, rotaing-convergent, sectoral rotating-convergent and scanning
Automated nuclear materials accounting
International Nuclear Information System (INIS)
Pacak, P.; Moravec, J.
1982-01-01
An automated state system of accounting for nuclear materials data was established in Czechoslovakia in 1979. A file was compiled of 12 programs in the PL/1 language. The file is divided into four groups according to logical associations, namely programs for data input and checking, programs for handling the basic data file, programs for report outputs in the form of worksheets and magnetic tape records, and programs for book inventory listing, document inventory handling and materials balance listing. A similar automated system of nuclear fuel inventory for a light water reactor was introduced for internal purposes in the Institute of Nuclear Research (UJV). (H.S.)
Technology Transfer Opportunities: Automated Ground-Water Monitoring
Smith, Kirk P.; Granato, Gregory E.
1997-01-01
Introduction A new automated ground-water monitoring system developed by the U.S. Geological Survey (USGS) measures and records values of selected water-quality properties and constituents using protocols approved for manual sampling. Prototypes using the automated process have demonstrated the ability to increase the quantity and quality of data collected and have shown the potential for reducing labor and material costs for ground-water quality data collection. Automation of water-quality monitoring systems in the field, in laboratories, and in industry have increased data density and utility while reducing operating costs. Uses for an automated ground-water monitoring system include, (but are not limited to) monitoring ground-water quality for research, monitoring known or potential contaminant sites, such as near landfills, underground storage tanks, or other facilities where potential contaminants are stored, and as an early warning system monitoring groundwater quality near public water-supply wells.
Partial Automated Alignment and Integration System
Kelley, Gary Wayne (Inventor)
2014-01-01
The present invention is a Partial Automated Alignment and Integration System (PAAIS) used to automate the alignment and integration of space vehicle components. A PAAIS includes ground support apparatuses, a track assembly with a plurality of energy-emitting components and an energy-receiving component containing a plurality of energy-receiving surfaces. Communication components and processors allow communication and feedback through PAAIS.
Driver support and automated driving systems : Acceptance and effects on behavior
De Waard, D.; Brookhuis, K.A.; Scerbo, MW; Mouloua, M
1999-01-01
Automation in driving ranges from simple in-vehicle information systems to completely automated driving in the Automated Highway System (AHS). An increased level of automation and increased restriction in behavioural freedom, as well as decreased control over tasks, have serious consequences for
Automation technology for aerospace power management
Larsen, R. L.
1982-01-01
The growing size and complexity of spacecraft power systems coupled with limited space/ground communications necessitate increasingly automated onboard control systems. Research in computer science, particularly artificial intelligence has developed methods and techniques for constructing man-machine systems with problem-solving expertise in limited domains which may contribute to the automation of power systems. Since these systems perform tasks which are typically performed by human experts they have become known as Expert Systems. A review of the current state of the art in expert systems technology is presented, and potential applications in power systems management are considered. It is concluded that expert systems appear to have significant potential for improving the productivity of operations personnel in aerospace applications, and in automating the control of many aerospace systems.
Automated imaging system for single molecules
Schwartz, David Charles; Runnheim, Rodney; Forrest, Daniel
2012-09-18
There is provided a high throughput automated single molecule image collection and processing system that requires minimal initial user input. The unique features embodied in the present disclosure allow automated collection and initial processing of optical images of single molecules and their assemblies. Correct focus may be automatically maintained while images are collected. Uneven illumination in fluorescence microscopy is accounted for, and an overall robust imaging operation is provided yielding individual images prepared for further processing in external systems. Embodiments described herein are useful in studies of any macromolecules such as DNA, RNA, peptides and proteins. The automated image collection and processing system and method of same may be implemented and deployed over a computer network, and may be ergonomically optimized to facilitate user interaction.
Study of PP/montmorillonite composite degradation
International Nuclear Information System (INIS)
Baer, Marcia; Granado, Carlos J.F.
