WorldWideScience

Sample records for actinium 231

  1. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  2. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  3. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  4. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  7. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. Comment: 231 [Taxonomy Icon

    Full Text Available Acytostelium subglobosum Acytostelium subglobosum Acytostelium_subglobosum_L.png 231.png Hideko ... of Tsukuba) licensed under CC Attribution2.1 Japan 写真 提供:漆原秀子 (筑波大学) Photograph provided by Hid ...

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  12. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. Exposure to radioactive aerosols in mining and milling operations: the importance of 227Ac and 231Pa

    'Full-Text:' 227Ac (half-life of 21.8 y) is the daughter or 231Pa; a beta emitter and parent of a subseries with five short-lived alpha-emitters. 231Pa (half-life of 3.27x104 y) is an alpha-emitter of the actinium series, the decay chain of 235U. As daughters of this uranium isotope they are thought to be unimportant as a radiological hazard, despite the fact that their ALI values for ingestion and inhalation are the lowest of any other radionuclide. Both nuclides can be considered as being in secular equilibrium with uranium in most geological media and so the mass concentration of 231Pa is the same of the 226Ra and that of 227Ac is the same of the 210Pa, to mention only two radionuclides of radiological concern. It is shown in this paper that if 231Pa and 227Ac are considered in the evaluations of dose commitments incurred by inhalation of aerosols in mining and milling operations, the results can be 70% higher than those calculated by the methodology of ICRP Publication 47. (author)

  14. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  16. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  17. 49 CFR 231.6 - Flat cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flat cars. 231.6 Section 231.6 Transportation... TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.6 Flat cars. (Cars with sides 12 inches or less above the floor may be equipped the same as flat cars.) (a) Hand brakes—(1) Number. Same as specified...

  18. 49 CFR 238.231 - Brake system.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Brake system. 238.231 Section 238.231... Equipment § 238.231 Brake system. Except as otherwise provided in this section, on or after September 9... train's primary brake system shall be capable of stopping the train with a service application from...

  19. 32 CFR 231.3 - Responsibilities.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 231.3 Section 231.3 National... § 231.3 Responsibilities. (a) The Under Secretary of Defense (Comptroller) (USD(C)) shall develop and... DoD installations within the guidance contained herein and in DoD Directive 1000.11 (32 CFR part...

  20. 32 CFR 231.2 - Policy.

    2010-07-01

    ... Policy. The policy pertaining to financial institutions operating on DoD installations is contained in DoD Directive 1000.11 (32 CFR part 230) and in § 231.4. ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 231.2 Section 231.2 National...

  1. 22 CFR 231.16 - Governing law.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 231.16 Section 231.16 Foreign... EMERGENCY WARTIME SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUBLIC LAW 108-11-STANDARD TERMS AND CONDITIONS § 231.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws...

  2. 22 CFR 231.14 - Arbitration.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 231.14 Section 231.14 Foreign... § 231.14 Arbitration. Any controversy or claim between USAID and any noteholder arising out of this Guarantee shall be settled by arbitration to be held in Washington, DC in accordance with the...

  3. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  4. 9 CFR 354.231 - Accessibility.

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Accessibility. 354.231 Section 354.231 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY... Accessibility. All equipment shall be so placed as to be readily accessible for all processing and...

  5. 27 CFR 25.231 - Finished beer.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Finished beer. 25.231... OF THE TREASURY LIQUORS BEER Beer Purchased From Another Brewer § 25.231 Finished beer. (a) A brewer may obtain beer in barrels and kegs, finished and ready for sale from another brewer. The...

  6. 46 CFR 108.231 - Application.

    2010-10-01

    ... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.231 Application. Sections 108.231 through 108.241 apply to each unit with a helicopter landing facility....

  7. 40 CFR 436.231 - Specialized definitions.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.231 Section 436.231 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Magnesite Subcategory §...

  8. 29 CFR 1952.231 - Developmental schedule.

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.231 Section 1952.231 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. The Kentucky state plan is developmental. The following is the developmental schedule as...

  9. Prospection for natural 231Pa in India

    Protactinium-231 (231Pa) occurs in nature as a member of the decay chain of naturally occuring 235U of the 4n+ 3 radioactive series. The expected protactinium concentration in the Jaduguda ore body (with uranium concentration of 0.03-0.06 %) is around 0.2 parts per billion (ppb) and that in monazite ore (uranium concentration 0.3%) is 0.9 ppb. The process at uranium ore processing plant at Jaduguda was studied. 231Pa content in samples from the process streams of the plant was determined. The gamma ray spectrometry method was chosen and standardised in our laboratory to detect and measure 231Pa in parts per billion levels in these samples. A concentrated source of protactinium could not be found among the assessed streams of Jaduguda uranium plant. The Monazite processing plant at IRE, Aluva was then studied. From the known chemistry of protactinium, the possible distribution of the 231Pa was guessed at. Accordingly, the process streams of IRE process plant were selected to prospect for 231Pa and determine the fractionation of protactinium. For analysis of 231Pa, the thorium bearing samples were chemically treated to remove the thorium daughter products, which interfere in gamma spectrometry. This report describes the planning for prospecting, sample selection, the standardisation of the analysis procedure for determination of 231Pa content, and the analysis results. The 231Pa content in various streams of Indian Rare Earths plant was found in the range 0.2 -6.5 ppb. Some of the streams did not carry any protactinium. The fractionation of 231Pa in the various streams of the plant and the selection of source for recovery of protactinium are discussed in detail. (author)

  10. Dicty_cDB: SHF231 [Dicty_cDB

    Full Text Available SH (Link to library) SHF231 (Link to dictyBase) - - - - SHF231P (Link to Original site) SHF231F ... anslated Amino Acid sequence (All Frames) Frame A: atk *ngygkyysflkkwf*pitnhcnnnnrcqwnihlypfssrkllrfthctkr ...

  11. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  12. In-beam spectroscopy of 231Pa

    Information on energy levels and on E2 and M1 matrix elements in 231Pa has been obtained using conversion-electron and gamma-ray spectroscopy following the 232Th(p, 2p)231Pa reaction and Coulomb excitation of the radioactive target 231Pa by 4He and 32S ions. The results are analyzed in the framework of the rotational model, applied to the rotational band built on the 1/2-[530] Nilsson state whose 3/2- member forms the ground state of this nucleus. The deviations of the level energies from the rigidrotor values can be described by Coriolis couplings. The analysis of the Coulomb-excitation process shows that a constant set of rotational parameters Q0, gR, gK, and b can fairly well account for the measured line intensities. (orig.)

  13. 22 CFR 231.02 - Definitions.

    2010-04-01

    ... States Government. (o) Guarantee means the guarantee of USAID pursuant to this part 231 and the Emergency..., joint stock company, trust, unincorporated organization, or government or any agency or political....15. (n) Business day means any day other than a day on which banks in New York, NY are closed...

  14. 36 CFR 223.231 - Bidding methods.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.231... methods. The Contracting Officer or designated forest officer shall offer advertised sales of special forest products through sealed bid or sealed bid followed by oral auction. The method selected shall:...

  15. 49 CFR 231.18 - Cars of special construction.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Cars of special construction. 231.18 Section 231... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.18 Cars of special construction. Cars of construction not covered specifically in the foregoing sections in this part, relative...

  16. 48 CFR 231.205-22 - Legislative lobbying costs.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Legislative lobbying costs. 231.205-22 Section 231.205-22 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Contracts With Commercial Organizations 231.205-22 Legislative lobbying costs. (a) Costs associated...

  17. 14 CFR 16.231 - Offer of proof.

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Offer of proof. 16.231 Section 16.231... PRACTICE FOR FEDERALLY-ASSISTED AIRPORT ENFORCEMENT PROCEEDINGS Hearings § 16.231 Offer of proof. A party whose evidence has been excluded by a ruling of the hearing officer may offer the evidence on the...

  18. Potential Effects of Chrysin on MDA-MB-231 Cells

    Maimunah Ahmad; Khoo Boon Yin; Thaneswary Yogarajah; Anizah Rahumatullah; Teh Ban Hong

    2010-01-01

    This study aims to elucidate the effects of chrysin on human ER-negative breast cancer cell line, MDA-MB-231. The study demonstrated that treatment of MDA-MB-231 cells with 20 µM chysin for 48 h significantly inhibited the growth of MDA-MB-231 cells and induced cytoplasmic lipid accumulation in the cells, but that the observed of cell death was not caused by apoptosis. The expression of PPARalpha mRNA in chrysin-treated MDA-MB-231 cells was significantly increased, which was likely associated...

  19. 49 CFR 231.22 - Operation of track motor cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Operation of track motor cars. 231.22 Section 231... motor cars. On and after August 1, 1963, it shall be unlawful for any railroad subject to the requirements of the Safety Appliance Acts to operate or permit to be operated on its line track motor cars...

  20. 49 CFR 192.231 - Protection from weather.

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Protection from weather. 192.231 Section 192.231 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... weather. The welding operation must be protected from weather conditions that would impair the quality...

  1. 40 CFR 795.231 - Pharmacokinetics of isopropanal.

    2010-07-01

    ... intravenously to four rats of each sex. (B) Oral. Two doses of test substance shall be used in the oral portion... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Pharmacokinetics of isopropanal. 795.231 Section 795.231 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED)...

  2. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  3. 231Pa systematics in postglacial volcanic rocks from Iceland

    Turner, Simon; Kokfelt, Thomas; Hoernle, Kaj; Lundstrom, Craig; Hauff, Folkmar

    2016-07-01

    Several recent studies have highlighted the potential of combined 238U-230Th and 235U-231Pa systematics to constrain upwelling rates and the role of recycled mafic lithologies in mantle plume-derived basalts. Accordingly, we present measurements of the 231Pa concentrations from 26 mafic volcanic rocks from Iceland, including off-axis basalts from the Snaefellsnes Peninsula, to complement previously published 238U-230Th-226Ra data. 231Pa concentrations vary from 27 to 624 fg/g and (231Pa/235U) ratios from 1.12 to 2.11 with the exception of one anomalous sample from the Southeast Rift which has a 231Pa deficit with (231Pa/235U) = 0.86. An important new result is that basalts from the Southeast Rift and the Snaefellsnes Peninsula define a trend at relatively low (231Pa/235U) for a given (230Th/238U) ratio. Many of the remaining samples fall in or around the global field for ocean island basalts but those from the Mid-Iceland Belt and the Southwest Rift/Reykjanes Peninsula extend to higher (231Pa/235U) ratios at a given (230Th/238U), similar to mid-ocean ridge basalts. In principle, these lavas could result from melting of peridotite at lower pressures. However, there is no reason to suspect that the Mid-Iceland Belt and the Southwest Rift lavas reflect shallower melting than elsewhere in Iceland. In our preferred model, these lavas reflect melting of garnet peridotite whereas those from the Southeast Rift and the Snaefellsnes Peninsula contain a significant contribution (up to 20%) of melt from garnet pyroxenite. This is consistent with incompatible trace element and radiogenic isotope evidence for recycled oceanic crust in these lavas. There is increasing agreement that the displacement of ocean island basalts to lower (231Pa/235U) ratios at a given (230Th/238U), compared to mid-ocean ridge basalts, reflects the role of recycled mafic lithologies such as garnet pyroxenite as well as higher average pressures of melting. It now seems likely that this interpretation may

  4. Dicty_cDB: VFN231 [Dicty_cDB

    Full Text Available T AGTAAAATTAATAATAATATTAAATAATAATAAAAAAAATCACTCATA Length of 3' end seq. 708 Connected seq. ID VFN231P Connect...AGACCTG GTAAATTCTTCAATGCTATTGCAAATCCACAAAATAAATAAGAAATAGTAAAATTAATAA TAATATTAAATAATAATAAAAAAAATCACTCATA Length of connect...s... 374 0.0 AC115607_16( AC115607 |pid:none) Dictyostelium discoideum chromoso... 374 0.0 AP004028_2( AP004028 |pid:none...r 8.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFN231 is...efimvhvhkqqd**qqyleqqd slvdi*yny*hvqvfk*lyhtdvkmkvfvisrcwan*vksfqfvsileianqlkeqfhtq tlssiwlvvimklvishstismfm

  5. 40 CFR 231.6 - Administrator's final determinations.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Administrator's final determinations... DUMPING SECTION 404(c) PROCEDURES § 231.6 Administrator's final determinations. After reviewing the recommendations of the Regional Administrator or his designee, the Administrator shall within 30 days of...

  6. 32 CFR 231.6 - Procedures-overseas banks.

    2010-07-01

    ... underwrite such banking services. (D) Establishment of a U.S. dollar currency custody account to support... identified and either the banking and currency control laws of certain host countries do not permit MBFs to... § 231.1(a). (D) Education, on a space-available, tuition-paying basis, provided by the Department...

  7. 32 CFR Appendix A to Part 231 - Sample Operating Agreement

    2010-07-01

    ... the DoD 7000.14-R (as codified in the Code of Federal Regulations (CFR) at 32 CFR parts 230 and 231... requirements in Volume 5, Chapter 34, of DoD 7000.14-R, as codified in the Code of Federal Regulations (CFR... programs, financial management program and newcomer's briefings. g. Prominently post in the lobby of...

  8. 49 CFR 231.21 - Tank cars without underframes.

    2010-10-01

    ... inches. (3) Location. One safety railing at each end of car shall extend horizontally across car not less... car at center. (ii) The safety railing shall enclose the operating platform, manway and fittings used... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.21 Tank cars...

  9. 49 CFR 231.9 - Tank cars without end sills.

    2010-10-01

    ...) Clearance of outer end of handhold shall be not more than 12 inches from end of car. (iv) If safety railings.... (3) Location. Safety railings shall be continuous around sides and ends of car, not less than 30 nor..., DEPARTMENT OF TRANSPORTATION RAILROAD SAFETY APPLIANCE STANDARDS § 231.9 Tank cars without end sills....

  10. 48 CFR 231.205-70 - External restructuring costs.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false External restructuring... PROCEDURES Contracts With Commercial Organizations 231.205-70 External restructuring costs. (a) Scope. This subsection— (1) Prescribes policies and procedures for allowing contractor external restructuring costs...

  11. 40 CFR 180.231 - Dichlobenil; tolerances for residues.

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Dichlobenil; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.231 Dichlobenil; tolerances for residues. (a) General. Tolerances are established for the...

  12. 49 CFR 231.5 - Drop-end low-side gondola cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Drop-end low-side gondola cars. 231.5 Section 231... gondola cars. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1)). (2) Dimensions. Same as specified for “Box and other house cars” (see § 231.1(a)(2))....

  13. 49 CFR 231.3 - Drop-end high-side gondola cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Drop-end high-side gondola cars. 231.3 Section 231... gondola cars. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see § 231.1(a)(1)). (2) Dimensions. Same as specified for “Box and other house cars” (see § 231.1(a)(2))....

  14. 22 CFR 23.1 - Remittances made payable to the Department of State.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Remittances made payable to the Department of State. 23.1 Section 23.1 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.1 Remittances made payable to the Department of State. Except as otherwise specified in this...

  15. 32 CFR Appendix B to Part 231 - In-Store Banking

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false In-Store Banking B Appendix B to Part 231.... 231, App. B Appendix B to Part 231—In-Store Banking A. Selection Process. The purpose of this guidance... provide in-store banking services when such services are desired and approved by the...

  16. 27 CFR 31.231 - Destruction of marks and brands on wine containers.

    2010-04-01

    ... brands on wine containers. 31.231 Section 31.231 Alcohol, Tobacco Products and Firearms ALCOHOL AND... § 31.231 Destruction of marks and brands on wine containers. A dealer who empties any cask, barrel, keg, or other bulk container of wine must scrape or obliterate from the empty container all marks,...

  17. 5 CFR 9901.231 - Conversion of positions and employees to NSPS classification system.

    2010-01-01

    ... NSPS classification system. 9901.231 Section 9901.231 Administrative Personnel DEPARTMENT OF DEFENSE... MANAGEMENT) DEPARTMENT OF DEFENSE NATIONAL SECURITY PERSONNEL SYSTEM (NSPS) Classification Transitional Provisions § 9901.231 Conversion of positions and employees to NSPS classification system. (a)...

  18. 5 CFR 9701.231 - Conversion of positions and employees to the DHS classification system.

    2010-01-01

    ... the DHS classification system. 9701.231 Section 9701.231 Administrative Personnel DEPARTMENT OF... MANAGEMENT) DEPARTMENT OF HOMELAND SECURITY HUMAN RESOURCES MANAGEMENT SYSTEM Classification Transitional Provisions § 9701.231 Conversion of positions and employees to the DHS classification system. (a)...

  19. A BLAZAR-LIKE RADIO FLARE IN MRK 231

    Radio monitoring of the broad absorption line quasar (BALQSO) Mrk 231 from 13.9 GHz to 17.6 GHz detected a strong flat spectrum flare. Even though BALQSOs are typically weak radio sources, the 17.6 GHz flux density doubled in ≈150 days, from ≈135 mJy to ≈270 mJy. It is demonstrated that the elapsed rise time in the quasar rest frame and the relative magnitude of the flare is typical of some of the stronger flares in blazars that are usually associated with the ejection of discrete components on parsec scales. The decay of a similar flare was found in a previous monitoring campaign at 22 GHz. We conclude that these flares are not rare. The implication is that Mrk 231 seems to be a quasar in which the physical mechanism that produces the broad absorption line wind is in tension with the emergence of a fledgling blazar

  20. A BLAZAR-LIKE RADIO FLARE IN MRK 231

    Reynolds, Cormac; Hurley-Walker, Natasha [ICRAR-Curtin University, GPO Box U1987, Perth, Western Australia, 6102 (Australia); Punsly, Brian [1415 Granvia Altamira, Palos Verdes Estates, CA 90274 (United States); O' Dea, Christopher P., E-mail: brian.punsly1@verizon.net, E-mail: brian.punsly@comdev-usa.com [Laboratory for Multiwavelength Astrophysics, School of Physics and Astronomy, Rochester Institute of Technology, 54 Lomb Memorial Drive, Rochester, NY 14623 (United States)

    2013-10-20

    Radio monitoring of the broad absorption line quasar (BALQSO) Mrk 231 from 13.9 GHz to 17.6 GHz detected a strong flat spectrum flare. Even though BALQSOs are typically weak radio sources, the 17.6 GHz flux density doubled in ≈150 days, from ≈135 mJy to ≈270 mJy. It is demonstrated that the elapsed rise time in the quasar rest frame and the relative magnitude of the flare is typical of some of the stronger flares in blazars that are usually associated with the ejection of discrete components on parsec scales. The decay of a similar flare was found in a previous monitoring campaign at 22 GHz. We conclude that these flares are not rare. The implication is that Mrk 231 seems to be a quasar in which the physical mechanism that produces the broad absorption line wind is in tension with the emergence of a fledgling blazar.

  1. 2.3.1 Biological Effects of Ionizing Radiations

    Kaul, A.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Subsection '2.3.1 Biological Effects of Ionizing Radiations' of the Section '2.3 Biological Effects' of the Chapter '2 Radiation and Biological Effects' with the comtents:

  2. Period of Light Variability in BL Lac ON 231

    Xu Yun Bing; Zhang Hao Jing; Zhang Xiong; Mao Wei Ming; Dong Fu Tong

    2011-03-01

    In this paper, the authors have compiled the data of about 100 years in B-band of the BL Lac ON 231 and used this database to analyze periodicity signals in the optical light curve. Two different methods were applied: the wavelet analysis and the Discrete Correlation Function (DCF) method. We revealed the existence of periods of 13.5 years in the source variability.