2009-01-01
The objective of this work was to produce composites of PP/sodium bentonite and PP/ organophilic bentonite through melt intercalation and analyze the degradation produced by ultraviolet irradiation. The XRD results showed that the samples of nature bentonite had better interaction with de polymer and produced intercalated nanocomposite. The effect of UV irradiation on degradation was observed after 24 hours of exposition. The samples showed the same photoproducts and at the same proportion until 240 hours of UV exposition; with 480 hours the organophilize bentonite composite showed higher degradation than other ones. The superficial cracks increased with degradation time. The degradation occurs due chromophores impurities presented in the samples, thus samples with sodium clay show higher degradation, and organophilic clay contains ammonium salt that contribute to increase the degradation. (author)
Beller, Elaine; Clark, Justin; Tsafnat, Guy; Adams, Clive; Diehl, Heinz; Lund, Hans; Ouzzani, Mourad; Thayer, Kristina; Thomas, James; Turner, Tari; Xia, Jun; Robinson, Karen; Glasziou, Paul
2018-05-19
Systematic reviews (SR) are vital to health care, but have become complicated and time-consuming, due to the rapid expansion of evidence to be synthesised. Fortunately, many tasks of systematic reviews have the potential to be automated or may be assisted by automation. Recent advances in natural language processing, text mining and machine learning have produced new algorithms that can accurately mimic human endeavour in systematic review activity, faster and more cheaply. Automation tools need to be able to work together, to exchange data and results. Therefore, we initiated the International Collaboration for the Automation of Systematic Reviews (ICASR), to successfully put all the parts of automation of systematic review production together. The first meeting was held in Vienna in October 2015. We established a set of principles to enable tools to be developed and integrated into toolkits.This paper sets out the principles devised at that meeting, which cover the need for improvement in efficiency of SR tasks, automation across the spectrum of SR tasks, continuous improvement, adherence to high quality standards, flexibility of use and combining components, the need for a collaboration and varied skills, the desire for open source, shared code and evaluation, and a requirement for replicability through rigorous and open evaluation.Automation has a great potential to improve the speed of systematic reviews. Considerable work is already being done on many of the steps involved in a review. The 'Vienna Principles' set out in this paper aim to guide a more coordinated effort which will allow the integration of work by separate teams and build on the experience, code and evaluations done by the many teams working across the globe.
Problems of complex automation of process at a NPP
International Nuclear Information System (INIS)
Naumov, A.V.
1981-01-01
The importance of theoretical investigation in determining the level and quality of NPP automation is discussed. Achievements gained in this direction are briefly reviewed on the example of domestic NPPs. Two models of the problem solution on function distribution between the operator and technical means are outlined. The processes subjected to automation are enumerated. Development of the optimal methods of power automatic control of power units is one of the most important problems of NPP automation. Automation of discrete operations especially during the start-up, shut-down or in imergency situations becomes important [ru
Automation of electron channeling investigations into crystals on the experimental stand
International Nuclear Information System (INIS)
Kolodin, L.G.; Kupchishin, A.A.; Bunegin, V.V.
1995-01-01
Automated control system of technological processes of the experimental stand is proposed for electron channeling investigation into crystals. The system is proposed for stand control automation and registration of corresponding radiations. There are four main parts in stand complex: Ehlu-6 type electron accelerator; forming and transporting system of electron beams; goniometer system; radiation detection system. Purposes of the automated system creation are following: - improvement of EhLU accelerator operating stability by of automation stabilization of its parameters; - quality improvement of electron beam monochromatization by of automation of monochromator electromagnet control; - simplification of crystal adjustment process relatively of primary electron beam and crystal transporting to the position by of goniometer automation control; - providing of automating collection and processing of data of physical experiments
Computer-Assisted Automated Scoring of Polysomnograms Using the Somnolyzer System.