  3. Neutron-induced fission cross-section of 231 Pa

    Beside the importance of 231 Pa for basic fission studies it is also of interest in the field of future reactor design based on the thorium-uranium fuel cycle. The 232 Th/233 U breeder cycle, where the natural resources of the main fuel thorium are estimated to last for hundred thousands of years, is contemplated to provide 'clean' and almost inexhaustible nuclear energy. Among the first priority isotopes the IAEA had pointed out 231 Pa and 233 Pa. Both are of special interest being intermediate nuclei in the formation of the fissile 233 U from the fertile 232 Th. The latter has been investigated in the recent past in great detail. In particular, 231 Pa carry a similar risk as 239 Pu does in the standard uranium-plutonium cycle due to its comparable half-life and radio-toxicity. Despite the wealth of existing experimental data important discrepancies exist, a scenario, which holds for the existing evaluated data files ENDF/B-VI and JENDL-3.3, too. Presently, the neutron-induced fission cross-section of 231 Pa is under investigation at the VdG neutron source at IRMM for incident neutron energies up to 20 MeV. The obtained cross-sections, representing the 3rd and higher chance fission in 233 Pa(n,f) will serve as precise input for the validation of the reaction cross-section calculations performed on 233 Pa up to 20 MeV and the envisaged extension up to 50 MeV. (authors)

  4. Dealing with a Pa-231 contaminated ventilation duct - 59248

    Cambridge University had worked in the 1960's and 1970's with Pa-231, a decay product of U-235. The fume cupboards discharged into ventilation ducting made from asbestos cement. The university wished to refurbish the laboratory and the RPA had negotiated over many years with the Environment Agency to set up a project to remove the ducting both to reduce the radiological hazards and as part of a programme to remove unwanted circuits and upgrade the ventilation system to modern standards. Contamination levels were significant and low dose rates were measurable on the external surface. The aim was to be able to remove the ducting and treat it as asbestos waste, rather than to have to treat the debris as asbestos contaminated radioactive waste. The age of the contaminant was such that a large fraction of the decay chain had grown in, giving a mixture of alpha, beta and gamma emissions. The most useful nuclides for surface monitoring were Pb-211 and Tl-207, both of which are energetic beta emitters. A wide energy range beta detector was used, but it was fitted with a filter to absorb any alpha radiation which otherwise would have contributed to the signal for good surfaces but not for dusty, damp or rough surfaces and would have contributed to the uncertainty in the activity assessment. Samples were checked using gamma spectrometry to confirm that only Pa-231 and its progeny were present in significant quantities. The gamma spectrum is complicated and this paper describes the difficulties in confirming that the spectrum only contained the Pa-231 decay chain. The vast majority of the contaminated ducting was successfully consigned as asbestos, rather than radioactive, waste. The other problem was dealing with the soft waste produced during the dismantling process. This was monitored using simple equipment and it was possible to demonstrate that it could be disposed of with the rest of the waste under the relevant UK legislation. (authors)

  5. IS231A from Bacillus thuringiensis is functional in Escherichia coli: transposition and insertion specificity.

    Hallet, Bernard; Rezsohazy, René; Delcour, Jean

    1991-01-01

    A kanamycin resistance gene was introduced within the insertion sequence IS231A from Bacillus thuringiensis, and transposition of the element was demonstrated in Escherichia coli. DNA sequencing at the target sites showed that IS231A transposition results in direct repeats of variable lengths (10, 11, and 12 bp). These target sequences resemble the terminal inverted repeats of the transposon Tn4430, which are the preferred natural insertion sites of IS231 in B. thuringiensis.

  6. Loquat (Eriobotrya japonica) leaf extract inhibits the growth of MDA-MB-231 tumors in nude mouse xenografts and invasion of MDA-MB-231 cells

    You, Mi-Kyoung; Kim, Min-Sook; Jeong, Kyu-Shik; Kim, Eun; Kim, Yong-Jae; Kim, Hyeon-A

    2016-01-01

    BACKGROUND/OBJECTIVES The present study was conducted to examine the inhibitory effect of loquat leaves on MDA-MB-231 cell proliferation and invasion. MATERIALS/METHODS Female athymic nude mice were given a subcutaneous (s.c.) inoculation of MDA-MB-231 cells and randomly grouped to receive a s.c. injection of either 500 mg/kg ethanol, water extract or vehicle five times a week. Tumor growth, mitotic rate and necrosis were examined. MDA-MB-231 cells were cultured with DMSO or with various conc...

  7. Opportunistic infections and malignancies in 231 Danish AIDS patients

    Pedersen, C; Gerstoft, J; Tauris, P;

    1990-01-01

    We analysed cumulative disease frequencies in the first 231 adult Danish AIDS patients with life tables. There was a certain hierarchical pattern in the occurrence of complicating diseases. Herpes zoster, Kaposi's sarcoma and Pneumocystis carinii pneumonia were early manifestations, whereas...... diseases caused by cytomegalovirus and atypical mycobacteria tended to occur later in the course of AIDS. Compared with all other AIDS patients, homosexual men were more likely to develop Kaposi's sarcoma, cytomegalovirus chorioretinitis and mucocutaneous herpes simplex virus infection. The proportion of...... patients who developed particular diseases changed with calendar time. Most striking was a three to fourfold decrease in diseases caused by cytomegalovirus. In conclusion, the study showed that disease frequencies in patients with AIDS may vary with the patients risk behaviour and duration of AIDS, and...

  8. 25 CFR 900.231 - What is an organizational conflict of interest?

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false What is an organizational conflict of interest? 900.231... ASSISTANCE ACT Conflicts of Interest § 900.231 What is an organizational conflict of interest? An organizational conflict of interest arises when there is a direct conflict between the financial interests of...

  9. The 2q23.1 microdeletion syndrome: clinical and behavioural phenotype.

    Bon, B.W.M. van; Koolen, D.A.; Brueton, L.; McMullan, D.; Lichtenbelt, K.D.; Ades, L.C.; Peters, G.; Gibson, K.; Moloney, S.; Novara, F.; Pramparo, T.; Bernardina, B. Dalla; Zoccante, L.; Balottin, U.; Piazza, F.; Pecile, V.; Gasparini, P.; Guerci, V.; Kets, M.; Pfundt, R.; Brouwer, A.P.M. de; Veltman, J.A.; Leeuw, N. de; Wilson, M.; Antony, J.; Reitano, S.; Luciano, D.; Fichera, M.; Romano, C.; Brunner, H.G.; Zuffardi, O.; Vries, L.B.A. de

    2010-01-01

    Six submicroscopic deletions comprising chromosome band 2q23.1 in patients with severe mental retardation (MR), short stature, microcephaly and epilepsy have been reported, suggesting that haploinsufficiency of one or more genes in the 2q23.1 region might be responsible for the common phenotypic fea

  10. 47 CFR 51.231 - Provision of information on advanced services deployment.

    2010-10-01

    ... deployment. 51.231 Section 51.231 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON... of information on advanced services deployment. (a) An incumbent LEC must provide to requesting... a requesting carrier relies on a calculation-based approach to support deployment of a...

  11. 43 CFR 2.31 - How will DOI respond to my appeal?

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will DOI respond to my appeal? 2.31... OF INFORMATION ACT FOIA Appeals § 2.31 How will DOI respond to my appeal? (a) Appeals will be decided... will state the basis for DOI's decision as follows: (1) Decision to release or withhold records. (i)...

  12. Evidence for a chemically differentiated outflow in Mrk 231

    Lindberg, J E; Muller, S; Martí-Vidal, I; Falstad, N; Costagliola, F; Henkel, C; van der Werf, P; García-Burillo, S; González-Alfonso, E

    2015-01-01

    Aims: Our goal is to study the chemical composition of the outflows of active galactic nuclei and starburst galaxies. Methods: We obtained high-resolution interferometric observations of HCN and HCO$^+$ $J=1\\rightarrow0$ and $J=2\\rightarrow1$ of the ultraluminous infrared galaxy Mrk~231 with the IRAM Plateau de Bure Interferometer. We also use previously published observations of HCN and HCO$^+$ $J=1\\rightarrow0$ and $J=3\\rightarrow2$, and HNC $J=1\\rightarrow0$ in the same source. Results: In the line wings of the HCN, HCO$^+$, and HNC emission, we find that these three molecular species exhibit features at distinct velocities which differ between the species. The features are not consistent with emission lines of other molecular species. Through radiative transfer modelling of the HCN and HCO$^+$ outflow emission we find an average abundance ratio $X(\\mathrm{HCN})/X(\\mathrm{HCO}^+)\\gtrsim1000$. Assuming a clumpy outflow, modelling of the HCN and HCO$^+$ emission produces strongly inconsistent outflow masses....

  13. 8 CFR 231.2 - Electronic manifest and I-94 requirement for passengers and crew onboard departing vessels and...

    2010-01-01

    ... section 231 of the Act are set forth in 19 CFR 4.64 (passengers and crew members onboard vessels) and in 19 CFR 122.75a (passengers onboard aircraft) and 122.75b (crew members onboard aircraft). (b... for passengers and crew onboard departing vessels and aircraft. 231.2 Section 231.2 Aliens...

  14. 8 CFR 231.1 - Electronic manifest and I-94 requirement for passengers and crew onboard arriving vessels and...

    2010-01-01

    ... section 231 of the Act are set forth in 19 CFR 4.7b (passengers and crew members onboard vessels) and in 19 CFR 122.49a (passengers onboard aircraft) and 122.49b (crew members onboard aircraft). (b... for passengers and crew onboard arriving vessels and aircraft. 231.1 Section 231.1 Aliens...

  15. 231Pa and 233Pa neutron-induced fission up to 20 MeV

    Consistency of neutron-induced fission cross section data of 231Pa and 233Pa and data extracted from transfer reactions is investigated. Present estimate of 233Pa(n,f) fission cross section is supported by smooth level density parameter systematic, validated in case of 231Pa(n,f) data description up to En=20 MeV. The fission probabilities of Pa, fissioning in 231,233Pa(n,nf) reactions, are defined by fitting (3He,d) or (3He,t) transfer reaction data

  16. Inorganic sulfur reduces the motility and invasion of MDA-MB-231 human breast cancer cells

    Kim, Jin Joo; Ha, Ae Wha; Kim, Hee Sun; Kim, Woo Kyoung

    2011-01-01

    This study investigated the effects of inorganic sulfur on metastasis in MDA-MB-231 human breast cancer cells. MDA-MB-231 cells were cultured in the absence or presence of various concentrations (12.5, 25, or 50 µmol/L) of inorganic sulfur. Cell motility, invasion, and the activity and mRNA expression of matrix metalloproteases (MMPs) were examined. Numbers of viable MDA-MB-231 cells did not differ by inorganic sulfur treatment from 0 to 50 µmol/L within 48 h. Inorganic sulfur significantly d...

  17. Overexpression, purification and preliminary X-ray diffraction analysis of the controller protein C.Csp231I from Citrobacter sp. RFL231

    The crystallization of a novel controller protein is reported and its interaction with DNA is characterized. Restriction–modification controller proteins play an essential role in regulating the temporal expression of restriction–modification genes. The controller protein C.Csp231I represents a new class of controller proteins. The gene was sublconed to allow overexpression in Escherichia coli. The protein was purified to homogeneity and crystallized using the hanging-drop vapour-diffusion method. The crystals diffracted to 2.0 Å resolution and belonged to space group P21. An electrophoretic mobility-shift assay provided evidence of strong binding of C.Csp231I to a sequence located upstream of the csp231IC start codon

  18. Experimental study of piperlongumine inducing apoptosis of human breast adenoma MDA-MB-231 cells

    Zhifeng Yao; Jianxin Yao; Xia He; Zhanfeng Li; Yongbiao Liu

    2013-01-01

    Objective: The aim of the study was to investigate the apoptosis induced by piperlongumine on human breast adenoma MDA-MB-231 cells and the mechanism involved. Methods: Human breast adenoma MDA-MB-231 cells line was cultured in vitro. The inhibitory effect of piperlongumine on the proliferation of human breast adenoma MDA-MB-231 cells was measured by CCK-8 assay. Distribution of cell cycle was analyzed by flow cytometry. The apoptosis rates of MDA-MB- 231 cells were measured using Annexin V/PI staining. The flow cytometry with the probe of DCFH-DA was used to detect the intracellular reactive oxygen species levels. Western blot was used to explore the protein expression of Bcl-2 and Bax. Results: The CCK-8 assay showed that piperlongumine had an inhibiting effect on the proliferation of MDA-MB-231 cells in a concentration- and time-dependent manner. MDA-MB-231 cells were markedly arrested at G0/G1 phase after treatment of piperlongumine. Piperlongumine induced apoptosis of MDA-MB-231 cells obviously. The level of intracellular reactive oxygen species was increased in a dose-dependent manner. The antioxidant N-acetyl-L-cystein inhibited the apoptosis of cells and the level of intracellular reactive oxygen species was also decreased. By Western blot analysis, we found the expression of Bax was up-regulated whereas that of Bcl-2 was down-regulated in a concentration-dependent manner. Conclusion: Piperlongumine possesses a significant function for inhibiting proliferation, arresting cells at G0/G1 phase and inducing apoptosis of MDA-MB-231 cells, which seems to be associated with the increased generation of intracellular reactive oxygen species as well as the down-regulation of Bcl-2 and up-regulation of Bax.

  19. Celecoxib Inhibits Prion Protein 90-231-Mediated Pro-inflammatory Responses in Microglial Cells.

    Villa, Valentina; Thellung, Stefano; Corsaro, Alessandro; Novelli, Federica; Tasso, Bruno; Colucci-D'Amato, Luca; Gatta, Elena; Tonelli, Michele; Florio, Tullio

    2016-01-01

    Activation of microglia is a central event in the atypical inflammatory response occurring during prion encephalopathies. We report that the prion protein fragment encompassing amino acids 90-231 (PrP90-231), a model of the neurotoxic activity of the pathogenic prion protein (PrP(Sc)), causes activation of both primary microglia cultures and N9 microglial cells in vitro. This effect was characterized by cell proliferation arrest and induction of a secretory phenotype, releasing prostaglandin E2 (PGE2) and nitric oxide (NO). Conditioned medium from PrP90-231-treated microglia induced in vitro cytotoxicity of A1 mesencephalic neurons, supporting the notion that soluble mediators released by activated microglia contributes to the neurodegeneration during prion diseases. The neuroinflammatory role of COX activity, and its potential targeting for anti-prion therapies, was tested measuring the effects of ketoprofen and celecoxib (preferential inhibitors of COX1 and COX2, respectively) on PrP90-231-induced microglial activation. Celecoxib, but not ketoprofen significantly reverted the growth arrest as well as NO and PGE2 secretion induced by PrP90-231, indicating that PrP90-231 pro-inflammatory response in microglia is mainly dependent on COX2 activation. Taken together, these data outline the importance of microglia in the neurotoxicity occurring during prion diseases and highlight the potentiality of COX2-selective inhibitors to revert microglia as adjunctive pharmacological approach to contrast the neuroinflammation-dependent neurotoxicity. PMID:25404089

  20. Characterization of past and present solid waste streams from 231-Z

    During the next two decades the transuranic (TRU) wastes now stored in the burial trenches and storage facilities at the Hanford Site are to be retrieved, processed at the Waste Receiving and Processing Facility, and shipped to the Waste Isolation Pilot Plant near Carlsbad, New Mexico for final disposal. Over 8% of the TRU waste to be retrieved for shipment to the Waste Isolation Pilot Plant has been generated at the Plutonium Metallurgy Laboratory (231-Z) Facility. The purpose of this report is to characterize the radioactive solid wastes generated by 231-Z using process knowledge, existing records and oral history interviews. Since 1944 research and development programs utilizing plutonium have been conducted at 231-Z in the fields of physical metallurgy, property determination, alloy development, and process development. The following are sources of solid waste generation at the 231-Z Facility: (1) General Weapons Development Program, (2) process waste from gloveboxes, (3) numerous classified research and development programs, (4) advanced decontamination and decommissioning technologies, including sectioning, vibratory finishing, electropolishing, solution process, and small bench-scale work, (5) general laboratory procedures, (6) foundry area, (7) housekeeping activities, and (8) four cleanout campaigns. All solid wastes originating at 231-Z were packaged for onsite-offsite storage or disposal. Waste packaging and reporting requirements have undergone significant changes throughout the history of 231-Z. Current and historical procedures are provided in Section 4.0. Information on the radioactive wastes generated at 231-Z can be found in a number of documents and databases, most importantly the Solid Waste Information and Tracking System database and Solid Waste Burial Records. Facility personnel also provide excellent information about past waste generation and the procedures used to handle that waste. Section 5.0 was compiled using these sources

  1. Design study of Thorium-232 and Protactinium-231 based fuel for long life BWR

    Trianti, N.; Su'ud, Z.; Riyana, E. S.

    2012-06-01

    A preliminary design study for the utilization of thorium added with 231Pa based fuel on BWR type reactor has been performed. In the previous research utilization of fuel based Thorium-232 and Uranium-233 show 10 years operation time with maximum excess-reactivity about 4.075% dk/k. To increase reactor operation time and reduce excess-reactivity below 1% dk/k, Protactinium (Pa-231) is used as Burnable Poison. Protactinium-231 has very interesting neutronic properties, which enable the core to reduce initial excess-reactivity and simultaneously increase production of 233U to 231Pa in burn-up process. Optimizations of the content of 231Pa in the core enables the BWR core to sustain long period of operation time with reasonable burn-up reactivity swing. Based on the optimization of fuel element composition (Th and Pa) in various moderation ratio we can get reactor core with longer operation time, 20 ˜ 30 years operation without fuel shuffling or refuelling, with average power densities maximum of about 35 watt/cc, and maximum excess-reactivity 0.56% dk/k.

  2. Leptonic CP Violation Search and the Ambiguity of dm^2_31

    Koike, M; Saitó, M; Takeuchi, T; Koike, Masafumi; Okamura, Naotoshi; Saito, Masako; Takeuchi, Tatsu

    2006-01-01

    We consider a search for the CP-violating angle deltaCP in long baseline neutrino oscillation experiments. We show that the subleading deltaCP-dependent terms in the nu_mu -> nu_e oscillation probability can be easily obscured by the ambiguity of the leading term given by dm^2_31. It is thus necessary to determine the value of dm^2_31 with a sufficient accuracy. We point out that nu_mu survival events, which can be accumulated simultaneously with the nu_e appearance events, can serve for this purpose owing to its large statistics. Therefore, the combined analysis of nu_e appearance and nu_mu survival events is crucial to provide a restrictive constraint on deltaCP. Taking a test experimental setup, we demonstrate in the deltaCP-dm^2_31 plane that the analysis of nu_e appearance events leads to less restrictive constraints on the value of deltaCP due to the ambiguity of dm^2_31. In contrast, the combined analysis is capable of constraining the values of deltaCP and dm^2_31 into a single small region, and also ...

  3. Escape, Accretion or Star Formation? The Competing Depleters of Gas in Markarian 231

    Alatalo, Katherine

    2015-01-01

    We report on high resolution CO(1-0), CS(2-1) and 3mm continuum Combined Array for Research in Millimeter Astronomy (CARMA) observations of the molecular outflow host and nearest quasar Markarian 231. We use the CS(2-1) measurements to derive a dense gas mass within Mrk 231 of $1.8\\pm0.3\\times10^{10}$ $M_\\odot$, quite consistent with previous measurements. The CS(2-1) data also seem to indicate that the molecular disk of Mrk 231 is forming stars at normal efficiency. The high resolution CARMA observations were able to resolve the CO(1-0) outflow into two distinct lobes, allowing for a size estimate to be made and further constraining the molecular outflow dynamical time, further constraining the molecular gas escape rate. We find that 15% of the molecular gas within the Mrk 231 outflow actually exceeds the escape velocity in the central kiloparsec. Assuming that molecular gas is not constantly being accelerated, we find the depletion timescale of molecular gas in Mrk 231 to be 49 Myr, rather than 32 Myr, more...

  4. Molecular mechanisms mediating the neuroproyective effects of quinacrine and minocycline on cell death induced by the prion protein fragment 90-231 (hPrP90-231

    V. Villa

    2011-01-01

    Full Text Available The effects of quinacrine and minocycline on the toxicity induced by hPrP90-231 were studied. By mild thermal denaturation, hPrP90-231 can be converted in a toxic PrPSc-like structure affecting the survival of SH-SY5Y cells. Quinacrine and minocycline prevented hPrP90-231-induced toxicity interfering with different mechanisms: protective effects of quinacrine are mediated by the binding to the fragment that abolished hPrP90-231 structural changes and cell internalization, whereas, minocycline reverted MAP kinase neurotoxic signaling exerted by the prion fragment.

  5. Effect of amlodipine on apoptosis of human breast carcinoma MDA-MB-231 cells

    2008-01-01

    Objective: To elucidate the effects of amlodipine on the proliferation and apoptosis of human breast carcinoma MDA-MB-231 cells. Methods: Light microscopy was used to determine the effects of amiodipine on cell morphology; Flow cytometry was used to quantitate cells undergoing apoptosis; the expression of a cell cycle-related protein, proliferating cell nuclear antigen (PCNA) and an antiapoptosis protein, Bcl-2 were assessed by immunocytochemistry. Results: Amlodipine concentration of 8.25 Ixmol/L (1/2 of IC50) affected the morphology, decreased the expression of PCNA and Bcl-2 and induced apoptosis of human breast carcinoma MDA-MB-231 cells. Conclusion: The effect of amlodipine on the antiproliferation of human breast carcinoma MDA-MB-231 cells is related to inducement of apoptosis, and the decrease of the expression of Bcl-2 and PCNA may be the possible mechanism for proliferation inhibitory and inducement of apoptosis.

  6. 231Pa and 233Pa Neutron-Induced Fission Data Analysis

    The 231Pa and 233Pa neutron-induced fission cross-section database is analyzed within the Hauser-Feshbach approach. The consistency of neutron-induced fission cross-section data and data extracted from transfer reactions is investigated. The fission probabilities of Pa, fissioning in 231,233Pa(n,nf) reactions, are defined by fitting (3He,d) or (3He,t) transfer-reaction data. The present estimate of the 233Pa(n,f) fission cross section above the emissive fission threshold is supported by smooth level-density parameter systematics, validated in the case of the 231Pa(n,f) data description up to En =20 MeV

  7. The Binary Black Hole Model for Mrk 231 Cannot Explain the Observed Emission Lines

    Leighly, Karen M.; Terndrup, Donald M.; Gallagher, Sarah C.; Lucy, Adrian B.

    2016-01-01

    Mrk 231 is a nearby quasar with an unusually red continuum, generally explained as heavy reddening by dust (e.g., Leighly et al. 2014). Yan et al. 2015 proposed that Mrk 231 is a milli-parsec black-hole binary with little intrinsic reddening. The large-mass black hole experiences advection-dominated accretion, emitting little continuum, while the accretion disk of the small-mass black hole emits as an ordinary quasar, dominating the observed weak UV continuum and contributing all of the photo...

  8. The extraordinary optical outburst of ON 231 (W Com) in spring 1998

    Massaro, E.; Maesano, M.; Montagni, F.; Nesci, R.; Tosti, G.; Fiorucci, M.; Luciani, M.; Takalo, L. O.; Sillanpää, A.; Katajainen, S.; Keinänen, P.; Pursimo, T.; Villata, M.; Raiteri, C. M.; de Francesco, G.; Sobrito, G.; Efimov, Y. S.; Shakhovskoy, N. M.

    1999-02-01

    The BL Lac object ON 231 (1219+285, W Com) had an exceptional outburst phase in April-May 1998 and reached the most luminous state, observed at least since the beginning of the century. In this paper our multiband photometric light curves and polarimetric measurements of this event are presented. In the maximum phase the magnitude of ON 231 was R(Cousins)=12.2 and the optical spectral distribution was the flattest ever observed. Our data indicate that the main features of this burst can be explained by the presence of some emission components having different polarisation states and variability time scales ranging from 1 day to several months.

  9. Acute severe head injury resulted from road traffic accidents:a report on 231 cases

    刘敬业; 张赛; 等

    1999-01-01

    Objective:To analyze the epidemiology and clinical outcome of acute severe head injurey induced by road traffic accidents.Methods:The data of 231 patients with acute severe head injury induced by road traffic accidents were retrospectively studied.Results:The major victim-maker was automobiles (98.8%).The first three common types of traffic accidents were automobiles crashing into automobiles,automobiles crashing into bicycles(42.9%),and automobiles crashing pedestrians(40.3%).Eighty-seven patients out of 231 died,with the mortality of 37.7%.Conclusions:It suggests tat improving traffic administration and traffic safety consciousness may significantly reduce traffic trauma.

  10. 48 CFR 231.205-1 - Public relations and advertising costs.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Public relations and... PROCEDURES Contracts With Commercial Organizations 231.205-1 Public relations and advertising costs. (e) See... public relations and advertising costs also include monies paid to the Government associated with...

  11. The Light curve of ON 231 (W Com) during the spring 1998 outburst.

    Tosti, G.; Fiorucci, M.; Luciani, M.; Maesano, M.; Massaro, E.; Montagni, F.; Nesci, R.; Villata, M.; Raiteri, C. M.; de Francesco, G.; Sobrito, G.; Takalo, L. O.; Sillanpä, A.; Katajainen, S.; Pursimo, T.

    We present the data of the optical monitoring of ON 231 during April 1997-June 1998. Photometric observations in the Johnson-Cousins BVRI bands were carried out by the groups of Perugia, Roma, Torino, and Tuorla. During this campaign the source showed an exceptional outburst and was as bright as in the beginning of this century.

  12. The Rare 23.1-GHz Methanol Masers in NGC 7538 IRS 1

    Galván-Madrid, Roberto; Ramírez, Edgar A; Kurtz, Stan; Araya, Esteban; Hofner, Peter

    2010-01-01

    We present high angular resolution (FWHM_beam < 0.2") observations of the 23.1-GHz methanol (CH_3OH) transition toward the massive-star forming region NGC 7538 IRS 1. The two velocity components previously reported by Wilson et al. are resolved into distinct spatial features with brightness temperatures (T_B) greater than 10^4 K, proving their maser nature. Thus, NGC 7538 IRS 1 is the third region confirmed to show methanol maser emission at this frequency. The brighter 23.1-GHz spot coincides in position with a rare formaldehyde (H_2CO) maser, and marginally with a 22.2-GHz water (H_2O) maser, for which we report archival observations. The weaker CH_3OH spot coincides with an H_2O maser. The ratio of T_B for the 23.1-GHz masers to that of the well-known 12.2-GHz CH_3OH masers in this region roughly agrees with model predictions. However, the 23.1-GHz spots are offset in position from the CH_3OH masers at other frequencies. This is difficult to interpret in terms of models that assume that all the masers a...

  13. X-231B technology demonstration for in situ treatment of contaminated soil: Technology evaluation and screening

    The Portsmouth Gaseous Diffusion Plant (Ports) is located approximately 70 miles south of Columbus in southern Ohio. Among the several waste management units on the facility, the X-231B unit consists of two adjacent oil biodegradation plots. The plots encompass ∼ 0.8 acres and were reportedly used from 1976 to 1983 for the treatment and disposal of waste oils and degreasing solvents, some containing uranium-235 and technetium-99. The X-231B unit is a regulated solid waste management unit (SWMU) under the Resource Conservation and Recovery Act (RCRA). The X-231B unit is also a designated SWMU located within Quadrant I of the site as defined in an ongoing RCRA Facilities Investigation and Corrective Measures Study (RFI/CMS). Before implementing one or more Technology Demonstration Project must be completed. The principal goal of this project was to elect and successfully demonstrate one ore more technologies for effective treatment of the contaminated soils associated with the X-231B unit at PORTS. The project was divided into two major phases. Phase 1 involved a technology evaluation and screening process. The second phase (i.e., Phase 2) was to involve field demonstration, testing and evaluation of the technology(s) selected during Phase 1. This report presents the methods, results, and conclusions of the technology evaluation and screening portion of the project

  14. Removal of 230Th and 231Pa from the open ocean

    Concentrations of 230Th and 231Pa were measured in particulate matter collected by sediment traps deployed in the Sargasso Sea (Site S2), the north equatorial Atlantic (site E), and the north equatorial Pacific (Site P) as well as in particles collected by in situ filtration at Site E. Concentrations of dissolved Th and Pa were determined by extraction onto manganese dioxide adsorbers at Site P and at a second site in the Sargasso Sea (site D). Dissolved 230Th/231Pa activity ratios were 3-6 at Sites P and D. In contrast, for all sediment trap samples from greater than 2000 m, unsupported 230Th/231Pa ratios were 22-35 (average 29.7). Ratios were lower in particulate matter sampled at shallower depths. Particles filtered at 3600 m and 5000 m at Site E had ratios of 50 and 40. Results show that suspended particulate matter in the open ocean preferentially scavenges Th relative to Pa. Most of the 230Th produced by decay of 234U in the open ocean is removed by adsorption to settling particulate matter. In contrast, less than 50% of the 231Pa produced by decay of 235U is removed from the water column by this mechanism. Mixing processes transport the remainder to other sinks. (orig.)

  15. 7 CFR 1280.231 - Patents, copyrights, inventions, product formulations, and publications.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, product formulations... Information Order Miscellaneous § 1280.231 Patents, copyrights, inventions, product formulations, and publications. (a) Any patents, copyrights, inventions or publications developed through the use of...

  16. 48 CFR 752.231-71 - Salary supplements for HG employees.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Salary supplements for HG....231-71 Salary supplements for HG employees. As prescribed in 731.205-71, for use in all contracts with a possible need or services of a HG employee. The clause should also be inserted in all...

  17. Congenital diaphragmatic hernia interval on chromosome 8p23.1 characterized by genetics and protein interaction networks

    Longoni, Mauro; Hansen, Kasper Lage; Russell, Meaghan K.;

    2012-01-01

    Chromosome 8p23.1 is a common hotspot associated with major congenital malformations, including congenital diaphragmatic hernia (CDH) and cardiac defects. We present findings from high‐resolution arrays in patients who carry a loss (n = 18) or a gain (n = 1) of sub‐band 8p23.1. We confirm a regio...

  18. Optical Identifications of Companion Soft X-ray Sources of Mrk 231

    2001-01-01

    We present optical identification results for four ROSAT PSPC soft X-ray companions of Mrk 231 based on the deep BATC 6660 A-band image and the optical spectra obtained by the 60/90cm Schmidt telescope and the 2.16mtelescope at the Xinglong Station, NAOC. Three optical counterparts are quasarswith redshifts z > 1 and the remaining X-ray source is probably a background galaxycluster. Therefore, none of these soft X-ray companions are physically connectedwith the central X-ray source Mrk 231. Incorporating the previous results of Arp 220and Mrk 273 (Xia et al. 1998, 1999), we suggest that the apparent soft X-rayassociations with ULIRGs are chance coincidence in most cases.

  19. Disparate SAR Data of Griseofulvin Analogues for the Dermatophytes Trichophyton mentagrophytes, T. rubrum, and MDA-MB-231 Cancer Cells

    Rønnest, Mads Holger; Raab, Marc S.; Anderhub, Simon;

    2012-01-01

    Griseofulvin and 53 analogues of this compound have been tested against the pathogenic dermatophytes Trichophyton rubrum and Trichophyton mentagrophytes as well as against the breast cancer cell line MDA-MB-231. The modifications to griseofulvin include the 4, 5, 6, 2', 3', and 4' positions. The...... analogues showed increased activity against the cancer cell line MDA-MB-231, highlighted by 2'-benzyloxy-2'-demethoxy-griseofulvin, which showed low activity against both fungi but was among the most potent compounds against MDA-MB-231 cancer cells. Tubulin has been proposed as the target of griseofulvin in...

  20. Relaxin reduces xenograft tumour growth of human MDA-MB-231 breast cancer cells

    Radestock, Yvonne; Hoang-Vu, Cuong; Hombach-Klonisch, Sabine

    2008-01-01

    Introduction Relaxin levels are increased in cases of human breast cancer and has been shown to promote cancer cell migration in carcinoma cells of the breast, prostate gland and thyroid gland. In oestrogen receptor alpha-negative MDA-MB-231 human breast cancer cells, relaxin was shown to down-regulate the metastasis-promoting protein S100A4 (metastasin), a highly significant prognostic factor for poor survival in breast cancer patients. The cellular mechanisms of relaxin exposure in breast c...

  1. Effects of osteopontin inhibition on radiosensitivity of MDA-MB-231 breast cancer cells

    Osteopontin (OPN) is a secreted glycophosphoprotein that is overexpressed in various tumors, and high levels of OPN have been associated with poor prognosis of cancer patients. In patients with head and neck cancer, high OPN plasma levels have been associated with poor prognosis following radiotherapy. Since little is known about the relationship between OPN expression and radiosensitivity, we investigated the cellular and radiation induced effects of OPN siRNA in human MDA-MB-231 breast cancer cells. MDA-MB-231 cells were transfected with OPN-specific siRNAs and irradiated after 24 h. To verify the OPN knockdown, we measured the OPN mRNA and protein levels using qRT-PCR and Western blot analysis. Furthermore, the functional effects of OPN siRNAs were studied by assays to assess clonogenic survival, migration and induction of apoptosis. Treatment of MDA-MB-231 cells with OPN siRNAs resulted in an 80% decrease in the OPN mRNA level and in a decrease in extracellular OPN protein level. Transfection reduced clonogenic survival to 42% (p = 0.008), decreased the migration rate to 60% (p = 0.15) and increased apoptosis from 0.3% to 1.7% (p = 0.04). Combination of OPN siRNA and irradiation at 2 Gy resulted in a further reduction of clonogenic survival to 27% (p < 0.001), decreased the migration rate to 40% (p = 0.03) and increased apoptosis to 4% (p < 0.005). Furthermore, OPN knockdown caused a weak radiosensitization with an enhancement factor of 1.5 at 6 Gy (p = 0.09) and a dose modifying factor (DMF10) of 1.1. Our results suggest that an OPN knockdown improves radiobiological effects in MDA-MB-231 cells. Therefore, OPN seems to be an attractive target to improve the effectiveness of radiotherapy

  2. Some spectroscopic properties of fine structures observed near the 231Pa(n,f) fission threshold

    The 231Pa neutron-induced fission cross section from 140 to 400 keV was resolved into finer structures. For some of the fractionated vibrational resonances in this energy region, the assignment of spectroscopic parameters may support evidence for an asymmetrically deformed third minimum in the 232Pa fission barrier. Also, for the first time, narrow fission resonances are observed above 1.3 eV exhibiting an average fission width /sub obs/ = 8meV

  3. Phenotypic Switch Induced by Simulated Microgravity on MDA-MB-231 Breast Cancer Cells

    Maria Grazia Masiello; Alessandra Cucina; Sara Proietti; Alessandro Palombo; Pierpaolo Coluccia; Fabrizio D’Anselmi; Simona Dinicola; Alessia Pasqualato; Veronica Morini; Mariano Bizzarri

    2014-01-01

    Microgravity exerts dramatic effects on cell morphology and functions, by disrupting cytoskeleton and adhesion structures, as well as by interfering with biochemical pathways and gene expression. Impairment of cells behavior has both practical and theoretical significance, given that investigations of mechanisms involved in microgravity-mediated effects may shed light on how biophysical constraints cooperate in shaping complex living systems. By exposing breast cancer MDA-MB-231 cells to simu...

  4. Alkaloids of Cynanchum vincetoxicum: Efficacy against MDA-MB-231 Mammary Carcinoma Cells

    Tanner, U.; Wiegrebe, Wolfgang

    1993-01-01

    Alkaloids 1-4 from Cynanchum vincetoxicum (asclepiadaceae) (Scheme 1) do not have affinity to the oestrogen receptor but they inhibit the growth of the hormone-independent mammary carcinoma cells MDA-MB-231 (Fig. 1) and bind to nucleosides and nucleotides (Table 1). Intercalation was not observed. Die Alkaloide 1-4 aus Cynanchum vincetoxicum (Asclepiadaceae) (Scheme 1) zeigen keine Affinität zum Oestrogen-Rezeptor, hemmen aber das Wachstum der hormonunabhängigen Mammakar...

  5. Cytotoxicity of Biologically Synthesized Silver Nanoparticles in MDA-MB-231 Human Breast Cancer Cells

    Sangiliyandi Gurunathan; Jae Woong Han; Vasuki Eppakayala; Muniyandi Jeyaraj; Jin-Hoi Kim

    2013-01-01

    Silver nanoparticles (AgNPs) have been used as an antimicrobial and disinfectant agents. However, there is limited information about antitumor potential. Therefore, this study focused on determining cytotoxic effects of AgNPs on MDA-MB-231 breast cancer cells and its mechanism of cell death. Herein, we developed a green method for synthesis of AgNPs using culture supernatant of Bacillus funiculus, and synthesized AgNPs were characterized by various analytical techniques such as UV-visible spe...

  6. Automation of the ERS-231 epr spectrometer on the basis of an IBM PC computer

    Paper describes a computer-aided control system (CCS) of a EPR spectrometer based on dataway-module measuring and computering system incorporating crates for functional modules and IBM PC computer. Paper contains CCS flow-diagram based on EPR for ERS-231 spectrometer. The spectrometer software consists of MS DOS operated text and control programs. Abilities of the updated spectrometer were checked using various specimens and under various temperatures

  7. Irradiation studies of 231Pa in DHRUVA reactor for preparation of 232U

    In this paper, identification of the potential source of 231Pa, various stages of its recovery and the sample of 231Pa supplied for trial irradiation are described. For producing 232U, irradiation work is proposed in different stages of irradiation. Various trial irradiations and its results are discussed in this paper along with their specific objectives. A computational estimation of conversion efficiency of 231Pa (∼ 10μg) to 232U in DHRUVA reactor, was carried out. The computational result predicted the conversion efficiency and the results of γ-spectroscopy based analysis of the second trial sample matched well. A first level calculation was also carried out to estimate the tolerable quantity of 232Th to keep the concentration of 233U below 5% in the 232U sample. The radioactivity due to the presence of various impurities present in the sample, during the high fluence irradiation, is being estimated. The feasibility of production of the 232U isotope in DHRUVA reactor has thus been established. (author)

  8. Extracts from Curcuma zedoaria Inhibit Proliferation of Human Breast Cancer Cell MDA-MB-231 In Vitro

    Xiu-fei Gao; Qing-lin Li; Hai-long Li; Hong-yan Zhang; Jian-ying Su; Bei Wang; Pei Liu; Ai-qin Zhang

    2014-01-01

    Objective. To evaluate the effect of petroleum ether extracts of Curcuma zedoaria on the proliferation of human triple negative breast cancer cell line MDA-MB-231. Methods. The reagents were isolated from Curcuma zedoaria by petroleum ether fraction. It was assayed by CCK8 for MDA-MB-231 cellular viability with various concentrations and days, cell cycle analyses, Western Blot analysis, and Realtime Reverse Transcriptase PCR analyses for chemokines molecules including E-cadherin, and E-select...

  9. BSP gene silencing inhibits migration, invasion, and bone metastasis of MDA-MB-231BO human breast cancer cells.

    Jie Wang

    Full Text Available Bone sialoprotein (BSP has been implicated in a variety of physiological and pathophysiological events, including tumor cell invasion, bone homing, adhesion, and matrix degradation. To explore the potential involvement of BSP in human breast cancer cell invasion and metastasis, we used retrovirus-mediated RNAi to deplete BSP levels in the human bone-seeking breast cancer cell line MDA-MB-231BO (231BO and established the 231BO-BSP27 and 231BO-BSP81 cell clones. Cell proliferation, colony formation, wound healing, and the ability to invade into matrigel of these BSP-depleted clones were all decreased. Both 231BO-BSP27 cells and 231BO-BSP81 cells showed a significant (15.4% and 28.6% respectively reduction of bone metastatic potential following intracardiac injection as determined by X-ray detection and by hematoxylin and eosin staining. Moreover, the expression of integrins αvβ3 and β3 was decreased in the BSP-silenced cells whereas ectopic BSP expression increased the integrins αvβ3 and β3 levels. These results together suggest that BSP silencing decreased the integrin αvβ3 and β3 levels, in turn inhibiting cell migration and invasion and decreasing the ability of the cells to metastasize to bone.

  10. In vitro effects of phenytoin and DAPT on MDA-MB-231 breast cancer cells.

    Aktas, Canan Cakir; Zeybek, N Dilara; Piskin, A Kevser

    2015-09-01

    Voltage-gated sodium channel (VGSC) activity enhances cell behaviors related to metastasis, such as motility, invasion, and oncogene expression. Neonatal alternative splice form of Nav1.5 isoform is expressed in metastatic breast cancers. Furthermore, aberrant Notch signaling pathway can induce oncogenesis and may promote the progression of breast cancers. In this study, we aimed to analyze the effect of the nNav1.5 inhibitor phenytoin and Notch signal inhibitor N-[N-(3,5-difluorophenacetyl)-L-alanyl]-S-phenylglycine-t-butyl ester (DAPT) on triple negative breast cancer cell line (MDA-MB-231) via inhibition of nNav1.5 VGSC activity and Notch signaling, respectively. In order to determine the individual and combined effects of these inhibitors, the 4-[3-(4-iyodophenyl)-2-(4-nitrophenyl)-2H-5-tetrazolio]-1,3-benzene disulfonate (WST-1) test, wound healing assay, and zymography were performed to detect the proliferation, lateral motility, and matrix metalloproteinase-9 (MMP9) activity, respectively. The expressions of nNav1.5, Notch4, MMP9, and tissue inhibitor of metalloproteinases-1 (TIMP1) were also detected by quantitative real-time reverse transcriptase-polymerase chain reaction. DAPT caused an antiproliferative effect when the doses were higher than 10 µM, whereas phenytoin showed no inhibitory action either alone or in combination with DAPT on the MDA-MB-231 cells. Furthermore, it was found that the lateral motility was inhibited by both inhibitors; however, this inhibitory effect was partially rescued when they were used in combination. Meanwhile, the results showed that the MMP9 activity and the ratio of MMP9 mRNA to TIMP1 mRNA were only decreased by DAPT. Thus, we conclude that the combined effect of DAPT and phenytoin is not as beneficial as using DAPT alone on MDA-MB-231 breast cancer cells. PMID:26206582

  11. Uranium age determination: Separation and analysis of 230Th and 231Pa

    In this work we focused on the age determination of uranium materials of different uranium enrichment. The radioactive decay of the uranium isotopes provides a chronometer that is inherent to the material, in particular the mother/daughter pairs 234U/230Th and 235U/231Pa can be advantageously used. Due to the relatively long half-lives of 234U (2.46 · 105 years) and 235U (7.04 · 108 years) only minute amounts of daughter nuclides are growing in, therefore both separation of Th and Pa from uranium must be of high chemical recovery and must afford large decontamination factors. Analytical methods for the age determination of uranium samples using the parent/daughter relations 234U/230Th and 235U/231Pa is demonstrated. Thorium is separated from bulk uranium using extraction chromatography and subsequently quantified using square-spectrometry, thermal ionisation mass spectrometry (TIMS) and inductively coupled mass spectrometry (ICP-MS). Protactinium is separated by highly selective sorption of protactinium to silica gel followed by square-spectrometric quantification. The methods were tested and validated using uranium reference materials of different uranium enrichment and of known ages. The experimental results obtained with both methods were found to agree with the assumed ages of the reference materials within the combined uncertainty of the measurement. The analysis exploiting the parent/daughter pair 235U/231Pa exhibits a slightly larger combined uncertainty and bias than the thorium method but is found valuable in validating the experimental results by means of a second, independent analysis

  12. VizieR Online Data Catalog: 231 AGN candidates from the 2FGL catalog (Doert+, 2014)

    Doert, M.; Errando, M.