Punjabi, Naresh M; Shifa, Naima; Dorffner, Georg; Patil, Susheel; Pien, Grace; Aurora, Rashmi N
2015-10-01
Manual scoring of polysomnograms is a time-consuming and tedious process. To expedite the scoring of polysomnograms, several computerized algorithms for automated scoring have been developed. The overarching goal of this study was to determine the validity of the Somnolyzer system, an automated system for scoring polysomnograms. The analysis sample comprised of 97 sleep studies. Each polysomnogram was manually scored by certified technologists from four sleep laboratories and concurrently subjected to automated scoring by the Somnolyzer system. Agreement between manual and automated scoring was examined. Sleep staging and scoring of disordered breathing events was conducted using the 2007 American Academy of Sleep Medicine criteria. Clinical sleep laboratories. A high degree of agreement was noted between manual and automated scoring of the apnea-hypopnea index (AHI). The average correlation between the manually scored AHI across the four clinical sites was 0.92 (95% confidence interval: 0.90-0.93). Similarly, the average correlation between the manual and Somnolyzer-scored AHI values was 0.93 (95% confidence interval: 0.91-0.96). Thus, interscorer correlation between the manually scored results was no different than that derived from manual and automated scoring. Substantial concordance in the arousal index, total sleep time, and sleep efficiency between manual and automated scoring was also observed. In contrast, differences were noted between manually and automated scored percentages of sleep stages N1, N2, and N3. Automated analysis of polysomnograms using the Somnolyzer system provides results that are comparable to manual scoring for commonly used metrics in sleep medicine. Although differences exist between manual versus automated scoring for specific sleep stages, the level of agreement between manual and automated scoring is not significantly different than that between any two human scorers. In light of the burden associated with manual scoring, automated
Ordered bulk degradation via autophagy
DEFF Research Database (Denmark)
Dengjel, Jörn; Kristensen, Anders Riis; Andersen, Jens S
2008-01-01
During amino acid starvation, cells undergo macroautophagy which is regarded as an unspecific bulk degradation process. Lately, more and more organelle-specific autophagy subtypes such as reticulophagy, mitophagy and ribophagy have been described and it could be shown, depending on the experimental...... at proteasomal and lysosomal degradation ample cross-talk between the two degradation pathways became evident. Degradation via autophagy appeared to be ordered and regulated at the protein complex/organelle level. This raises several important questions such as: can macroautophagy itself be specific and what...
In vitro degradation of ribosomes.
Mora, G; Rivas, A
1976-12-01
The cytoplasmic ribosomes from Euglena gracilis var. bacillaris are found to be of two types taking into consideration their stability "in vitro". In the group of unstable ribosomes the large subunit is degraded. The other group apparently does not suffer any degradation under the conditions described. However the RNAs extracted from both types of ribosomes are degraded during sucrose density gradients. The degradation of the largest RNA species has been reported previously, but no comment has been made about the stability of the ribosome itself.
Lysosomal degradation of membrane lipids.
Kolter, Thomas; Sandhoff, Konrad
2010-05-03
The constitutive degradation of membrane components takes place in the acidic compartments of a cell, the endosomes and lysosomes. Sites of lipid degradation are intralysosomal membranes that are formed in endosomes, where the lipid composition is adjusted for degradation. Cholesterol is sorted out of the inner membranes, their content in bis(monoacylglycero)phosphate increases, and, most likely, sphingomyelin is degraded to ceramide. Together with endosomal and lysosomal lipid-binding proteins, the Niemann-Pick disease, type C2-protein, the GM2-activator, and the saposins sap-A, -B, -C, and -D, a suitable membrane lipid composition is required for degradation of complex lipids by hydrolytic enzymes. Copyright 2009 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.
Automation and decision support in interactive consumer products.
Sauer, J.; Rüttinger, B.
2007-01-01
This article presents two empirical studies (n=30, n=48) that are concerned with different forms of automation in interactive consumer products. The goal of the studies was to evaluate the effectiveness of two types of automation: perceptual augmentation (i.e. supporting users' action selection and implementation). Furthermore, the effectiveness of non-product information (i.e. labels attached to product) in supporting automation design was evaluated. The findings suggested greater benefits f...