    2016-01-01

    The second Fermi-LAT source catalog (2FGL; Nolan et al. 2012, cat. J/ApJS/199/31) is the deepest all-sky survey available in the gamma-ray band. It contains 1873 sources, of which 576 remain unassociated. The Large Area Telescope (LAT) on board the Fermi Gamma-ray Space Telescope started operations in 2008. In this work, machine-learning algorithms are used to identify unassociated sources in the 2FGL catalog with properties similar to gamma-ray-emitting Active Galactic Nuclei (AGN). This analysis finds 231 high-confidence AGN candidates (see Table3). (1 data file).

  13. The rotational bands in the nuclei 229Pa and 231Pa

    Experimental evidence is presented for the similarity between the rotational spectra built on the 1/2-[530] state in 231Pa, where the 3/2- member of the band forms the ground state, and in 229Pa, where this state lies within 20 keV of the ground state. Our findings are in contrast with earlier work invoking octupole deformations in the ground state to account for the different positions of low-lying Nilsson states in the two isotopes. (author)

  14. Installing and Running AIM 2.3.1 in a Clustered Server Production Environment

    High availability and redundancy were required for a 24/7 technical baseline at a nuclear production facility. Process engineering, operations, and maintenance all had to connect to the AIM workflow and data management system at the plant. 24-hour availability and 100 percent data integrity were requirements. AIM 2.3.1 satisfied these needs by running in a clustered environment, using shared RAID 5 data storage installed with Oracle Fail Safe on clustered WinNT 4.0 Servers. Order of installation was critical for successful operation. The system has been running in production for 12 months with minimal downtime, and zero loss of data

  15. Mulige interaksjoner mellom tyrosin kinase reseptoren Axl, metabolisme og proliferasjon i brystkreftceller (MDA-MB-231)

    Bergslien, Ingunn

    2009-01-01

    Metabolismen i kreftceller er assosiert med økt aerob glykolyse, et fenomen omtalt som Warburg effekten. Den forhøyede glykolytiske raten utgjør en av de større forskjellene, som skiller normale celler fra kreftceller, og forståelse av de underliggende mekanismene er viktig for å kunne utvikle målrettet kreftterapi. Brystkreft cellelinjen MDA-MB-231 er karakterisert som aggressiv og invasiv, og viser høye rater av aerob glykolyse, sammenlignet med brystkreft cellelinjer med lavere invasivi...

  16. Action and Signaling of Lysophosphatidylethanolamine in MDA-MB-231 Breast Cancer Cells

    Park, Soo-Jin; Lee, Kyoung-Pil; Im, Dong-Soon

    2014-01-01

    Previously, we reported that lysophosphatidylethanolamine (LPE), a lyso-type metabolite of phosphatidylethanolamine, can increase intracellular Ca2+ ([Ca2+]i) via type 1 lysophosphatidic acid (LPA) receptor (LPA1) and CD97, an adhesion G-protein-coupled receptor (GPCR), in MDA-MB-231 breast cancer cells. Furthermore, LPE signaling was suggested as like LPA1/CD97-Gi/o proteins-phospholipase C-IP3-Ca2+ increase in these cells. In the present study, we further investigated actions of LPE not onl...

  17. ASCA Observation of an X-Ray-Luminous Active Nucleus in Markarian 231

    Maloney, P R; Maloney, Philip R.; Reynolds, Christopher S

    2000-01-01

    We have obtained a moderately long (100 kilosecond) ASCA observation of the Seyfert 1 galaxy Markarian 231, the most luminous of the local ultraluminous infrared galaxy (ULIRG) population. In the best-fitting model we do not see the X-ray source directly; the spectrum consists of a scattered power-law component and a reflection component, both of which have been absorbed by a column N_H \\approx 3 X 10^(22)/cm^2. About 3/4 of the observed hard X-rays arise from the scattered component, reducing the equivalent width of the iron K alpha line. The implied ratio of 1-10 keV X-ray luminosity to bolometric luminosity, L_x/L_bol \\sim 2%, is typical of Sy 1 galaxies and radio-quiet QSOs of comparable bolometric luminosities, and indicates that the bolometric luminosity is dominated by the AGN. Our estimate of the X-ray luminosity also moves Mrk 231 in line with the correlations found for AGN with extremely strong Fe II emission. A second source separated by about 2 arcminutes is also clearly detected, and contributes ...

  18. Molecular Emission in Dense Massive Clumps from the Star-Forming Regions S231-S235

    Ladeyschikov, D A; Tsivilev, A P; Sobolev, A M

    2016-01-01

    The article deals with observations of star-forming regions S231-S235 in 'quasi-thermal' lines of ammonia (NH$_3$), cyanoacetylene (HC$_3$N) and maser lines of methanol (CH$_3$OH) and water vapor (H$_2$O). S231-S235 regions is situated in the giant molecular cloud G174+2.5. We selected all massive molecular clumps in G174+2.5 using archive CO data. For the each clump we determined mass, size and CO column density. After that we performed observations of these clumps. We report about first detections of NH$_3$ and HC$_3$N lines toward the molecular clumps WB89 673 and WB89 668. This means that high-density gas is present there. Physical parameters of molecular gas in the clumps were estimated using the data on ammonia emission. We found that the gas temperature and the hydrogen number density are in the ranges 16-30 K and 2.8-7.2$\\times10^3$ cm$^{-3}$, respectively. The shock-tracing line of CH$_3$OH molecule at 36.2 GHz is newly detected toward WB89 673.

  19. VizieR Online Data Catalog: BV(RI)c photometry of ON 231 (Tosti+ 1998)

    Tosti, G.; Fiorucci, M.; Luciani, M.; Rizzi, N. M. Villata; Raiteri, C. M.; de, G. Francesco; Lanteri, L.; Chiaberge, M.; Peila, A.; Cavallone, M.; Sobrito, G.; Maesano, M.; Massaro, E.; Montagni, F.; Nesci, R.; Ghisellini, G.; Takalo, L. O.; Sillanpaa, A.; Katajainen, S.; Heinamaki, P.; Nilsson, K.; Pursimo, T.

    1997-11-01

    We present the most continuous data base of optical multiband data ever published on the BL Lacertae object ON 231 (W Com). The data have been collected during an intensive and coordinated BV(RI)c monitoring campaign carried out in the period from March 1994 to March 1997. During our campaign, the source brightness was at the highest level ever observed. The light curve shows a complex structure, characterized by the presence of three major outbursts having the observed maxima in March 1995, February 1996, and January 1997, when ON 231 reached its historical maximum (B~=14.2). Variability on time scales from a few hours up to a month have frequently been observed and the light curve seems to be the superposition of many flares with different amplitudes and time scales. The broad-band optical spectral energy distribution is characterized by a spectral slope which correlates with the flux level. In particular, the higher is the flux the flatter is the spectrum. (1 data file).

  20. The geochemical behavior of protactinium 231 and its chosen geochemical analogue thorium in the biosphere

    To be able to judge whether protactinium 231 might represent a major contribution to the human radiation risk from high level radioactive waste a literature study of the geochemical behavior of protactinium has been made. The interest in protactinium determinations has, as far, been in the field of marine geochemistry and geochronology. These investigations show that thorium may be used as a chemical analogue. The content of protactinium 231 is determined by the 235U content and consequently the occurrence of protactinium in nature is directly associated to the geochemistry of uranium. The pronounced hydrolytic tendency of protactinium and its great sorption and coprecipitation capacity ought to prevent or at least appreciably delay its transport from a back-filled nuclear waste vault to the uppermost surface of the earth. It also has a tendency to form colloids or particulates which may be strongly fixed on a rock surface. In adsorption and desorption processes kinetics must play an important role. Our knowledge in this field is quite limited. Under the physico-chemical conditions in the sea, protactinium is rapidly scavenged from the water column by particulates. It accumulates in the sediments. (author)

  1. Another piece of the puzzle: the fast HI outflow in Mrk231

    Morganti, Raffaella; Oosterloo, Tom; Teng, Stacy H; Rupke, David

    2016-01-01

    We present the detection, performed with the Westerbork Synthesis Radio Telescope (WSRT) and the Karl Jansky Very Large Array (VLA), of a fast HI 21-cm outflow in the ultra-luminous infrared galaxy Mrk 231. The outflow is observed as shallow HI absorption blueshifted ~1300 km/s with respect to the systemic velocity and located against the inner kpc of the radio source. The outflowing gas has an estimated column density between 5 and 15x10^18 Tspin cm^-2. We derive the Tspin to lie in the range 400-2000 K and the densities are n_HI~10-100 cm^-3. Our results confirm the multiphase nature of the outflow in Mrk231. Although effects of the interaction between the radio plasma and the surrounding medium cannot be ruled out, the energetics and the lack of a clear kpc-scale jet suggest that the most likely origin of the HI outflow is a wide-angle nuclear wind, as earlier proposed to explain the neutral outflow traced by NaI and molecular gas. Our results suggest that an HI component is present in fast outflows regard...

  2. The Binary Black Hole Model for Mrk 231 Cannot Explain the Observed Emission Lines

    Leighly, Karen M; Gallagher, Sarah C; Lucy, Adrian B

    2016-01-01

    Mrk 231 is a nearby quasar with an unusually red continuum, generally explained as heavy reddening by dust (e.g., Leighly et al. 2014). Yan et al. 2015 proposed that Mrk 231 is a milli-parsec black-hole binary with little intrinsic reddening. The large-mass black hole experiences advection-dominated accretion, emitting little continuum, while the accretion disk of the small-mass black hole emits as an ordinary quasar, dominating the observed weak UV continuum and contributing all of the photoionizing flux. We demonstrate that this model is untenable for four reasons. (1) To produce the observed near-infrared emission lines, the equivalent widths would have to be ~100 times larger than typical values with respect to the photoionizing continuum, a situation that seems energetically unlikely. (2) We use the photoionization code Cloudy to demonstrate it is not possible to produce the HeI* emission line intensity for the observed HeI*/Pbeta flux ratios, even if the line-emitting gas intersects all of the photoioni...

  3. Directional Migration of MDA-MB-231 Cells Under Oxygen Concentration Gradients.

    Yahara, D; Yoshida, T; Enokida, Y; Takahashi, E

    2016-01-01

    To elucidate the initial mechanism of hematogenous metastasis of cancer cells, we hypothesized that cancer cells migrate toward regions with higher oxygen concentration such as intratumor micro vessels along the oxygen concentration gradient. To produce gradients of oxygen concentration in vitro, we devised the gap cover glass (GCG). After placing a GCG onto cultured MDA-MB-231 cells (a metastatic breast cancer cell line), the migration of individual cells under the GCG was tracked up to 12 h at 3 % oxygen in the micro incubator. We quantified the migration of individual cells using forward migration index (FMI). The cell migration perpendicular to the oxygen gradients was random in the direction whereas FMIs of the cell located at 300, 500, 700, and 1500 μm from the oxygen inlet were positive (p < 0.05) indicating a unidirectional migration toward the oxygen inlet. Present results are consistent with our hypothesis that MDA-MB-231 cells migrate toward regions with higher oxygen concentration. PMID:27526134

  4. Testing the 231Pa/230Th paleo-circulation proxy: A data versus 2D model comparison

    Variations of the Atlantic Meridional Overturning Circulation (AMOC) are believed to have crucially influenced Earth's climate due to its key role in the inter-hemispheric redistribution of heat and carbon. To assess its past strength, the sedimentary 231Pa/230Th proxy has been developed and improved but also contested due to its sensitivity to other factors beyond ocean circulation. In order to provide a better basis for the understanding of the Atlantic 231Pa/230Th system, and therefore to shed light on the controversy, we compare new measurements of Holocene sediments from the north Brazilian margin to water column data and the output of a two-dimensional scavenging-circulation model, based on modern circulation patterns and reversible scavenging parameters. We show that sedimentary 231Pa/230Th data from one specific area of the Atlantic are in very good agreement with model results suggesting that sedimentary 231Pa/230Th is predominantly driven by the AMOC. Therefore, 231Pa/230Th represents an appropriate method to reconstruct past AMOC at least qualitatively along the western margin. (authors)

  5. Isolation and characterization of antimicrobial proteins produced by a potential probiotic strain of human Lactobacillus rhamnosus 231 and its effect on selected human pathogens and food spoilage organisms

    Ambalam, P. S.; Prajapati, J. B.; Dave, J. M.; Nair, Baboo M.; Ljungh, Åsa; Vyas, B. R. M.

    2011-01-01

    Objective: To study in vitro properties of potential probiotics and the antimicrobial activity of Lactobacillus rhamnosus 231 isolated from human faeces. Methods and Results: Lact. rhamnosus 231 isolated from human faeces tolerated bile salt (4%), phenol (0.5%), and NaCl (4%) and retained viability at low pH (2.5). The cell-free culture (CFC) fi ltrate and extracellular protein concentrate (EPC) of Lact. rhamnosus 231 contained antimicrobial substances active against Pseudomonas aeruginosa, E...

  6. Polyphenols from Artemisia annua L Inhibit Adhesion and EMT of Highly Metastatic Breast Cancer Cells MDA-MB-231.

    Ko, Young Shin; Lee, Won Sup; Panchanathan, Radha; Joo, Young Nak; Choi, Yung Hyun; Kim, Gon Sup; Jung, Jin-Myung; Ryu, Chung Ho; Shin, Sung Chul; Kim, Hye Jung

    2016-07-01

    Recent evidence suggests that polyphenolic compounds from plants have anti-invasion and anti-metastasis capabilities. The Korean annual weed, Artemisia annua L., has been used as a folk medicine for treatment of various diseases. Here, we isolated and characterized polyphenols from Korean A. annua L (pKAL). We investigated anti-metastatic effects of pKAL on the highly metastatic MDA-MB-231 breast cancer cells especially focusing on cancer cell adhesion to the endothelial cell and epithelial-mesenchymal transition (EMT). Firstly, pKAL inhibited cell viability of MDA-MB-231 cells in a dose-dependent manner, but not that of human umbilical vein endothelial cells (ECs). Polyphenols from Korean A. annua L inhibited the adhesion of MDA-MB-231 cells to ECs through reducing vascular cell adhesion molecule-1 expression of MDA-MB-231 and ECs, but not intracellular adhesion molecule-1 at the concentrations where pKAL did not influence the cell viability of either MDA-MB-231 cells nor EC. Further, pKAL inhibited tumor necrosis factor-activated MDA-MB-231 breast cancer cell invasion through inhibition of matrix metalloproteinase-2 and matrix metalloproteinase-9 and EMT. Moreover, pKAL inhibited phosphorylation of Akt, but not that of protein kinase C. These results suggest that pKAL may serve as a therapeutic agent against cancer metastasis at least in part by inhibiting the cancer cell adhesion to ECs through suppression of vascular cell adhesion molecule-1 and invasion through suppression of EMT. Copyright © 2016 John Wiley & Sons, Ltd. PMID:27151203

  7. In Vitro Cytotoxic Activity of Origanum vulgare L. on HCT-116 and MDA-MB-231 Cell Lines

    Filip Grbović; Stanković, Milan S.; Milena Ćurčić; Nataša Đorđević; Dragana Šeklić; Marina Topuzović; Snežana Marković

    2013-01-01

    In the present investigation, we examined the cytotoxic effect of methanolic extract from Origanum vulgare on HCT-116 and MDA-MB-231 cell line in vitro. In order to determine the cytotoxic effects we used an MTT viability assay. The results showed that cell growth is significantly lower in extract treated cells compared to untreated control. The effect of inhibition of cell growth was higher in the treatment of HCT-116 cell line than in MDA-MB-231. Based on the results it is determined that O...

  8. Mitotic arrest of breast cancer MDA-MB-231 cells by a halogenated thieno[3,2-d]pyrimidine

    Ross, Christina R.; Temburnikar, Kartik W; Wilson, Gerald M.; Seley-Radtke, Katherine L.

    2015-01-01

    Halogenated thieno[3,2-d]pyrimidines exhibit antiproliferative activity against a variety of cancer cell models, such as the mouse lymphocytic leukemia cell line L1210 in which they induce apoptosis independent of cell cycle arrest. Here we assessed these activities on MDA-MB-231 cells, a well-established model of aggressive, metastatic breast cancer. While 2,4-dichloro[3,2-d]pyrimidine was less toxic to MDA-MB-231 cells than previously observed in the L1210 model, flow cytometry analysis sho...

  9. Recovery of protactinium-231 and thorium-230 from cotter concentrate: pilot plant operatins and process development

    Hertz, M.R.; Figgins, P.E.; Deal, W.R.

    1983-02-10

    The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 100/sup 0/C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables.

  10. Recovery of protactinium-231 and thorium-230 from cotter concentrate: pilot plant operatins and process development

    The equipment and methods used to recover and purify 339 g of thorium-230 and 890 mg of protactinium-231 from 22 of the 1251 drums of Cotter Concentrate are described. The process developed was (1) dissolution at 1000C in concentrated nitric acid and dilution to 2 to 3 molar acid, (2) filtration to remove undissolved solids (mostly silica filter aid), (3) extraction of uranium with di-sec-butyl-phenyl phophonate (DSBPP) in carbon tetrachloride, (4) extraction of both thorium and protactinium with tri-n-octylphosphine oxide (TOPO) in carbon tetrachloride followed by selective stripping of the thorium with dilute of sulfuric acid, (5) thorium purification using oxalic acid, (6) stripping protactinium from the TOPO with oxalic acid, and (7) protactinium purification through a sequence of steps. The development of the separation procedures, the design of the pilot plant, and the operating procedures are described in detail. Analytical procedures are given in an appendix. 8 figures, 4 tables

  11. Commissioning of the CCD231 4K×4K detector for PMAS

    Roth, Martin M.; Fechner, Thomas; Wolter, Dieter; Sandin, Christer; Kelz, Andreas; Bauer, Svend M.; Popow, Emil; Monreal-Ibero, Ana; Kehrig, Carolina; Streicher, Ole

    2010-07-01

    The PMAS integral field spectrophotometer, operated at the Calar Alto Observatory 3.5m Telescope, is one of the most demanded instruments of its kind. The optical system was designed for a camera field of view to accommodate a 4K×4K detector with 15μm pixels. However, due to a failure of one of the initially foreseen 2K×4K CCDs in a mosaic configuration, only half of the available field of view could be covered to date. Owing to the high demand from the user community, an upgrade to the full complement of 4K×4K pixels was envisaged, based on the availability of the new e2v CCD231 device. We describe the specification, implementation, test, and commissioning of this new detector for PMAS.

  12. On the magnetic field of OH 231.8+4.2

    Leal-Ferreira, Marcelo L.; Vlemmings, Wouter H. T.; Diamond, Philip J.; Kemball, Athol; Amiri, Nikta; Desmurs, Jean-François

    2012-08-01

    During the transition from an AGB star to a planetary nebula, a large number of low/intermediate initial mass stars loses its spherical symmetry. The process responsible for that change of morphology is, so far, not well understood. The candidates responsible for shaping these objects are (i) a companion to the star (binary/heavy planet) and its tidal forces, (ii) disk interaction and (iii) magnetic fields - or a combination of these. In particular a binary induced magnetic field is a promising option. To study this we observed the polarization of H2O masers in the known binary pre-Planetary Nebula (pPN) OH231.8+4.2. Our results show a magnetic field B || of ~45 mG is present in the H2O maser region of this pPN.

  13. Cell cycle arrest induced by MPPa-PDT in MDA-MB-231 cells

    Liang, Liming; Bi, Wenxiang; Tian, Yuanyuan

    2016-05-01

    Photodynamic therapy (PDT) is a medical treatment using a photosensitizing agent and light source to treat cancers. Pyropheophorbidea methyl ester (MPPa), a derivative of chlorophyll, is a novel potent photosensitizer. To learn more about this photosensitizer, we examined the cell cycle arrest in MDA-MB-231. Cell cycle and apoptosis were measured by flow cytometer. Checkpoints of the cell cycle were measured by western blot. In this study, we found that the expression of Cyclin D1 was obviously decreased, while the expression of Chk2 and P21 was increased after PDT treatment. This study showed that MPPa-PDT affected the checkpoints of the cell cycle and led the cells to apoptosis.

  14. Polyphenols sensitization potentiates susceptibility of MCF-7 and MDA MB-231 cells to Centchroman.

    Neetu Singh

    Full Text Available Polyphenols as "sensitizers" together with cytotoxic drugs as "inducers" cooperate to trigger apoptosis in various cancer cells. Hence, their combination having similar mode of mechanism may be a novel approach to enhance the efficacy of inducers. Additionally, this will also enable to achieve the physiological concentrations facilitating significant increase in the activity at concentrations which the compound can individually provide. Here we propose that polyphenols (Resveratrol (RES and Curcumin (CUR pre-treatment may sensitize MCF-7/MDA MB-231 (Human Breast Cancer Cells, HBCCs to Centchroman (CC, antineoplastic agent. 6 h pre-treated cells with 10 µM RES/CUR and 100 µM RES/30 µM CUR doses, followed by 10 µM CC for 18 h were investigated for Ser-167 ER-phosphorylation, cell cycle arrest, redox homeostasis, stress activated protein kinase (SAPKs: JNK and p38 MAPK pathways and downstream apoptosis effectors. Low dose RES/CUR enhances the CC action through ROS mediated JNK/p38 as well as mitochondrial pathway in MCF-7 cells. However, RES/CUR sensitization enhanced apoptosis in p53 mutant MDA MB-231 cells without/with involvement of ROS mediated JNK/p38 adjunct to Caspase-9. Contrarily, through high dose sensitization in CC treated cells, the parameters remained unaltered as in polyphenols alone. We conclude that differential sensitization of HBCCs with low dose polyphenol augments apoptotic efficacy of CC. This may offer a novel approach to achieve enhanced action of CC with concomitant reduction of side effects enabling improved management of hormone-dependent breast cancer.

  15. The physics and the structure of the quasar-driven outflow in Mrk 231

    Cicone, C.; Feruglio, C.; Maiolino, R.; Fiore, F.; Piconcelli, E.; Menci, N.; Aussel, H.; Sturm, E.

    2012-07-01

    Massive AGN-driven outflows are invoked by AGN-galaxy co-evolutionary models to suppress both star formation and black hole accretion. Massive molecular outflows have been discovered in some AGN hosts. However, the physical properties and structures of these AGN-driven molecular outflows are still poorly constrained. Here we present new IRAM PdBI observations of Mrk 231, the closest quasar known, targeting both the CO(1-0) and CO(2-1) transitions. We detect broad wings in both transitions, which trace a massive molecular outflow moving with velocities of up to 800 km s-1. The wings are spatially resolved at high significance levels (5-11σ), indicating that the molecular outflow extends to the kpc scale. The CO(2-1)/CO(1-0) ratio of the red broad wings is consistent with the ratio observed in the narrow core, while the blue broad wing is less excited than the core. The latter result suggests that quasar-driven outflow models invoking shocks (which would predict higher gas excitation) are inappropriate for describing the bulk of the outflow in Mrk 231. However, we note that within the central 700 pc the CO(2-1)/CO(1-0) ratio of the red wing is slightly, but significantly, higher than in the line core, suggesting that shocks may play a role in the central region. We also find that the average size of the outflow anticorrelates with the critical density of the transition used as a wind tracer. This indicates that, although diffuse and dense clumps coexist in the outflowing gas, dense outflowing clouds have shorter lifetimes and that they evaporate into the diffuse component along the outflow or, more simply, that diffuse clouds are more efficiently accelerated to larger distances by radiation pressure.

  16. 49 CFR 231.8 - Tank cars without side sills and tank cars with short side sills and end platforms.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tank cars without side sills and tank cars with... APPLIANCE STANDARDS § 231.8 Tank cars without side sills and tank cars with short side sills and end platforms. (a) Hand brakes—(1) Number. Same as specified for “Box and other house cars” (see §...

  17. Expression and activity of carbonic anhydrase IX is associated with metabolic dysfunction in MDA-MB-231 breast cancer cells.

    Li, Ying; Wang, H.; Oosterwijk, E.; Tu, C.; Shiverick, K.T.; Silverman, D.N.; Frost, S.C.

    2009-01-01

    The expression of carbonic anhydrase IX (CAIX), a marker for hypoxic tumors, is correlated with poor prognosis in breast cancer patients. We show herein that the MDA-MB-231 cells, a "triple-negative," basal B line, express exclusively CAIX, while a luminal cell line (T47D) expresses carbonic anhydra

  18. X-231B technology demonstration for in situ treatment of contaminated soil: Contaminant characterization and three dimensional spatial modeling

    Fine-textured soils and sediments contaminated by trichloroethylene (TCE) and other chlorinated organics present a serious environmental restoration challenge at US Department of Energy (DOE) sites. DOE and Martin Marietta Energy Systems, Inc. initiated a research and demonstration project at Oak Ridge National Laboratory. The goal of the project was to demonstrate a process for closure and environmental restoration of the X-231B Solid Waste Management Unit at the DOE Portsmouth Gaseous Diffusion Plant. The X-231B Unit was used from 1976 to 1983 as a land disposal site for waste oils and solvents. Silt and clay deposits beneath the unit were contaminated with volatile organic compounds and low levels of radioactive substances. The shallow groundwater was also contaminated, and some contaminants were at levels well above drinking water standards. This document begins with a summary of the subsurface physical and contaminant characteristics obtained from investigative studies conducted at the X-231B Unit prior to January 1992 (Sect. 2). This is then followed by a description of the sample collection and analysis methods used during the baseline sampling conducted in January 1992 (Sect. 3). The results of this sampling event were used to develop spatial models for VOC contaminant distribution within the X-231B Unit

  19. Vascular endothelial growth inhibitor affects the invasion, apoptosis and vascularisation in breast cancer cell line MDA-MB-231

    Gao Yinguang; Ge Zhicheng; Zhang Zhongtao; Bai Zhigang; Ma Xuemei; Wang Yu

    2014-01-01

    Background Breast cancer is one of the most common malignant female diseases worldwide.It is a significant threat to every woman's health.Vascular endothelial growth inhibitor (VEGI) is known to be abundant in endothelial cells.According to previous literature,overexpression of VEGI has been shown to inhibit tumor neovascularisation and progression in cellular and animal models,but there has been limited research on the significance of VEGI in the breast cancer.Methods In our study,cell lines MDA-MB-231 were first constructed in which VEGI mediated by lentivirus over-expressed.The effects of VEGI over-expression on MDA-MB-231 cells were investigated both in vitro and in vivo.The expression of VEGI in the MDA-MB-231 cells after infection of lentivirus was analyzed using real-time PCR and Western blotting.The effect of the biological characteristics of MDA-MB-231 cells was assessed by growth,invasion,adhesion,and migration assay with subcutaneous tumor-bearing nude mice models.Then the growth curves of the subcutaneous tumors were studied.Expressions of VEGI,CD31 and CD34 in the tumors were analyzed by immunohistochemistry and apoptosis was detected by flow cytometry and immunohistochemistry.Results Infection of MDA-MB-231 cells within the lentivirus resulted in approximately a 1 000-fold increase in the expression of VEGI.As can be seen in the invasion,adhesion and migration assay,the over-expression of VEGI can inhibit the ability of MDA-MB-231 cells during migration,adhesion and invasion.The volume of the subcutaneous tumor in the over-expression group was distinctly and significantly less than that of the control groups.Immunohistochemistry analysis of the tumor biopsies cleady showed the expression of VEGI in the over-expression group increased while CD31 and CD34 decreased significantly.In vitro and in vivo,the early apoptosis rate and the apoptosis index were increased within the VEGI over-expression group as compared with the control group.Conclusions Taken

  20. Protactinium-231 as a new fissionable material for nuclear reactors that can produce nuclear fuel with stable neutron-multiplying properties

    Shmelev, Anatoly N.; Kulikov, Gennady G.; Kulikov, Evgeny G.; Apse, Vladimir A. [National Research Nuclear Univ. MEPHI, Moscow (Russian Federation). Moscow Engineering Physics Inst.

    2016-03-15

    Main purpose of the study is justifying doping of protactinium-231 into fuel compositions of advanced nuclear reactors with the ultimate aim to improve their operation safety and economic efficiency. Protactinium-231 could be generated in thorium blankets of hybrid thermonuclear facilities. The following results were obtained: 1. Protactinium-231 has some favorable features for its doping into nuclear fuel; 2. Protactinium containing fuel compositions can be characterized by the higher values of fuel burn-up, the longer values of fuel lifetime and the better proliferation resistance; 3. as protactinium-231 is the stronger neutron absorber than uranium-238, remarkably lower amounts of protactinium-231 may be doped into fuel compositions. The free space could be occupied by materials which are able to improve heat conductivity and refractoriness of fuel. As a consequence, operation safety of nuclear reactors could be upgraded.

  1. Protactinium-231 as a new fissionable material for nuclear reactors that can produce nuclear fuel with stable neutron-multiplying properties

    Main purpose of the study is justifying doping of protactinium-231 into fuel compositions of advanced nuclear reactors with the ultimate aim to improve their operation safety and economic efficiency. Protactinium-231 could be generated in thorium blankets of hybrid thermonuclear facilities. The following results were obtained: 1. Protactinium-231 has some favorable features for its doping into nuclear fuel; 2. Protactinium containing fuel compositions can be characterized by the higher values of fuel burn-up, the longer values of fuel lifetime and the better proliferation resistance; 3. as protactinium-231 is the stronger neutron absorber than uranium-238, remarkably lower amounts of protactinium-231 may be doped into fuel compositions. The free space could be occupied by materials which are able to improve heat conductivity and refractoriness of fuel. As a consequence, operation safety of nuclear reactors could be upgraded.

  2. Nustar Reveals an Intrinsically X-ray Weak Broad Absorption Line Quasar in the Ultraluminous Infrared Galaxy Markarian 231

    Teng, Stacy H.; Brandt. W. N.; Harrison, F. A.; Luo, B.; Alexander, D. M.; Bauer, F. E.; Boggs, S. E.; Christensen, F. E.; Comastri, A.; Craig, W. W.; Fabian, A. C.; Farrah, D.; Fiore, F.; Gandhi, P.; Grefenstette, B. W.; Hailey, C. J.; Hickox, R. C.; Madsen, K. K.; Ptak, A. F.; Rigby, Jane Rebecca; Risaliti, G.; Saz, C.; Stern, D.; Veilleux, S.; Walton, D. J.; Wik, D. R.; Zhang, W. W.

    2014-01-01

    We present high-energy (3-30 keV) NuSTAR observations of the nearest quasar, the ultraluminous infrared galaxy (ULIRG) Markarian 231 (Mrk 231), supplemented with new and simultaneous low-energy (0.5-8 keV) data from Chandra. The source was detected, though at much fainter levels than previously reported, likely due to contamination in the large apertures of previous non-focusing hard X-ray telescopes. The full band (0.5-30 keV) X-ray spectrum suggests the active galactic nucleus (AGN) in Mrk 231 is absorbed by a patchy and Compton-thin N(sub H) approx. 1.2(sup +0.3) sub-0.3) x 10(exp 23) / sq cm) column. The intrinsic X-ray luminosity L(sub 0.5-30 Kev) approx. 1.0 x 10(exp 43) erg /s) is extremely weak relative to the bolometric luminosity where the 2-10 keV to bolometric luminosity ratio is approx. 0.03% compared to the typical values of 2-15%. Additionally, Mrk 231 has a low X-ray-to-optical power law slope alpha(sub 0X) approx. -1.7. It is a local example of a low-ionization broad absorption line (LoBAL) quasar that is intrinsically X-ray weak. The weak ionizing continuum may explain the lack of mid-infrared [O IV], [Ne V], and [Ne VI] fine-structure emission lines which are present in sources with otherwise similar AGN properties. We argue that the intrinsic X-ray weakness may be a result of the super-Eddington accretion occurring in the nucleus of this ULIRG, and may also be naturally related to the powerful wind event seen in Mrk 231, a merger remnant escaping from its dusty cocoon.

  3. Uranium age determination - Separation and analysis of 230Th and 231Pa

    Full text: In recent years several incidents involving illicit trafficking and smuggling of nuclear material, radioactive sources and radioactively contaminated materials have raised growing public concern about criminal acts involving nuclear materials. Consequently, research efforts in nuclear forensic science have been intensified in order to develop and improve methods for the identification of the nature and origin of seized materials. Information obtained from the analysis of unknown nuclear materials is of key importance in order to aide authorities that are in charge of developing fast and appropriate response action. For the identification of nuclear materials various sample characteristics are of relevance, including isotopic composition, the content of chemical impurities, material properties and the date of production. Information on the production date, respectively the 'age' of nuclear materials, will also be of key importance in other fields of nuclear science, i.e. for the verification of a Fissile Materials Cut-Off Treaty (FMCT) in order to distinguish freshly produced materials from 'old' excess weapons materials. The age of nuclear materials may also be of relevance under a strengthened safeguards regime to reveal clandestine production of weapons usable materials, i.e. the separation of plutonium or production of highly enriched uranium (HEU). The age dating of plutonium samples has been described in detail for bulk samples as well as for particles. In this work we focused on the age determination of uranium materials of different uranium enrichment. The radioactive decay of the uranium isotopes provides a chronometer that is inherent to the material, in particular the mother/daughter pairs 234U/230Th and 235U/231Pa can be advantageously used. Due to the relatively long half-lives of 234U (2.46·105 years) and 235U (7.04·108 years) only minute amounts of daughter nuclides are growing in, therefore both separation of Th and Pa from uranium must

  4. Anticancer property of sediment actinomycetes against MCF-7 and MDA-MB-231 cell lines

    Ravikumar S; Fredimoses M; Gnanadesigan M

    2012-01-01

    Objective: To investigate the anticancer property of marine sediment actinomycetes against two different breast cancer cell lines. Methods:In vitro anticancer activity was carried out against breast (MCF-7 and MDA-MB-231) cancer cell lines. Partial sequences of the 16s rRNA gene, phylogenetic tree construction, multiple sequence analysis and secondary structure analysis were also carried out with the actinomycetes isolates. Results: Of the selected five actinomycete isolates, ACT01 and ACT02 showed the IC50 value with (10.13±0.92) and (22.34±5.82)μg/mL concentrations, respectively for MCF-7 cell line at 48 h, but ACT01 showed the minimum (18.54±2.49 μg/mL) level of IC50 value with MDA-MB-231 cell line. Further, the 16s rRNA partial sequences of ACT01, ACT02, ACT03, ACT04 and ACT05 isolates were also deposited in NCBI data bank with the accession numbers of GQ478246, GQ478247, GQ478248, GQ478249 and GQ478250, respectively. The phylogenetic tree analysis showed that, the isolates of ACT02 and ACT03 were represented in group I and III, respectively, but ACT01 and ACT02 were represented in group II. The multiple sequence alignment of the actinomycete isolates showed that, the maximum identical conserved regions were identified with the nucleotide regions of 125 to 221st base pairs, 65 to 119th base pairs and 55, 48 and 31st base pairs. Secondary structure prediction of the 16s rRNA showed that, the maximum free energy was consumed with ACT03 isolate (-45.4 kkal/mol) and the minimum free energy was consumed with ACT04 isolate (-57.6 kkal/mol). Conclusions:The actinomycete isolates of ACT01 and ACT02 (GQ478246 and GQ478247) which are isolated from sediment sample can be further used as anticancer agents against breast cancer cell lines.

  5. Tank 241-TX-104, cores 230 and 231 analytical results for the final report

    This document is the analytical laboratory report for tank 241-TX-104 push mode core segments collected between February 18, 1998 and February 23, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-104 Push Mode Core Sampling and Analysis Plan (TSAP) (McCain, 1997), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al., 1995) and the Safety Screening Data Quality Objective (DQO) (Dukelow, et.al., 1995). The analytical results are included in the data summary table. None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Alpha Activity (AT) exceeded notification limits as stated in the TSAP. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report. Appearance and Sample Handling Attachment 1 is a cross reference to relate the tank farm identification numbers to the 222-S Laboratory LabCore/LIMS sample numbers. The subsamples generated in the laboratory for analyses are identified in these diagrams with their sources shown. Core 230: Three push mode core segments were removed from tank 241-TX-104 riser 9A on February 18, 1998. Segments were received by the 222-S Laboratory on February 19, 1998. Two segments were expected for this core. However, due to poor sample recovery, an additional segment was taken and identified as 2A. Core 231: Four push mode core segments were removed from tank 241-TX-104 riser 13A between February 19, 1998 and February 23, 1998. Segments were received by the 222-S Laboratory on February 24, 1998. Two segments were expected for this core. However, due to poor sample recovery, additional segments were taken and identified as 2A and 2B. The TSAP states the core samples should be transported to the laboratory within three

  6. Half-Megasecond Chandra Spectral Imaging of the Hot Circumgalactic Nebula around Quasar Mrk 231

    Veilleux, S; Rupke, D S N; Maiolino, R; Sturm, E

    2014-01-01

    A deep 400-ksec ACIS-S observation of the nearest quasar known, Mrk 231, is combined with archival 120-ksec data obtained with the same instrument and setup to carry out the first ever spatially resolved spectral analysis of a hot X-ray emitting circumgalactic nebula around a quasar. The 65 x 50 kpc X-ray nebula shares no resemblance with the tidal debris seen at optical wavelengths. One notable exception is the small tidal arc 3.5 kpc south of the nucleus where excess soft X-ray continuum emission and Si XIII 1.8 keV line emission are detected, consistent with star formation and its associated alpha-element enhancement, respectively. An X-ray shadow is also detected at the location of the 15-kpc northern tidal tail. The hard X-ray continuum emission within 6 kpc of the center is consistent with being due entirely to the bright central AGN. The soft X-ray spectrum of the outer (>6 kpc) portion of the nebula is best described as the sum of two thermal components with T~3 and ~8 million K and spatially uniform ...

  7. A probable Milli-Parsec Supermassive Binary Black Hole in the Nearest Quasar Mrk 231

    Yan, Chang-Shuo; Dai, Xinyu; Yu, Qingjuan

    2015-01-01

    Supermassive binary black holes (BBHs) are unavoidable products of galaxy mergers and are expected to exist in the cores of many quasars. Great effort has been made during the past several decades to search for BBHs among quasars; however, observational evidence for BBHs remains elusive and ambiguous, which is difficult to reconcile with theoretical expectations. In this paper, we show that the distinct optical-to-UV spectrum of Mrk 231 can be well interpreted as emission from accretion flows onto a BBH, with a semimajor axis of ~590AU and an orbital period of ~1.2 year. The flat optical and UV continua are mainly emitted from a circumbinary disk and a mini-disk around the secondary black hole (BH), respectively; and the observed sharp drop off and flux deficit at wavelength lambda ~ 4000-2500 Angstrom is due to a gap (or hole) opened by the secondary BH migrating within the circumbinary disk. If confirmed by future observations, this BBH will provide a unique laboratory to study the interplay between BBHs an...

  8. The physics and the structure of the quasar-driven outflow in Mrk 231

    Cicone, C; Maiolino, R; Fiore, F; Piconcelli, E; Menci, N; Aussel, H; Sturm, E

    2012-01-01

    Massive AGN-driven outflows are invoked by AGN-galaxy co-evolutionary models to suppress both star formation and black hole accretion. Massive molecular outflows have recently been revealed in some AGN hosts. However, the physical properties and structure of these AGN-driven molecular outflows are still poorly constrained. Here we present new IRAM PdBI observations of Mrk231, the closest quasar known, targeting both the CO(1-0) and CO(2-1) transitions. We detect broad wings in both transitions, tracing a massive molecular outflow with velocities up to 800 km/s. The wings are spatially resolved at high significance level (5-11 sigma), indicating that the molecular outflow extends on the kpc scale. The CO(2-1)/CO(1-0) ratio of the red broad wings is consistent with the ratio observed in the narrow core, while the blue broad wing is less excited than the core. The latter result suggests that quasar driven outflow models invoking shocks (which would predict higher gas excitation) are not appropriate to describe t...

  9. Radio Continuum Evidence for Outflow and Absorption in the Seyfert 1 Galaxy Markarian 231

    Ulvestad, J S; Carilli, C L

    1999-01-01

    The VLBA and the VLA have been used to image the continuum radio emission from Mrk 231, a Seyfert 1 galaxy and the brightest infrared galaxy in the local universe. The smallest scales reveal a double source less than 2 pc in extent. The components of this central source have minimum brightness temperatures of 10^9 to 10^{10} K, spectral turnovers between 2 and 10 GHz, and appear to define the galaxy nucleus plus the inner regions of a jet. The components may be free-free absorbed or synchtrotron self-absorbed. On larger scales, the images confirm a previously known north-south triple source extending 40 pc and elongated perpendicular to a 350-pc starburst disk. Both lobes show evidence for free-free absorption near 2 GHz, probably due to ionized gas with a density of 1-2 X 10^3 cm^{-3} in the innermost parts of the starburst disk. The absorbing gas may be ionized by the active nucleus or by local regions of enhanced star formation. The elongation of the 40-pc triple differs by 65 deg from that of the 2-pc sou...

  10. Phenotypic switch induced by simulated microgravity on MDA-MB-231 breast cancer cells.

    Masiello, Maria Grazia; Cucina, Alessandra; Proietti, Sara; Palombo, Alessandro; Coluccia, Pierpaolo; D'Anselmi, Fabrizio; Dinicola, Simona; Pasqualato, Alessia; Morini, Veronica; Bizzarri, Mariano

    2014-01-01

    Microgravity exerts dramatic effects on cell morphology and functions, by disrupting cytoskeleton and adhesion structures, as well as by interfering with biochemical pathways and gene expression. Impairment of cells behavior has both practical and theoretical significance, given that investigations of mechanisms involved in microgravity-mediated effects may shed light on how biophysical constraints cooperate in shaping complex living systems. By exposing breast cancer MDA-MB-231 cells to simulated microgravity (~0.001 g), we observed the emergence of two morphological phenotypes, characterized by distinct membrane fractal values, surface area, and roundness. Moreover, the two phenotypes display different aggregation profiles and adherent behavior on the substrate. These morphological differences are mirrored by the concomitant dramatic functional changes in cell processes (proliferation and apoptosis) and signaling pathways (ERK, AKT, and Survivin). Furthermore, cytoskeleton undergoes a dramatic reorganization, eventually leading to a very different configuration between the two populations. These findings could be considered adaptive and reversible features, given that, by culturing microgravity-exposed cells into a normal gravity field, cells are enabled to recover their original phenotype. Overall these data outline the fundamental role gravity plays in shaping form and function in living systems. PMID:25215287

  11. Multispectral lensless digital holographic microscope: imaging MCF-7 and MDA-MB-231 cancer cell cultures

    Ryle, James P.; Molony, Karen M.; McDonnell, Susan; Naughton, Thomas J.; Sheridan, John T.