ORIGAMI Automator Primer. Automated ORIGEN Source Terms and Spent Fuel Storage Pool Analysis
Energy Technology Data Exchange (ETDEWEB)
Wieselquist, William A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Thompson, Adam B. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Bowman, Stephen M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Peterson, Joshua L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2016-04-01
Source terms and spent nuclear fuel (SNF) storage pool decay heat load analyses for operating nuclear power plants require a large number of Oak Ridge Isotope Generation and Depletion (ORIGEN) calculations. SNF source term calculations also require a significant amount of bookkeeping to track quantities such as core and assembly operating histories, spent fuel pool (SFP) residence times, heavy metal masses, and enrichments. The ORIGEN Assembly Isotopics (ORIGAMI) module in the SCALE code system provides a simple scheme for entering these data. However, given the large scope of the analysis, extensive scripting is necessary to convert formats and process data to create thousands of ORIGAMI input files (one per assembly) and to process the results into formats readily usable by follow-on analysis tools. This primer describes a project within the SCALE Fulcrum graphical user interface (GUI) called ORIGAMI Automator that was developed to automate the scripting and bookkeeping in large-scale source term analyses. The ORIGAMI Automator enables the analyst to (1) easily create, view, and edit the reactor site and assembly information, (2) automatically create and run ORIGAMI inputs, and (3) analyze the results from ORIGAMI. ORIGAMI Automator uses the standard ORIGEN binary concentrations files produced by ORIGAMI, with concentrations available at all time points in each assembly’s life. The GUI plots results such as mass, concentration, activity, and decay heat using a powerful new ORIGEN Post-Processing Utility for SCALE (OPUS) GUI component. This document includes a description and user guide for the GUI, a step-by-step tutorial for a simplified scenario, and appendices that document the file structures used.
The role of automation and robotics in space stations
Black, D. C.
1985-01-01
Automation and robotics have played important roles in space research, most notably in planetary exploration. While an increased need for automation and robotics in space research is anticipated, some of the major challenges and opportunities for automation and robotics will be provided by the Space Station. Examples of these challenges are briefly reviewed.
Ecological Automation Design, Extending Work Domain Analysis
Amelink, M.H.J.
2010-01-01
In high–risk domains like aviation, medicine and nuclear power plant control, automation has enabled new capabilities, increased the economy of operation and has greatly contributed to safety. However, automation increases the number of couplings in a system, which can inadvertently lead to more
How to Evaluate Integrated Library Automation Systems.
Powell, James R.; Slach, June E.
1985-01-01
This paper describes methodology used in compiling a list of candidate integrated library automation systems at a corporate technical library. Priorities for automation, identification of candidate systems, the filtering process, information for suppliers, software and hardware considerations, on-site evaluations, and final system selection are…
Automation for the Nineties: A Review Article.
Whitney, Gretchen; Glogoff, Stuart
1994-01-01
Describes the technical, political, economic, and cultural environments of library automation. A review is then presented of five books covering wide-ranging library automation themes, including practical experiences; planning second-generation library systems; software, systems, and services; new roles for librarians; and the national network…
Process computers automate CERN power supply installations
International Nuclear Information System (INIS)
Ullrich, H.; Martin, A.
1974-01-01
Higher standards of performance and reliability in the power plants of large particle accelerators necessitate increasing use of automation. The CERN (European Nuclear Research Centre) in Geneva started to employ process computers for plant automation at an early stage in its history. The great complexity and extent of the plants for high-energy physics first led to the setting-up of decentralized automatic systems which are now being increasingly combined into one interconnected automation system. One of these automatic systems controls and monitors the extensive power supply installations for the main ring magnets in the experimental zones. (orig.) [de
Spaceport Command and Control System Automation Testing
Hwang, Andrew
2017-01-01
The Spaceport Command and Control System (SCCS) is the National Aeronautics and Space Administrations (NASA) launch control system for the Orion capsule and Space Launch System, the next generation manned rocket currently in development. This large system requires high quality testing that will properly measure the capabilities of the system. Automating the test procedures would save the project time and money. Therefore, the Electrical Engineering Division at Kennedy Space Center (KSC) has recruited interns for the past two years to work alongside full-time engineers to develop these automated tests, as well as innovate upon the current automation process.