    2009-08-01

    Digital holography is the process where an object's phase and amplitude information is retrieved from intensity images obtained using a digital camera (e.g. CCD or CMOS sensor). In-line digital holographic techniques offer full use of the recording device's sampling bandwidth, unlike off-axis holography where object information is not modulated onto carrier fringes. Reconstructed images are obscured by the linear superposition of the unwanted, out of focus, twin images. In addition to this, speckle noise degrades overall quality of the reconstructed images. The speckle effect is a phenomenon of laser sources used in digital holographic systems. Minimizing the effects due to speckle noise, removal of the twin image and using the full sampling bandwidth of the capture device aids overall reconstructed image quality. Such improvements applied to digital holography can benefit applications such as holographic microscopy where the reconstructed images are obscured with twin image information. Overcoming such problems allows greater flexibility in current image processing techniques, which can be applied to segmenting biological cells (e.g. MCF-7 and MDA-MB- 231) to determine their overall cell density and viability. This could potentially be used to distinguish between apoptotic and necrotic cells in large scale mammalian cell processes, currently the system of choice, within the biopharmaceutical industry.

  12. PEA3 activates CXCR4 transcription in MDA-MB-231 and MCF7 breast cancer cells

    Shengmei Gu; Li Chen; Qi Hong; Tingting Yan; Zhigang Zhuang; Qiaoqiao wang; Wei Jin; Hua Zhu; Jiong Wu

    2011-01-01

    CXC chemokine receptor 4 (CXCR4) is a cell surface receptor that has been shown to mediate the metastasis of many solid tumors including lung,breast,kidney,and prostate tumors.In this study,we found that overexpression of ets variant gene 4 (PEA3) could elevate CXCR4 mRNA level and CXCR4 promoter activity in human MDA-MB-231 and MCF-7 breast cancer cells.PEA3 promoted CXCR4 expression and breast cancer metastasis.Chromatin immunoprecipitation assay demonstrated that PEA3 could bind to the CXCR4 promoter in the cells transfected with PEA3 expression vector.PEA3 siRNA attenuated CXCR4 promoter activity and the binding of PEA3 to the CXCR4 promoter in MDA-MB-231 and MCF-7 cells.These results indicated that PEA3 could activate CXCR4 promoter transcription and promote breast cancer metastasis.

  13. Comparison of Apoptotic Inducing Effect of Zerumbone and Zerumbone-Loaded Nanostructured Lipid Carrier on Human Mammary Adenocarcinoma MDA-MB-231 Cell Line

    Mahnaz Hosseinpour; Ahmad Bustamam Abdul; Heshu Sulaiman Rahman; Abdullah Rasedee; Swee Keong Yeap; Negin Ahmadi; Hemn Hassan Othman; Max Stanley Chartrand

    2014-01-01

    This study investigated the anticancer effect of zerumbone (ZER) and zerumbone-loaded nanostructured lipid carrier (ZER-NLC) on the human mammary gland adenocarcinoma (MDA-MB-231) cell line. The effect of ZER and ZER-NLC on MDA-MB-231 cells was determined via electron and fluorescent microscopy and flow cytometry using the Annexin V, cell cycle, and Tdt-mediated dUTP nick-end labeling assays. We demonstrated that ZER and ZER-NLC significantly suppressed the proliferation of MDA-MB-231 cells w...

  14. Regulation of MDA-MB-231 cell proliferation by GSK-3β involves epigenetic modifications under high glucose conditions

    Hyperglycemia is a critical risk factor for development and progression of breast cancer. We have recently reported that high glucose induces phosphorylation of histone H3 at Ser 10 as well as de-phosphorylation of GSK-3β at Ser 9 in MDA-MB-231 cells. Here, we elucidate the mechanism underlying hyperglycemia-induced proliferation in MDA-MB-231 breast cancer cells. We provide evidence that hyperglycemia led to increased DNA methylation and DNMT1 expression in MDA-MB-231 cells. High glucose condition led to significant increase in the expression of PCNA, cyclin D1 and decrease in the expression of PTPN 12, p21 and PTEN. It also induced hypermethylation of DNA at the promoter region of PTPN 12, whereas hypomethylation at Vimentin and Snail. Silencing of GSK-3β by siRNA prevented histone H3 phosphorylation and reduced DNMT1 expression. We show that chromatin obtained after immunoprecipitation with phospho-histone H3 was hypermethylated under high glucose condition, which indicates a cross-talk between DNA methylation and histone H3 phosphorylation. ChIP-qPCR analysis revealed up-regulation of DNMT1 and metastatic genes viz. Vimentin, Snail and MMP-7 by phospho-histone H3, which were down-regulated upon GSK-3β silencing. To the best of our knowledge, this is the first report which shows that interplay between GSK-3β activation, histone H3 phosphorylation and DNA methylation directs proliferation of breast cancer cells. - Highlights: • High glucose induces phosphorylation of histone H3 and dephosphorylation of GSK-3β. • Moreover, hyperglycemia also leads to increased DNA methylation in MDA-MB-231 cells. • Inhibition of GSK-3β prevented histone H3 phosphorylation and reduced DNMT1 levels. • Interplay exists between GSK-3β, histone H3 phosphorylation and DNA methylation

  15. Disparate SAR Data of Griseofulvin Analogues for the Dermatophytes Trichophyton mentagrophytes, T. rubrum, and MDA-MB-231 Cancer Cells

    Rønnest, Mads Holger; Raab, Marc S.; Anderhub, Simon; Boesen, Sven; Krämer, Alwin; Larsen, Thomas Ostenfeld; Clausen, Mads Hartvig

    2012-01-01

    Griseofulvin and 53 analogues of this compound have been tested against the pathogenic dermatophytes Trichophyton rubrum and Trichophyton mentagrophytes as well as against the breast cancer cell line MDA-MB-231. The modifications to griseofulvin include the 4, 5, 6, 2', 3', and 4' positions. The SAR of the griseofulvin analogues toward the two fungi followed the same trend with the majority being less active than griseofulvin and none had more than twice the potency of the parent compound. A ...

  16. Medium Renewal Blocks Anti-Proliferative Effects of Metformin in Cultured MDA-MB-231 Breast Cancer Cells

    Maruša Rajh; Klemen Dolinar; Katarina Miš; Mojca Pavlin; Sergej Pirkmajer

    2016-01-01

    Epidemiological studies indicate that metformin, a widely used type 2 diabetes drug, might reduce breast cancer risk and mortality in patients with type 2 diabetes. Metformin might protect against breast cancer indirectly by ameliorating systemic glucose homeostasis. Alternatively, it might target breast cancer cells directly. However, experiments using MDA-MB-231 cells, a standard in vitro breast cancer model, produced inconsistent results regarding effectiveness of metformin as a direct ant...

  17. Study of (n,p) and (n,α) cross-sections for 232Th, 231Pa, 233U isotopes

    The study of neutron induced reaction cross-sections in the charged particle emission in this energy region will help us to understand the energy dependence of activation cross-sections in detail, thereby providing a complete database that will lead to better understanding of mechanisms of the nuclear reactions. The present study describes nuclear model calculations of (n,p) and (n,α) reaction cross-sections for 232Th, 231Pa and 233U isotopes

  18. Novel Suppressive Effects of Ketotifen on Migration and Invasion of MDA-MB-231 and HT-1080 Cancer Cells

    Kim, Hyun Ji; Park, Mi Kyung; Kim, Soo Youl; Lee, Chang Hoon

    2014-01-01

    The high mortality rates associated with cancer reflect the metastatic spread of tumor cells from the site of their origin. Metastasis, in fact, is the cause of 90% of cancer deaths. Therefore, considerable effort is being made to inhibit metastasis. In the present study, we screened ketotifen for anti-migratory and anti-invasive activities against MDA-MB-231 breast cancer and HT-1080 fibrosarcoma cancer cells. Cancer cell migration and invasion were measured using multi-well chambers. Additi...

  19. Curcumin Suppresses Proliferation and Migration of MDA-MB-231 Breast Cancer Cells through Autophagy-Dependent Akt Degradation

    Feng Guan; Youming Ding; Yemin Zhang; Yu Zhou; Mingxin Li; Changhua Wang

    2016-01-01

    Previous studies have evidenced that the anticancer potential of curcumin (diferuloylmethane), a main yellow bioactive compound from plant turmeric was mediated by interfering with PI3K/Akt signaling. However, the underlying molecular mechanism is still poorly understood. This study experimentally revealed that curcumin treatment reduced Akt protein expression in a dose- and time-dependent manner in MDA-MB-231 breast cancer cells, along with an activation of autophagy and suppression of ubiqu...

  20. Regulation of MDA-MB-231 cell proliferation by GSK-3β involves epigenetic modifications under high glucose conditions

    Gupta, Chanchal; Kaur, Jasmine; Tikoo, Kulbhushan, E-mail: tikoo.k@gmail.com

    2014-05-15

    Hyperglycemia is a critical risk factor for development and progression of breast cancer. We have recently reported that high glucose induces phosphorylation of histone H3 at Ser 10 as well as de-phosphorylation of GSK-3β at Ser 9 in MDA-MB-231 cells. Here, we elucidate the mechanism underlying hyperglycemia-induced proliferation in MDA-MB-231 breast cancer cells. We provide evidence that hyperglycemia led to increased DNA methylation and DNMT1 expression in MDA-MB-231 cells. High glucose condition led to significant increase in the expression of PCNA, cyclin D1 and decrease in the expression of PTPN 12, p21 and PTEN. It also induced hypermethylation of DNA at the promoter region of PTPN 12, whereas hypomethylation at Vimentin and Snail. Silencing of GSK-3β by siRNA prevented histone H3 phosphorylation and reduced DNMT1 expression. We show that chromatin obtained after immunoprecipitation with phospho-histone H3 was hypermethylated under high glucose condition, which indicates a cross-talk between DNA methylation and histone H3 phosphorylation. ChIP-qPCR analysis revealed up-regulation of DNMT1 and metastatic genes viz. Vimentin, Snail and MMP-7 by phospho-histone H3, which were down-regulated upon GSK-3β silencing. To the best of our knowledge, this is the first report which shows that interplay between GSK-3β activation, histone H3 phosphorylation and DNA methylation directs proliferation of breast cancer cells. - Highlights: • High glucose induces phosphorylation of histone H3 and dephosphorylation of GSK-3β. • Moreover, hyperglycemia also leads to increased DNA methylation in MDA-MB-231 cells. • Inhibition of GSK-3β prevented histone H3 phosphorylation and reduced DNMT1 levels. • Interplay exists between GSK-3β, histone H3 phosphorylation and DNA methylation.

  1. Analysis of Protein–Protein Interactions in MCF-7 and MDA-MB-231 Cell Lines Using Phthalic Acid Chemical

    Shih-Shin Liang; Tsu-Nai Wang; Eing-Mei Tsai

    2014-01-01

    Phthalates are a class of plasticizers that have been characterized as endocrine disrupters, and are associated with genital diseases, cardiotoxicity, hepatotoxicity, and nephrotoxicity in the GeneOntology gene/protein database. In this study, we synthesized phthalic acid chemical probes and demonstrated differing protein–protein interactions between MCF-7 cells and MDA-MB-231 breast cancer cell lines. Phthalic acid chemical probes were synthesized using silicon dioxide particle carriers, whi...

  2. On carbon and oxygen isotope ratios in starburst galaxies: New data from NGC253 and Mrk231 and their implications

    Henkel, C; Ao, Y; Aalto, S; Danielson, A L R; Papadopoulos, P P; Garcia-Burillo, S; Aladro, R; Impellizzeri, C M V; Mauersberger, R; Martin, S; Harada, N

    2014-01-01

    Using the IRAM 30-m telescope, CN and CO isotopologues have been measured toward the central regions of the nearby starburst galaxy NGC253 and the prototypical ultraluminous infrared galaxy Mrk231. In NGC253, the 12C/13C ratio is 40+-10. Assuming that the ratio also holds for the CO emitting gas, this yields 16O/18O = 145+-36 and 16O/17O = 1290+-365 and a 32S/34S ratio close to that measured for the local interstellar medium (20-25). No indication for vibrationally excited CN is found. Peak line intensity ratios between NGC253 and Mrk231 are ~100 for 12C16O and 12C18O J=1-0, while the ratio for 13C16O J=1-0 is ~250. This and similar 13CO and C18O line intensities in the J=1-0 and 2-1 transitions of Mrk231 suggest 12C/13C ~ 100 and 16O/18O ~ 100, in agreement with values obtained for the less evolved ultraluminous merger Arp220. Also accounting for other extragalactic data, 12C/13C ratios appear to vary over a full order of magnitude, from >100 in ultraluminous high redshift galaxies to ~100 in more local such...

  3. Deleterious effects on MDAMB-231 breast adenocarcinoma cell lineage submitted to Ho-166 radioactive seeds at very low activity

    Herein, the deleterious effect of ionizing radiation provided by Ho-166 radioactive seeds at low activity were addressed, based on experimental in vitro assays at the MDA MB231 cell lineage, a breast adenocarcinoma, compared to PBMC - peripheral blood cells. The methodology involves of the MDBMB-231 and PBMC expansion in culture in suitable environment in 30mm well plates and T-25 flasks. Seeds were synthesized with Ho-165 incorporated and characterized previously. Activation was processed at IPR1 reactor at the peripheral table, at 8h exposition. Three groups of seeds were tested: 0,34 mCi, 0,12 mCi activity, and control group. Such seeds were placed on culture and held to a period of 05 half-lives of the radionuclide. The biological responses at these exposure were documented by inverse microscopic photographic in time. Also, MTT essay were performed. A fast response in producing deleterious effects at cancer cell was observed even if for the low activity seeds. Also, a biological response dependent to a radial distance of the seed was observed. At conclusion, viability clonogenic control of MDAMB231 is identified at the exposition to Ho-166 ceramic seeds, even if at low activity of 0,1 to 0,3mCi. (author)

  4. Analysis of Protein–Protein Interactions in MCF-7 and MDA-MB-231 Cell Lines Using Phthalic Acid Chemical

    Shih-Shin Liang

    2014-11-01

    Full Text Available Phthalates are a class of plasticizers that have been characterized as endocrine disrupters, and are associated with genital diseases, cardiotoxicity, hepatotoxicity, and nephrotoxicity in the GeneOntology gene/protein database. In this study, we synthesized phthalic acid chemical probes and demonstrated differing protein–protein interactions between MCF-7 cells and MDA-MB-231 breast cancer cell lines. Phthalic acid chemical probes were synthesized using silicon dioxide particle carriers, which were modified using the silanized linker 3-aminopropyl triethoxyslane (APTES. Incubation with cell lysates from breast cancer cell lines revealed interactions between phthalic acid and cellular proteins in MCF-7 and MDA-MB-231 cells. Subsequent proteomics analyses indicated 22 phthalic acid-binding proteins in both cell types, including heat shock cognate 71-kDa protein, ATP synthase subunit beta, and heat shock protein HSP 90-beta. In addition, 21 MCF-7-specific and 32 MDA-MB-231 specific phthalic acid-binding proteins were identified, including related proteasome proteins, heat shock 70-kDa protein, and NADPH dehydrogenase and ribosomal correlated proteins, ras-related proteins, and members of the heat shock protein family, respectively.

  5. Technology demonstration assessment report for X-231B (Part 1) and summary of closure activities (Part 2)

    This Technology Demonstration Assessment Report (TDAR) was developed to evaluate and recommend the most feasible approach for cleanup of contaminated Minford soil in the vadose zone and to summarize closure activities at the Portsmouth Gaseous Diffusion Plant (PORTS) X-231B Oil Biodegradation Plot (X-231B). The X-23 IB site, consisting of a north and south area, is oriented on a north-south axis. The north and south areas measure 265 ft by I 10 ft and 100 ft by 70 ft, respectively. The X-231B Technology Demonstration (TD) Project was initiated during fall 1990 to identify and evaluate emerging technologies which could provide cost effective and feasible in situ soil treatment. The four technologies plus the Contingent Design evaluated were: In situ Soil Mixing with Solidification/Stabilization; In situ Soil Mixing with Isothermal Vapor Extraction; In situ Soil Mixing with Thermally Enhanced Vapor Extraction; In situ Soil Mixing with Peroxidation Destruction; Center-line Trench Drain - Contingent Design

  6. Deleterious effects on MDAMB-231 breast adenocarcinoma cell lineage submitted to Ho-166 radioactive seeds at very low activity

    Falcao, Patricia L.; Campos, Tarcisio P.R., E-mail: campos@nuclear.ufmg.br [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear; Sarmento, Eduardo V. [Centro de Desenvolvimento de Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil); Cuperschmid, Ethel M. [Universidade Federal de Minas Gerais (CEMEMOR/UFMG), Belo Horizonte, BR (Brazil). Fac. de Medicina. Centro de Memoria da Medicina

    2011-07-01

    Herein, the deleterious effect of ionizing radiation provided by Ho-166 radioactive seeds at low activity were addressed, based on experimental in vitro assays at the MDA MB231 cell lineage, a breast adenocarcinoma, compared to PBMC - peripheral blood cells. The methodology involves of the MDBMB-231 and PBMC expansion in culture in suitable environment in 30mm well plates and T-25 flasks. Seeds were synthesized with Ho-165 incorporated and characterized previously. Activation was processed at IPR1 reactor at the peripheral table, at 8h exposition. Three groups of seeds were tested: 0,34 mCi, 0,12 mCi activity, and control group. Such seeds were placed on culture and held to a period of 05 half-lives of the radionuclide. The biological responses at these exposure were documented by inverse microscopic photographic in time. Also, MTT essay were performed. A fast response in producing deleterious effects at cancer cell was observed even if for the low activity seeds. Also, a biological response dependent to a radial distance of the seed was observed. At conclusion, viability clonogenic control of MDAMB231 is identified at the exposition to Ho-166 ceramic seeds, even if at low activity of 0,1 to 0,3mCi. (author)

  7. Antitumor Activity of Chinese Propolis in Human Breast Cancer MCF-7 and MDA-MB-231 Cells

    Hongzhuan Xuan

    2014-01-01

    Full Text Available Chinese propolis has been reported to possess various biological activities such as antitumor. In present study, anticancer activity of ethanol extract of Chinese propolis (EECP at 25, 50, 100, and 200 μg/mL was explored by testing the cytotoxicity in MCF-7 (human breast cancer ER(+ and MDA-MB-231 (human breast cancer ER(− cells. EECP revealed a dose- and time-dependent cytotoxic effect. Furthermore, annexin A7 (ANXA7, p53, nuclear factor-κB p65 (NF-κB p65, reactive oxygen species (ROS levels, and mitochondrial membrane potential were investigated. Our data indicated that treatment of EECP for 24 and 48 h induced both cells apoptosis obviously. Exposure to EECP significantly increased ANXA7 expression and ROS level, and NF-κB p65 level and mitochondrial membrane potential were depressed by EECP dramatically. The effects of EECP on p53 level were different in MCF-7 and MDA-MB-231 cells, which indicated that EECP exerted its antitumor effects in MCF-7 and MDA-MB-231 cells by inducing apoptosis, regulating the levels of ANXA7, p53, and NF-κB p65, upregulating intracellular ROS, and decreasing mitochondrial membrane potential. Interestingly, EECP had little or small cytotoxicity on normal human umbilical vein endothelial cells (HUVECs. These results suggest that EECP is a potential alternative agent on breast cancer treatment.

  8. Unusual roles of caspase-8 in triple-negative breast cancer cell line MDA-MB-231.

    De Blasio, Anna; Di Fiore, Riccardo; Morreale, Marco; Carlisi, Daniela; Drago-Ferrante, Rosa; Montalbano, Mauro; Scerri, Christian; Tesoriere, Giovanni; Vento, Renza

    2016-06-01

    Triple-negative breast cancer (TNBC) is a clinically aggressive form of breast cancer that is unresponsive to endocrine agents or trastuzumab. TNBC accounts for ~10-20% of all breast cancer cases and represents the form with the poorest prognosis. Patients with TNBC are at higher risk of early recurrence, mainly in the lungs, brain and soft tissue, therefore, there is an urgent need for new therapies. The present study was carried out in MDA-MB-231 cells, where we assessed the role of caspase-8 (casp-8), a critical effector of death receptors, also involved in non‑apoptotic functions. Analysis of casp-8 mRNA and protein levels indicated that they were up-regulated with respect to the normal human mammalian epithelial cells. We demonstrated that silencing of casp-8 by small interfering-RNA, strongly decreased MDA-MB-231 cell growth by delaying G0/G1- to S-phase transition and increasing p21, p27 and hypo-phosphorylated/active form of pRb levels. Surprisingly, casp-8-knockdown, also potently increased both the migratory and metastatic capacity of MDA-MB‑231 cells, as shown by both wound healing and Matrigel assay, and by the expression of a number of related-genes and/or proteins such as VEGFA, C-MYC, CTNNB1, HMGA2, CXCR4, KLF4, VERSICAN V1 and MMP2. Among these, KLF4, a transcriptional factor with a dual role (activator and repressor), seemed to play critical roles. We suggest that in MDA-MB‑231 cells, the endogenous expression of casp-8 might keep the cells perpetually cycling through downregulation of KLF4, the subsequent lowering of p21 and p27, and the inactivation by hyperphosphorylation of pRb. Simultaneously, by lowering the expression of some migratory and invasive genes, casp-8 might restrain the metastatic ability of the cells. Overall, our findings showed that, in MDA-MB-231 cells, casp-8 might play some unusual roles which should be better explored, in order to understand whether it might be identified as a molecular therapeutic target. PMID

  9. Medium Renewal Blocks Anti-Proliferative Effects of Metformin in Cultured MDA-MB-231 Breast Cancer Cells.

    Maruša Rajh

    Full Text Available Epidemiological studies indicate that metformin, a widely used type 2 diabetes drug, might reduce breast cancer risk and mortality in patients with type 2 diabetes. Metformin might protect against breast cancer indirectly by ameliorating systemic glucose homeostasis. Alternatively, it might target breast cancer cells directly. However, experiments using MDA-MB-231 cells, a standard in vitro breast cancer model, produced inconsistent results regarding effectiveness of metformin as a direct anti-cancer agent. Metformin treatments in cultured MDA-MB-231 cells are usually performed for 48-96 hours, but protocols describing renewal of cell culture medium during these prolonged treatments are rarely reported. We determined whether medium renewal protocol might alter sensitivity of MDA-MB-231 cells treated with metformin. Using the MTS assay, BrdU incorporation and Hoechst staining we found that treatment with metformin for 48-72 hours failed to suppress viability and proliferation of MDA-MB-231 cells if low-glucose (1 g/L medium was renewed every 24 hours. Conversely, metformin suppressed their viability and proliferation if medium was not renewed. Without renewal glucose concentration in the medium was reduced to 0.1 g/L in 72 hours, which likely explains increased sensitivity to metformin under these conditions. We also examined whether 2-deoxy-D-glucose (2-DG reduces resistance to metformin. In the presence of 2-DG metformin reduced viability and proliferation of MDA-MB-231 cells with or without medium renewal, thus demonstrating that 2-DG reduces their resistance to metformin. In sum, we show that medium renewal blocks anti-proliferative effects of metformin during prolonged treatments in low-glucose medium. Differences in medium renewal protocols during prolonged treatments might therefore lead to apparently inconsistent results as regards effectiveness of metformin as a direct anti-cancer agent. Finally, our results indicate that co-therapy with

  10. Medium Renewal Blocks Anti-Proliferative Effects of Metformin in Cultured MDA-MB-231 Breast Cancer Cells.

    Rajh, Maruša; Dolinar, Klemen; Miš, Katarina; Pavlin, Mojca; Pirkmajer, Sergej

    2016-01-01

    Epidemiological studies indicate that metformin, a widely used type 2 diabetes drug, might reduce breast cancer risk and mortality in patients with type 2 diabetes. Metformin might protect against breast cancer indirectly by ameliorating systemic glucose homeostasis. Alternatively, it might target breast cancer cells directly. However, experiments using MDA-MB-231 cells, a standard in vitro breast cancer model, produced inconsistent results regarding effectiveness of metformin as a direct anti-cancer agent. Metformin treatments in cultured MDA-MB-231 cells are usually performed for 48-96 hours, but protocols describing renewal of cell culture medium during these prolonged treatments are rarely reported. We determined whether medium renewal protocol might alter sensitivity of MDA-MB-231 cells treated with metformin. Using the MTS assay, BrdU incorporation and Hoechst staining we found that treatment with metformin for 48-72 hours failed to suppress viability and proliferation of MDA-MB-231 cells if low-glucose (1 g/L) medium was renewed every 24 hours. Conversely, metformin suppressed their viability and proliferation if medium was not renewed. Without renewal glucose concentration in the medium was reduced to 0.1 g/L in 72 hours, which likely explains increased sensitivity to metformin under these conditions. We also examined whether 2-deoxy-D-glucose (2-DG) reduces resistance to metformin. In the presence of 2-DG metformin reduced viability and proliferation of MDA-MB-231 cells with or without medium renewal, thus demonstrating that 2-DG reduces their resistance to metformin. In sum, we show that medium renewal blocks anti-proliferative effects of metformin during prolonged treatments in low-glucose medium. Differences in medium renewal protocols during prolonged treatments might therefore lead to apparently inconsistent results as regards effectiveness of metformin as a direct anti-cancer agent. Finally, our results indicate that co-therapy with 2-DG and

  11. Herbal Extract SH003 Suppresses Tumor Growth and Metastasis of MDA-MB-231 Breast Cancer Cells by Inhibiting STAT3-IL-6 Signaling

    Youn Kyung Choi; Sung-Gook Cho; Sang-Mi Woo; Yee Jin Yun; Sunju Park; Yong Cheol Shin; Seong-Gyu Ko

    2014-01-01

    Cancer inflammation promotes cancer progression, resulting in a high risk of cancer. Here, we demonstrate that our new herbal extract, SH003, suppresses both tumor growth and metastasis of MDA-MB-231 breast cancer cells via inhibiting STAT3-IL-6 signaling path. Our new herbal formula, SH003, mixed extract from Astragalus membranaceus, Angelica gigas, and Trichosanthes kirilowii Maximowicz, suppressed MDA-MB-231 tumor growth and lung metastasis in vivo and reduced the viability and metastatic ...

  12. Chamaejasmine Arrests Cell Cycle, Induces Apoptosis and Inhibits Nuclear NF-κB Translocation in the Human Breast Cancer Cell Line MDA-MB-231

    Yuxian Bai; Guanglu Dong; Li Cai; Hongyang Yu; Tingting Zhang

    2013-01-01

    In this study, the anticancer activity of chamaejasmine was characterized in the human breast cancer cell line, MDA-MB-231. Cell viability and cell cycle distribution were determined by MTT assay and flow cytometry, respectively. Western blotting was performed to determine changes in levels of various proteins. Results showed that treatment with chamaejasmine (4–16 μM) inhibited cell proliferation, which correlated with G2/M phase arrest and apoptosis in MDA-MB-231 cells. C...

  13. Gene expression profiling and pathway analysis data in MCF-7 and MDA-MB-231 human breast cancer cell lines treated with dioscin.

    Aumsuwan, Pranapda; Khan, Shabana I; Khan, Ikhlas A; Walker, Larry A; Dasmahapatra, Asok K

    2016-09-01

    Microarray technology (Human OneArray microarray, phylanxbiotech.com) was used to compare gene expression profiles of non-invasive MCF-7 and invasive MDA-MB-231 breast cancer cells exposed to dioscin (DS), a steroidal saponin isolated from the roots of wild yam, (Dioscorea villosa). Initially the differential expression of genes (DEG) was identified which was followed by pathway enrichment analysis (PEA). Of the genes queried on OneArray, we identified 4641 DEG changed between MCF-7 and MDA-MB-231 cells (vehicle-treated) with cut-off log2 |fold change|≧1. Among these genes, 2439 genes were upregulated and 2002 were downregulated. DS exposure (2.30 μM, 72 h) to these cells identified 801 (MCF-7) and 96 (MDA-MB-231) DEG that showed significant difference when compared with the untreated cells (pMDA-MB-231 cells. Further comparison of DEG between MCF-7 and MDA-MB-231 cells exposed to DS identified 3626 DEG of which 1700 were upregulated and 1926 were down-regulated. Regarding to PEA, 12 canonical pathways were significantly altered between these two cell lines. However, there was no alteration in any of these pathways in MCF-7 cells, while in MDA-MB-231 cells only MAPK pathway showed significant alteration. When PEA comparison was made on DS exposed cells, it was observed that only 2 pathways were significantly affected. Further, we identified the shared DEG, which were targeted by DS and overlapped in both MCF-7 and MDA-MB-231 cells, by intersection analysis (Venn diagram). We found that 7 DEG were overlapped of which six are reported in the database. This data highlight the diverse gene networks and pathways in MCF-7 and MDA-MB-231 human breast cancer cell lines treated with dioscin. PMID:27331101

  14. Sediment 231Pa/230Th as a recorder of the rate of the Atlantic meridional overturning circulation: insights from a 2-D model

    S. E. Allen

    2010-03-01

    Full Text Available A two dimensional scavenging model is used to investigate the patterns of sediment 231Pa/230Th generated by the Atlantic Meridional Overturning Circulation (AMOC and further advance the application of this proxy for ocean paleocirculation studies. The scavenging parameters and the geometry of the overturning circulation cell have been chosen so that the model generates meridional sections of dissolved 230Th and 231Pa consistent with published water column profiles and an additional 12 previously unpublished profiles measured in the North and Equatorial Atlantic. The processes that generate the meridional sections of dissolved and particulate 230Th, dissolved and particulate 231Pa, dissolved and particulate 231Pa/230Th, and sediment 231Pa/230Th are discussed in detail. The results indicate that the relationship between sediment 231Pa/230Th at any given site and the overturning circulation is very complex. They clearly show that constraining past changes in the strength and geometry of the AMOC requires an extensive data set and they suggest strategies to maximize information from a limited number of samples.

  15. Sediment 231Pa/230Th as a recorder of the rate of the Atlantic meridional overturning circulation: insights from a 2-D model

    S. E. Allen

    2009-11-01

    Full Text Available A two dimensional scavenging-circulation model is used to investigate the patterns of sediment 231Pa/230Th generated by the Atlantic Meridional Overturning Circulation (AMOC and further advance the application of this proxy for ocean paleocirculation studies. The scavenging parameters and the geometry of the overturning circulation cell have been chosen so that the model generates meridional sections of dissolved 230Th and 231Pa consistent with published water column profiles and an additional 12 previously unpublished profiles measured in the North and Equatorial Atlantic. The processes that generate the meridional sections of dissolved and particulate 230Th, dissolved and particulate 231Pa, dissolved and particulate 231Pa/230Th, and sediment 231Pa/230Th are discussed in detail. The results indicate that the relationship between sediment 231Pa/230Th at any given site and the overturning circulation is very complex. They clearly show that constraining past changes in the strength and geometry of the AMOC requires an extensive data set and they suggest strategies to maximize information from a limited number of samples.

  16. Context dependent reversion of tumor phenotype by connexin-43 expression in MDA-MB231 cells and MCF-7 cells: Role of β-catenin/connexin43 association

    Connexins (Cx), gap junction (GJ) proteins, are regarded as tumor suppressors, and Cx43 expression is often down regulated in breast tumors. We assessed the effect of Cx43 over-expression in 2D and 3D cultures of two breast adenocarcinoma cell lines: MCF-7 and MDA-MB-231. While Cx43 over-expression decreased proliferation of 2D and 3D cultures of MCF-7 by 56% and 80% respectively, MDA-MB-231 growth was not altered in 2D cultures, but exhibited 35% reduction in 3D cultures. C-terminus truncated Cx43 did not alter proliferation. Untransfected MCF-7 cells formed spherical aggregates in 3D cultures, and MDA-MB-231 cells formed stellar aggregates. However, MCF-7 cells over-expressing Cx43 formed smaller sized clusters and Cx43 expressing MDA-MB-231 cells lost their stellar morphology. Extravasation ability of both MCF-7 and MDA-MB-231 cells was reduced by 60% and 30% respectively. On the other hand, silencing Cx43 in MCF10A cells, nonneoplastic human mammary cell line, increased proliferation in both 2D and 3D cultures, and disrupted acinar morphology. Although Cx43 over-expression did not affect total levels of β-catenin, α-catenin and ZO-2, it decreased nuclear levels of β-catenin in 2D and 3D cultures of MCF-7 cells, and in 3D cultures of MDA-MB-231 cells. Cx43 associated at the membrane with α-catenin, β-catenin and ZO-2 in 2D and 3D cultures of MCF-7 cells, and only in 3D conditions in MDA-MB-231 cells. This study suggests that Cx43 exerts tumor suppressive effects in a context-dependent manner where GJ assembly with α-catenin, β-catenin and ZO-2 may be implicated in reducing growth rate, invasiveness, and, malignant phenotype of 2D and 3D cultures of MCF-7 cells, and 3D cultures of MDA-MB-231 cells, by sequestering β-catenin away from nucleus. - Highlights: • Cx43 over-expressing MCF-7 and MDA-MB-231 were grown in 2D and 3D cultures. • Proliferation and growth morphology were affected in a context dependent manner. • Extravasation ability of both MCF

  17. Context dependent reversion of tumor phenotype by connexin-43 expression in MDA-MB231 cells and MCF-7 cells: Role of β-catenin/connexin43 association

    Talhouk, Rabih S., E-mail: rtalhouk@aub.edu.lb [Department of Biology, Faculty of Arts and Sciences, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon); Fares, Mohamed-Bilal; Rahme, Gilbert J.; Hariri, Hanaa H.; Rayess, Tina; Dbouk, Hashem A.; Bazzoun, Dana; Al-Labban, Dania [Department of Biology, Faculty of Arts and Sciences, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon); El-Sabban, Marwan E., E-mail: me00@aub.edu.lb [Department of Anatomy, Cell Biology and Physiology, Faculty of Medicine, American University of Beirut, P.O. Box 11-0236, Beirut (Lebanon)

    2013-12-10

    Connexins (Cx), gap junction (GJ) proteins, are regarded as tumor suppressors, and Cx43 expression is often down regulated in breast tumors. We assessed the effect of Cx43 over-expression in 2D and 3D cultures of two breast adenocarcinoma cell lines: MCF-7 and MDA-MB-231. While Cx43 over-expression decreased proliferation of 2D and 3D cultures of MCF-7 by 56% and 80% respectively, MDA-MB-231 growth was not altered in 2D cultures, but exhibited 35% reduction in 3D cultures. C-terminus truncated Cx43 did not alter proliferation. Untransfected MCF-7 cells formed spherical aggregates in 3D cultures, and MDA-MB-231 cells formed stellar aggregates. However, MCF-7 cells over-expressing Cx43 formed smaller sized clusters and Cx43 expressing MDA-MB-231 cells lost their stellar morphology. Extravasation ability of both MCF-7 and MDA-MB-231 cells was reduced by 60% and 30% respectively. On the other hand, silencing Cx43 in MCF10A cells, nonneoplastic human mammary cell line, increased proliferation in both 2D and 3D cultures, and disrupted acinar morphology. Although Cx43 over-expression did not affect total levels of β-catenin, α-catenin and ZO-2, it decreased nuclear levels of β-catenin in 2D and 3D cultures of MCF-7 cells, and in 3D cultures of MDA-MB-231 cells. Cx43 associated at the membrane with α-catenin, β-catenin and ZO-2 in 2D and 3D cultures of MCF-7 cells, and only in 3D conditions in MDA-MB-231 cells. This study suggests that Cx43 exerts tumor suppressive effects in a context-dependent manner where GJ assembly with α-catenin, β-catenin and ZO-2 may be implicated in reducing growth rate, invasiveness, and, malignant phenotype of 2D and 3D cultures of MCF-7 cells, and 3D cultures of MDA-MB-231 cells, by sequestering β-catenin away from nucleus. - Highlights: • Cx43 over-expressing MCF-7 and MDA-MB-231 were grown in 2D and 3D cultures. • Proliferation and growth morphology were affected in a context dependent manner. • Extravasation ability of both MCF

  18. New N-bearing species towards OH 231.8+4.2. HNCO, HNCS, HC3N, and NO

    Velilla Prieto, L.; Sánchez Contreras, C.; Cernicharo, J.; Agúndez, M.; Quintana-Lacaci, G.; Alcolea, J.; Bujarrabal, V.; Herpin, F.; Menten, K. M.; Wyrowski, F.

    2015-03-01

    Circumstellar envelopes (CSEs) around asymptotic giant branch (AGB) stars are the main sites of molecular formation. OH 231.8+4.2 is a well studied oxygen-rich CSE around an intermediate-mass evolved star that, in dramatic contrast to most AGB CSEs, displays bipolar molecular outflows accelerated up to ~400 km s-1. OH 231.8+4.2 also presents an exceptional molecular richness probably due to shock-induced chemical processes. We report the first detection in this source of four nitrogen-bearing species, HNCO, HNCS, HC3N, and NO, which have been observed with the IRAM-30 m radiotelescope in a sensitive mm-wavelength survey towards this target. HNCO and HNCS are also first detections in CSEs. The observed line profiles show that the emission arises in the massive (~0.6 M⊙) central component of the envelope, expanding with low velocities of Vexp~ 15-30 km s-1, and at the base of the fast lobes. The NO profiles (with FWHM~ 40-50 km s-1) are broader than those of HNCO, HNCS, and HC3N and, most importantly, broader than the line profiles of 13CO, which is a good mass tracer. This indicates that the NO abundance is enhanced in the fast lobes relative to the slow, central parts. From LTE and non-LTE excitation analysis, we estimate beam-average rotational temperatures of Trot~ 15-30 K (and, maybe, up to ~55 K for HC3N) and fractional abundances relative to H2 of X(HNCO) ~ [0.8-1] × 10-7, X(HNCS) ~ [0.9-1] × 10-8, X(HC3N) ~ [5-7] × 10-9, and X(NO) ~ [1-2] × 10-6. NO is, therefore, amongst the most abundant N-bearing species in OH 231.8+4.2. We performed thermodynamical chemical equilibrium and chemical kinetics models to investigate the formation of these N-bearing species in OH 231.8+4.2. The model underestimates the observed abundances for HNCO, HNCS, and HC3N by several orders of magnitude, which indicates that these molecules can hardly be products of standard UV-photon and/or cosmic-ray induced chemistry in OH 231.8+4.2 and that other processes (e.g. shocks) play a

  19. X-231B technology demonstration for in situ treatment of contaminated soil: Laboratory evaluation of in situ vapor stripping

    The goal of the study described in this report was to determine the efficiency of vapor stripping coupled with soil mixing for removing volatile organic compounds (VOCs) from clay soils such as those that underlie the PORTS X-231B Solid Waste Management Unit. This was accomplished by conducting experiments wherein contaminated soil cores were treated in the laboratory using a system that simulated a field-scale vapor stripping/soil mixing treatment process. Treatment efficiencies obtained using several sets of process conditions, such as air temperature and flow rate, were determined through subsampling of the soil cores to establish pre- and posttreatment levels of VOCs in the soil. Two series of experiments were conducted under this study. In the first series, laboratory treatment was performed on intact soil cores that were taken from contaminated zones within the PORTS X-231B Unit using sampler liners that could be adapted as reaction lysimeters. Since soil core disturbance was minimized using this approach, the treatability experiments were conducted on soil that was fairly close to in situ conditions in terms of both soil structure and contaminant levels. The second series of experiments were performed on cores that were packed using X-231B soil and spiked with known amounts of trichloroethylene (TCE). This approach was taken for the second series because the VOC levels in the intact cores were found to be much lower than field values. In addition, the packed cores were smaller than the intact soil cores, with treatment volumes that were about a fifth of the treatment volumes in the intact soil cores. The smaller packed cores were not only easier to handle but were also more reliably characterized due to smaller treatment volumes from which samples were taken

  20. High throughput screening of natural products for anti-mitotic effects in MDA-MB-231 human breast carcinoma cells.

    Mazzio, E; Badisa, R; Mack, N; Deiab, S; Soliman, K F A

    2014-06-01

    Some of the most effective anti-mitotic microtubule-binding agents, such as paclitaxel (Taxus brevifolia) were originally discovered through robust National Cancer Institute botanical screenings. In this study, a high-through put microarray format was utilized to screen 897 aqueous extracts of commonly used natural products (0.00015-0.5 mg/mL) relative to paclitaxel for anti-mitotic effects (independent of toxicity) on proliferation of MDA-MB-231 cells. The data obtained showed that less than 1.34 % of the extracts tested showed inhibitory growth (IG50 ) properties Phoradendron flavescens), Tou Gu Cao [symbol: see text] Speranskia herb (Speranskia tuberculata), Bentonite clay, Bunge root (Pulsatilla chinensis), Brucea fruit (Brucea javanica), Madder root (Rubia tinctorum), Gallnut of Chinese Sumac (Melaphis chinensis), Elecampane root (Inula Helenium), Yuan Zhi [symbol: see text] root (Polygala tenuifolia), Pagoda Tree fruit (Melia Toosendan), Stone root (Collinsonia Canadensis), and others such as American Witchhazel, Arjun, and Bladderwrack. The strongest tumoricidal herbs identified from amongst the subset evaluated for anti-mitotic properties were wild yam (Dioscorea villosa), beth root (Trillium Pendulum), and alkanet root (Lithospermum canescens). Additional data was obtained on a lesser-recognized herb: (S. tuberculata), which showed growth inhibition on BT-474 (human ductal breast carcinoma) and Ishikawa (human endometrial adenocarcinoma) cells with ability to block replicative DNA synthesis, leading to G2 arrest in MDA-MB-231 cells. In conclusion, these findings present relative potency of anti-mitotic natural plants that are effective against human breast carcinoma MDA-MB-231 cell division. PMID:24105850

  1. ESTRATÉGIAS DE RESPONSABILIDADE SOCIAL CORPORATIVA: UM ESTUDO SOBRE OS 231 CASOS CONCRETOS DO INSTITUTO ETHOS

    Franciara Maria de Oliveira

    2006-01-01

    Resumo
    Um perfil das estratégias de Responsabilidade Social Corporativa adotadas por empresas no Brasil é o objetivo
    principal deste trabalho. Utilizou-se como universo de estudo os 231 Casos Concretos preenchidos
    espontaneamente pelas empresas filiadas na página web do Instituto Ethos de Empresa e Responsabilidade
    Social (Instituto Ethos). Os casos foram analisados pelo software alemão de análise de dados qualitativos&l...