Spaceport Command and Control System Automated Testing
Stein, Meriel
2017-01-01
The Spaceport Command and Control System (SCCS) is the National Aeronautics and Space Administrations (NASA) launch control system for the Orion capsule and Space Launch System, the next generation manned rocket currently in development. This large system requires high quality testing that will properly measure the capabilities of the system. Automating the test procedures would save the project time and money. Therefore, the Electrical Engineering Division at Kennedy Space Center (KSC) has recruited interns for the past two years to work alongside full-time engineers to develop these automated tests, as well as innovate upon the current automation process.
Automated Ply Inspection (API) for AFP, Phase I
National Aeronautics and Space Administration — The Automated Ply Inspection (API) system autonomously inspects layups created by high speed automated fiber placement (AFP) machines. API comprises a high accuracy...
Knowledge-based automated radiopharmaceutical manufacturing for Positron Emission Tomography
International Nuclear Information System (INIS)
Alexoff, D.L.
1991-01-01
This article describes the application of basic knowledge engineering principles to the design of automated synthesis equipment for radiopharmaceuticals used in Positron Emission Tomography (PET). Before discussing knowledge programming, an overview of the development of automated radiopharmaceutical synthesis systems for PET will be presented. Since knowledge systems will rely on information obtained from machine transducers, a discussion of the uses of sensory feedback in today's automated systems follows. Next, the operation of these automated systems is contrasted to radiotracer production carried out by chemists, and the rationale for and basic concepts of knowledge-based programming are explained. Finally, a prototype knowledge-based system supporting automated radiopharmaceutical manufacturing of 18FDG at Brookhaven National Laboratory (BNL) is described using 1stClass, a commercially available PC-based expert system shell
An automated digital imaging system for environmental monitoring applications
Bogle, Rian; Velasco, Miguel; Vogel, John
2013-01-01
Recent improvements in the affordability and availability of high-resolution digital cameras, data loggers, embedded computers, and radio/cellular modems have advanced the development of sophisticated automated systems for remote imaging. Researchers have successfully placed and operated automated digital cameras in remote locations and in extremes of temperature and humidity, ranging from the islands of the South Pacific to the Mojave Desert and the Grand Canyon. With the integration of environmental sensors, these automated systems are able to respond to local conditions and modify their imaging regimes as needed. In this report we describe in detail the design of one type of automated imaging system developed by our group. It is easily replicated, low-cost, highly robust, and is a stand-alone automated camera designed to be placed in remote locations, without wireless connectivity.
Lyu, Suping
2011-03-01
Materials derived from agricultural products such as cellulose, starch, polylactide, etc. are more sustainable and environmentally benign than those derived from petroleum. However, applications of these polymers are limited by their processing properties, chemical and thermal stabilities. For example, polyethylene terephthalate fabrics last for many years under normal use conditions, but polylactide fabrics cannot due to chemical degradation. There are two primary mechanisms through which these polymers degrade: via hydrolysis and via oxidation. Both of these two mechanisms are related to combined factors such as monomer chemistry, chain configuration, chain mobility, crystallinity, and permeation to water and oxygen, and product geometry. In this talk, we will discuss how these materials degrade and how the degradation depends on these factors under application conditions. Both experimental studies and mathematical modeling will be presented.
Fang, Shumei; An, Xuejiao; Liu, Hongyuan; Cheng, Yi; Hou, Ning; Feng, Lu; Huang, Xinning; Li, Chunyan
2015-06-01
Nitriles are common environmental pollutants, and their removal has attracted increasing attention. Microbial degradation is considered to be the most acceptable method for removal. In this work, we investigated the biodegradation of three aliphatic nitriles (acetonitrile, acrylonitrile and crotononitrile) by Rhodococcus rhodochrous BX2 and the expression of their corresponding metabolic enzymes. This organism can utilize all three aliphatic nitriles as sole carbon and nitrogen sources, resulting in the complete degradation of these compounds. The degradation kinetics were described using a first-order model. The degradation efficiency was ranked according to t1/2 as follows: acetonitrile>trans-crotononitrile>acrylonitrile>cis-crotononitrile. Only ammonia accumulated following the three nitriles degradation, while amides and carboxylic acids were transient and disappeared by the end of the assay. mRNA expression and enzyme activity indicated that the tested aliphatic nitriles were degraded via both the inducible NHase/amidase and the constitutive nitrilase pathways, with the former most likely preferred. Copyright © 2015 Elsevier Ltd. All rights reserved.
Plant automation-application to SBWR project
International Nuclear Information System (INIS)
Rodriguez Rodriguez, C.
1995-01-01
In accordance with the requirements set out in the URD (Utility Requirements Document) issued by the EPRI (Electrical Power Research Institute), the design of new reactors, whether evolutionary or passive, shall taken into account the systematic automation of functions relating to normal plant operation. The objectives established are to: =2E Simplify operator-performed tasks =2E Reduce the risk of operator-error by considering human factors in the allocation of tasks =2E Improve man-machine reliability =2E Increase the availability of the plant In previous designs, automation has only been considered from the point of view of compliance with regulatory requirements for safety-related systems, or in isolated cases, as a method of protecting the investment where there is a risk of damage to main equipment. The use of digital technology has prevented the systematic pursuit of such objectives in the design of automated systems for processes associated with normal plant operation (startup, load follow, normal shutdown, etc) from being excessively complex and therefore costly to undertake. This paper describes how the automation of the aforementioned normal plant operation activities has been approached in General Electric's SBWR (Simplified Boiling Water Reactor) design. (Author)
Bala, John L.
1995-08-01
Automation and polymer science represent fundamental new technologies which can be directed toward realizing the goal of establishing a domestic, world-class, commercial optics business. Use of innovative optical designs using precision polymer optics will enable the US to play a vital role in the next generation of commercial optical products. The increased cost savings inherent in the utilization of optical-grade polymers outweighs almost every advantage of using glass for high volume situations. Optical designers must gain experience with combined refractive/diffractive designs and broaden their knowledge base regarding polymer technology beyond a cursory intellectual exercise. Implementation of a fully automated assembly system, combined with utilization of polymer optics, constitutes the type of integrated manufacturing process which will enable the US to successfully compete with the low-cost labor employed in the Far East, as well as to produce an equivalent product.
22 CFR 120.30 - The Automated Export System (AES).
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The Automated Export System (AES). 120.30... DEFINITIONS § 120.30 The Automated Export System (AES). The Automated Export System (AES) is the Department of... system for collection of export data for the Department of State. In accordance with this subchapter U.S...
Physics of automated driving in framework of three-phase traffic theory.
Kerner, Boris S
2018-04-01
We have revealed physical features of automated driving in the framework of the three-phase traffic theory for which there is no fixed time headway to the preceding vehicle. A comparison with the classical model approach to automated driving for which an automated driving vehicle tries to reach a fixed (desired or "optimal") time headway to the preceding vehicle has been made. It turns out that automated driving in the framework of the three-phase traffic theory can exhibit the following advantages in comparison with the classical model of automated driving: (i) The absence of string instability. (ii) Considerably smaller speed disturbances at road bottlenecks. (iii) Automated driving vehicles based on the three-phase theory can decrease the probability of traffic breakdown at the bottleneck in mixed traffic flow consisting of human driving and automated driving vehicles; on the contrary, even a single automated driving vehicle based on the classical approach can provoke traffic breakdown at the bottleneck in mixed traffic flow.
Necessity of supporting situation understanding to prevent over-trust in automation
International Nuclear Information System (INIS)
Itoh, Makoto
2010-01-01
It is necessary to clarify how a human operator comes to expect that an automation will perform a task successfully even beyond the limit of the automation. This paper proposes a way of modeling trust in automation by which it is possible to discuss how an operator's trust in automation becomes over-trust. On the basis of the model, an experiment using a micro world was conducted to examine whether the range of user's expectation per se surpasses the limit of the capability of the automation. The results revealed that informing the human operator of the functional limit of capability of automation without giving an appropriate reason was effective but not perfect for avoiding human operator's over trust. It was also shown that the understanding of the automation's limitation can be changed through experiences due to confusion about the situation, therefore, it is necessary to support adequate situation understanding of the human operator in order to prevent over-trust in automation. (author)
Physics of automated driving in framework of three-phase traffic theory
Kerner, Boris S.
2018-04-01
We have revealed physical features of automated driving in the framework of the three-phase traffic theory for which there is no fixed time headway to the preceding vehicle. A comparison with the classical model approach to automated driving for which an automated driving vehicle tries to reach a fixed (desired or "optimal") time headway to the preceding vehicle has been made. It turns out that automated driving in the framework of the three-phase traffic theory can exhibit the following advantages in comparison with the classical model of automated driving: (i) The absence of string instability. (ii) Considerably smaller speed disturbances at road bottlenecks. (iii) Automated driving vehicles based on the three-phase theory can decrease the probability of traffic breakdown at the bottleneck in mixed traffic flow consisting of human driving and automated driving vehicles; on the contrary, even a single automated driving vehicle based on the classical approach can provoke traffic breakdown at the bottleneck in mixed traffic flow.
Research on the Reliability Testing of Electrical Automation Control Equipment
Yongjie Luo
2014-01-01
According to the author’s many years’ work experience, this paper first discusses the concepts of electrical automation control equipment reliability testing, and then analyzes the test method of electrical automation control equipment reliability testing, finally, on this basis, this article discusses how to determine the reliability test method of electrical automation control equipment. Results of this study will provide a useful reference for electrical automation control equipment reliab...
Enzymatic degradation of polycaprolactone–gelatin blend
International Nuclear Information System (INIS)
Banerjee, Aditi; Chatterjee, Kaushik; Madras, Giridhar
2015-01-01
Blends of polycaprolactone (PCL), a synthetic polymer and gelatin, natural polymer offer a optimal combination of strength, water wettability and cytocompatibility for use as a resorbable biomaterial. The enzymatic degradation of PCL, gelatin and PCL–gelatin blended films was studied in the presence of lipase (Novozym 435, immobilized) and lysozyme. Novozym 435 degraded the PCL films whereas lysozyme degraded the gelatin. Though Novozym 435 and lysozyme individually could degrade PCL–gelatin blended films, the combination of these enzymes showed the highest degradation of these blended films. Moreover, the enzymatic degradation was much faster when fresh enzymes were added at regular intervals. The changes in physico-chemical properties of polymer films due to degradation were studied by scanning electron microscopy, Fourier transform infrared spectroscopy and differential scanning calorimetry. These results have important implications for designing resorbable biomedical implants. (paper)
Design automation, languages, and simulations
Chen, Wai-Kai
2003-01-01
As the complexity of electronic systems continues to increase, the micro-electronic industry depends upon automation and simulations to adapt quickly to market changes and new technologies. Compiled from chapters contributed to CRC's best-selling VLSI Handbook, this volume covers a broad range of topics relevant to design automation, languages, and simulations. These include a collaborative framework that coordinates distributed design activities through the Internet, an overview of the Verilog hardware description language and its use in a design environment, hardware/software co-design, syst
Lifecycle, Iteration, and Process Automation with SMS Gateway
Directory of Open Access Journals (Sweden)
Fenny Fenny
2015-12-01
Full Text Available Producing a better quality software system requires an understanding of the indicators of the software quality through defect detection, and automated testing. This paper aims to elevate the design and automated testing process in an engine water pump of a drinking water plant. This paper proposes how software developers can improve the maintainability and reliability of automated testing system and report the abnormal state when an error occurs on the machine. The method in this paper uses literature to explain best practices and case studies of a drinking water plant. Furthermore, this paper is expected to be able to provide insights into the efforts to better handle errors and perform automated testing and monitoring on a machine.