  2. Human Sulfatase 2 inhibits in vivo tumor growth of MDA-MB-231 human breast cancer xenografts

    Extracellular human sulfatases modulate growth factor signaling by alteration of the heparin/heparan sulfate proteoglycan (HSPG) 6-O-sulfation state. HSPGs bind to numerous growth factor ligands including fibroblast growth factors (FGF), epidermal growth factors (EGF), and vascular endothelial growth factors (VEGF), and are critically important in the context of cancer cell growth, invasion, and metastasis. We hypothesized that sulfatase activity in the tumor microenvironment would regulate tumor growth in vivo. We established a model of stable expression of sulfatases in the human breast cancer cell line MDA-MB-231 and purified recombinant human Sulfatase 2 (rhSulf2) for exogenous administration. In vitro studies were performed to measure effects on breast cancer cell invasion and proliferation, and groups were statistically compared using Student's t-test. The effects of hSulf2 on tumor progression were tested using in vivo xenografts with two methods. First, MDA-MB-231 cells stably expressing hSulf1, hSulf2, or both hSulf1/hSulf2 were grown as xenografts and the resulting tumor growth and vascularization was compared to controls. Secondly, wild type MDA-MB-231 xenografts were treated by short-term intratumoral injection with rhSulf2 or vehicle during tumor growth. Ultrasound analysis was also used to complement caliper measurement to monitor tumor growth. In vivo studies were statistically analyzed using Student's t test. In vitro, stable expression of hSulf2 or administration of rhSulf2 in breast cancer cells decreased cell proliferation and invasion, corresponding to an inhibition of ERK activation. Stable expression of the sulfatases in xenografts significantly suppressed tumor growth, with complete regression of tumors expressing both hSulf1 and hSulf2 and significantly smaller tumor volumes in groups expressing hSulf1 or hSulf2 compared to control xenografts. Despite significant suppression of tumor volume, sulfatases did not affect vascular

  3. X-231B technology demonstration for in situ treatment of contaminated soil: Laboratory evaluation of chemical oxidation using hydrogen peroxide

    Treatability studies were conducted as part of a comprehensive research project initiated to demonstrate as well as evaluate in situ treatment technologies for volatile organic compounds (VOCs) and radioactive substances in wet, slowly permeable soils. The site of interest for this project was the X-231B Oil Biodegradation unit at the Portsmouth Gaseous Diffusion Plant, a US Department of Energy (DOE) facility in southern Ohio. This report describes the treatability studies that investigated the feasibility of the application of low-strength hydrogen peroxide (H2O2) solutions to treat trichloroethylene (TCE)-contaminated soil

  4. Radiosensitizing effect of conjugated linoleic acid in MCF-7 and MDA-MB-231 breast cancer cells

    Apoptotic pathways in breast cancer cells are frequently altered, reducing the efficiency of radiotherapy. Conjugated linoleic acid (CLA), known to trigger apoptosis, was tested as radiosensitizer in breast cancer cells MCF-7 and MDA-MB-231. The CLA-mix, made up of the isomers CLA-9cis 11trans and CLA-10trans 12cis, was compared to three purified isomers, i.e., the CLA-9cis 11cis, CLA-9cis 11trans, and CLA-10trans 12cis. Using the apoptotic marker YO-PRO-1, the CLA-9cis 11cis at 50 μmol/L turned out to be the best apoptotic inducer leading to a 10-fold increase in MCF-7 cells and a 2,5-fold increase in MDA-MB-231 cells, comparatively to the CLA-mix. Contrary to previous studies on colorectal and prostate cancer cells, CLA-10trans 12cis does not lead to an apoptotic response on breast cancer cell lines MCF-7 and MDA-MB-231. Our results also suggest that the main components of the CLA-mix (CLA-9cis 11trans and CLA-10trans 12cis) are not involved in the induction of apoptosis in the breast cancer cells studied. A dose of 5 Gy did not induce apoptosis in MCF-7 and MDA-MB-231 cells. The addition of CLA-9cis 11cis or CLA-mix has allowed us to observe a radiation-induced apoptosis, with the CLA-9cis 11cis being about 8-fold better than the CLA-mix. CLA-9cis 11cis turned out to be the best radiosensitizer, although the isomers CLA-9cis 11trans and CLA-10trans 12cis have also reduced the cell survival following irradiation, but using a mechanism not related to apoptosis. In conclusion, the radiosensitizing property of CLA-9cis 11cis supports its potential as an agent to improve radiotherapy against breast carcinoma. (author)

  5. High throughput screening of natural products for anti-mitotic effects in MDA-MB-231 human breast carcinoma cells

    Mazzio, E; Badisa, R; Mack, N; Deiab, S.; Soliman, KFA

    2013-01-01

    Some of the most effective anti-mitotic microtubule-binding agents, such as paclitaxel (Taxus brevifolia) were originally discovered through robust NCI botanical screenings. In this study, a high-through microarray format was utilized to screen 897 aqueous extracts of commonly used natural products (0.00015–0.5 mg/ml) relative to paclitaxel for anti-mitotic effects (independent of toxicity) on proliferation of MDA-MB-231 cells. The data obtained showed that less than 1.34 % tested showed inhi...

  6. Expression and Activity of Carbonic Anhydrase IX Is Associated With Metabolic Dysfunction in MDA-MB-231 Breast Cancer Cells

    Ying LI; Wang, Hai; Oosterwijk, Egbert; Tu, Chingkuang; Shiverick, Kathleen T.; Silverman, David N.; Frost, Susan C.

    2009-01-01

    The expression of carbonic anhydrase IX (CAIX), a marker for hypoxic tumors, is correlated with poor prognosis in breast cancer patients. We show herein that the MDA-MB-231 cells, a “triple-negative,” basal B line, express exclusively CAIX, while a luminal cell line (T47D) expresses carbonic anhydrase XII (CAXII). CAIX expression in the basal B cells is both density-and hypoxia-dependent and is correlated with carbonic anhydrase activity. Evidence is provided that CAIX contributes to extracel...

  7. Differential Epigenetic Effects of Atmospheric Cold Plasma on MCF-7 and MDA-MB-231 Breast Cancer Cells

    Sung-Bin Park; Byungtak Kim; Hansol Bae; Hyunkyung Lee; Seungyeon Lee; Eun H. Choi; Sun Jung Kim

    2015-01-01

    Cold atmospheric plasma (plasma) has emerged as a novel tool for a cancer treatment option, having been successfully applied to a few types of cancer cells, as well as tissues. However, to date, no studies have been performed to examine the effect of plasma on epigenetic alterations, including CpG methylation. In this study, the effects of plasma on DNA methylation changes in breast cancer cells were examined by treating cultured MCF-7 and MDA-MB-231 cells, representing estrogen-positive and ...

  8. Interfering with CXCR4 expression inhibits proliferation, adhesion and migration of breast cancer MDA-MB-231 cells

    Guo, Shanyu; Xiao, Dan; LIU, HUIHUI; Zheng, Xiao; Liu, Lei; LIU, SHOUGUI

    2014-01-01

    To investigate the effect and mechanism of the CXC chemokine receptor 4 (CXCR4) in the proliferation and migration of breast cancer, a short-hairpin RNA (shRNA) eukaryotic expression vector targeting CXCR4 was constructed, and the impact of such on the proliferation, adhesion and migration of human breast cancer MDA-MB-231 cells was observed. The fragments of CXCR4-shRNA were synthesized and cloned into a pGCsi-U6-Neo-green fluorescent protein vector. The recombinant plasmids were transfected...

  9. Inhibition of γ-synuclein (SNCG) expression in breast cancer MDA-MB231 cell line%抑制SNCG阳性表达乳腺癌细胞株MDA-MB231的实验研究

    Tao Ren; Bangxian Tan; Xiaojie Ma; Yan Gui; Daiyuan Ma; Yeqin Zhou

    2012-01-01

    Objective: The aim of the study was to evaluate the inhibition of different chemotherapy drugs on γ-synuclein (SNCG) positive expression of breast cancer cell line MDA-MB231, and the effects on cell cycle and apoptosis, and to explore the related mechanism as well.Methods: We treated the breast cancer cell line MDA-MB231 for the inhibition of SNCG with chemotherapy drugs such as irinotecan, nedaplatin and 5-fluorouracil using RT-PCR and immunohistochemistry, and adopted flow cytometry to detect cell cycle distribution and apoptosis.Results: At the transcription and translation levels, the SNCG expression level in nedaplatin group and 5-fluorouracil group was lower than that of other groups and there was statistically significance (P < 0.01) compared with the control group, while there was not statistically significant between irinotecan group and the control group.After drugs action, cell cycle and distribution in each experiment group changed obviously, where the cells in G0G1 phase increased, especially the cells in the nedaplatin group and 5-fluorouracil group changed most significantly, as well as the obvious change in the cells of nedaplatin group and 5-fluorouracil group in the apoptosis period.Conclusion: There was a stronger inhibition of SNCG expression in nedaplatin and 5-fluorouracil groups, and can cause significant cell cycle and apoptosis changes.It may also be concluded that nedaplatin and 5-fluorouracil could make effects by the mechanisms of inhibiting cancer cell proliferation and inducing cell apoptosis.

  10. PARP inhibitor ABT-888 affects response of MDA-MB-231 cells to doxorubicin treatment, targeting Snail expression.

    Mariano, Germano; Ricciardi, Maria Rosaria; Trisciuoglio, Daniela; Zampieri, Michele; Ciccarone, Fabio; Guastafierro, Tiziana; Calabrese, Roberta; Valentini, Elisabetta; Tafuri, Agostino; Del Bufalo, Donatella; Caiafa, Paola; Reale, Anna

    2015-06-20

    To overcome cancer cells resistance to pharmacological therapy, the development of new therapeutic approaches becomes urgent. For this purpose, the use of poly(ADP-ribose) polymerase (PARP) inhibitors in combination with other cytotoxic agents could represent an efficacious strategy. Poly(ADP-ribosyl)ation (PARylation) is a post-translational modification that plays a well characterized role in the cellular decisions of life and death. Recent findings indicate that PARP-1 may control the expression of Snail, the master gene of epithelial-mesenchymal transition (EMT). Snail is highly represented in different resistant tumors, functioning as a factor regulating anti-apoptotic programmes. MDA-MB-231 is a Snail-expressing metastatic breast cancer cell line, which exhibits chemoresistance properties when treated with damaging agents. In this study, we show that the PARP inhibitor ABT-888 was capable to modulate the MDA-MB-231 cell response to doxorubicin, leading to an increase in the rate of apoptosis. Our further results indicate that PARP-1 controlled Snail expression at transcriptional level in cells exposed to doxorubicin. Given the increasing interest in the employment of PARP inhibitors as chemotherapeutic adjuvants, our in vitro results suggest that one of the mechanisms through which PARP inhibition can chemosensitize cancer cells in vivo, is targeting Snail expression thus promoting apoptosis. PMID:25938539

  11. Curcumin inhibits intracellular fatty acid synthase and induces apoptosis in human breast cancer MDA-MB-231 cells.

    Fan, Huijin; Liang, Yan; Jiang, Bing; Li, Xiabing; Xun, Hang; Sun, Jia; He, Wei; Lau, Hay Tong; Ma, Xiaofeng

    2016-05-01

    High levels of fatty acid synthase (FAS) expression have been found in many tumors, including prostate, breast, and ovarian cancers, and inhibition of FAS has been reported to obstruct tumor growth in vitro and in vivo. Curcumin is one of the major active ingredients of Curcuma longa, which has been proven to inhibit the growth of cancer cells. In the present study, we investigated the potential activity of curcumin as a FAS inhibitor for chemoprevention of breast cancer. As a result, curcumin induced human breast cancer MDA-MB-231 cell apoptosis with the half-inhibitory concentration value of 3.63 ± 0.26 µg/ml, and blocked FAS activity, expression and mRNA level in a dose-dependent manner. Curcumin also regulated B-cell lymphoma 2 (Bcl-2), Bax and p-Akt protein expression in MDA-MB-231 cells. Moreover, FAS knockdown showed similar effect as curcumin. All these results suggested that curcumin may induce cell apoptosis via inhibiting FAS. PMID:26985864

  12. BVR_cI_c monitoring of ON 231 during the great outburst in 1994-1997

    Tosti, G.; Fiorucci, M.; Luciani, M.; Rizzi, N.; Villata, M.; Raiteri, C. M.; de Francesco, G.; Lanteri, L.; Chiaberge, M.; Peila, A.; Cavallone, M.; Sobrito, G.; Maesano, M.; Massaro, E.; Montagni, F.; Nesci, R.; Ghisellini, G.; Takalo, L. O.; Sillanpaeae, A.; Katajainen, S.; Heinaemaeki, P.; Nilsson, K.; Pursimo, T.

    1998-05-01

    We present the most continuous data base of optical multiband data ever published on the BL Lacertae object ON 231 (W Com). The data have been collected during an intensive and coordinated BVR_cI_c monitoring campaign carried out in the period from March 1994 to March 1997. During our campaign, the source brightness was at the highest level ever observed. The light curve shows a complex structure, characterized by the presence of three major outbursts having the observed maxima in March 1995, February 1996, and January 1997, when ON 231 reached its historical maximum (B =~ 14.2). Variability on time scales from a few hours up to a month have frequently been observed and the light curve seems to be the superposition of many flares with different amplitudes and time scales. The broad-band optical spectral energy distribution is characterized by a spectral slope which correlates with the flux level. In particular, the higher is the flux the flatter is the spectrum. Table 2 is only available in electronic form at the CDS via anonymous ftp 130.79.128.5 or via http://cdsweb.u-strasbg.fr/Abstract.html

  13. Masses of Astrometrically-Discovered and Imaged Binaries: G 78-28AB and GJ 231.1BC

    Pravdo, S H; Wiktorowicz, S J; Kulkarni, S; Lloyd, J P; Martinache, F; Tuthill, P G; Ireland, M J; Pravdo, Steven H.; Shaklan, Stuart B.; Wiktorowicz, Sloane J.; Kulkarni, Shri; Lloyd, James P.; Martinache, Frantz; Tuthill, Peter G.; Ireland, Michael J.

    2006-01-01

    The Stellar Planet Survey (STEPS) is an ongoing astrometric search for giant planets and brown dwarfs around a sample of ~30 M-dwarfs. We have discovered several low-mass companions by measuring the motion of our target stars relative to their reference frames. The highest mass discovery thus far is G 78-28B, a companion to the M-dwarf G 78-28A. The orbital period is 4.18 +/- 0.03 y, the system mass is 0.565 +/- 0.055 Msolar, and the semi-major axis is 2.19 +/- 0.10 AU. Imaging observations with the Keck laser guide star adaptive optics (LGSAO) and the Palomar AO instruments resolved the system and also yielded JHK-band delta magnitudes. We use the orbital solution, light ratios, and mass-luminosity relationships to derive component masses of MA = 0.370 +/- 0.034 Msolar and MB = 0.195 +/- 0.021 Msolar. G 78-28B is of type M4 V based upon its colors and mass. We also discovered GJ 231.1C, a companion to GJ 231.1B, with STEPS and imaged the companion with LGSAO and Palomar AO, but the orbital period is longer t...

  14. Broccoli and watercress suppress matrix metalloproteinase-9 activity and invasiveness of human MDA-MB-231 breast cancer cells

    A high dietary intake of cruciferous vegetables has been associated with a reduction in numerous human pathologies particularly cancer. In the current study, we examined the inhibitory effects of broccoli (Brassica oleracea var. italica) and watercress (Rorripa nasturtium aquaticum) extracts on 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced cancer cell invasion and matrix metalloproteinase-9 activity using human MDA-MB-231 breast cancer cells. Aberrant overexpression of matrix metalloproteinases, including metalloproteinase-9, is associated with increased invasive potential in cancer cell lines. Our results demonstrate that extracts of broccoli and Rorripa suppressed TPA-induced MMP-9 activity and invasiveness in a concentration dependant manner as determined by zymographic analysis. Furthermore, fractionation of individual extracts followed by liquid chromatography mass spectroscopy analysis (LC-MS) revealed that the inhibitory effects of each vegetable were associated with the presence of 4-methysulfinylbutyl (sulforaphane) and 7-methylsulphinylheptyl isothiocyanates. Taken together, our data indicate that isothiocyanates derived form broccoli and Rorripa inhibit metalloproteinase 9 activities and also suppress the invasive potential of human MDA-MB-231 breast cancer cells in vitro. The inhibitory effects observed in the current study may contribute to the suppression of carcinogenesis by diets high in cruciferous vegetables

  15. FGFR4 GLY388 isotype suppresses motility of MDA-MB-231 breast cancer cells by EDG-2 gene repression.

    Stadler, Christiane Regina; Knyazev, Pjotr; Bange, Johannes; Ullrich, Axel

    2006-06-01

    Clinical investigations of an FGFR4 germline polymorphism, resulting in substitution of glycine by arginine at codon 388 (G388 to R388), have shown a correlation between FGFR4 R388 and aggressive disease progression in cancer patients. Here, we studied the differential effects of the two FGFR4 isotypes on cellular signalling and motility in the MDA-MB-231 human breast cancer cell model. cDNA array analysis showed the ability of FGFR4 G388 to suppress expression of specific genes involved in invasiveness and motility. Further investigations concentrating on cell signalling and motility revealed an abrogation of phosphatidylinositol-3-kinase-dependent LPA-induced Akt activation and cell migration due to downregulation of the LPA receptor Edg-2 in FGFR4 G388-expressing MDA-MB-231 cells. Moreover, FGFR4 G388 expression attenuated the invasivity of the breast cancer cell line and decreased small Rho GTPase activity. We conclude that FGFR4 G388 suppresses cell motility of invasive breast cancer cells by altering signalling pathways and the expression of genes that are required for metastasis. Therefore, the positive effect of FGFR4 R388 on disease progression appears to result from a loss of the tumour suppressor activity displayed by FGFR4 G388 rather than the acquisition or enhancement of oncogenic potential. PMID:16109476

  16. L-leucine transport in human breast cancer cells (MCF-7 and MDA-MB-231): kinetics, regulation by estrogen and molecular identity of the transporter.

    Shennan, D B; Thomson, J; Gow, I F; Travers, M T; Barber, M C

    2004-08-30

    The transport of L-leucine by two human breast cancer cell lines has been examined. L-leucine uptake by MDA-MB-231 and MCF-7 cells was via a BCH-sensitive, Na+ -independent pathway. L-leucine uptake by both cell lines was inhibited by L-alanine, D-leucine and to a lesser extent by L-lysine but not by L-proline. Estrogen (17beta-estradiol) stimulated L-leucine uptake by MCF-7 but not by MDA-MB-231 cells. L-leucine efflux from MDA-MB-231 and MCF-7 cells was trans-stimulated by BCH in a dose-dependent fashion. The effect of external BCH on L-leucine efflux from both cell types was almost abolished by reducing the temperature from 37 to 4 degrees C. There was, however, a significant efflux of L-leucine under zero-trans conditions which was also temperature-sensitive. L-glutamine, L-leucine, D-leucine, L-alanine, AIB and L-lysine all trans-stimulated L-leucine release from MDA-MB-231 and MCF-7 cells. In contrast, D-alanine and L-proline had little or no effect. The anti-cancer agent melphalan inhibited L-leucine uptake by MDA-MB-231 cells but had no effect on L-leucine efflux. Quantitative real-time PCR revealed that LAT1 mRNA was approximately 200 times more abundant than LAT2 mRNA in MCF-7 cells and confirmed that MDA-MB-231 cells express LAT1 but not LAT2 mRNA. LAT1 mRNA levels were higher in MCF-7 cells than in MDA-MB-231 cells. Furthermore, LAT1 mRNA was more abundant than CD98hc mRNA in both MDA-MB-231 and MCF-7 cells. The results suggest that system L is the major transporter for L-leucine in both MDA-MB-231 and MCF-7 cells. It is possible that LAT1 may be the major molecular correlate of system L in both cell types. However, not all of the properties of system L reflected those of LAT1/LAT2/CD98hc. PMID:15328053

  17. Herbal Extract SH003 Suppresses Tumor Growth and Metastasis of MDA-MB-231 Breast Cancer Cells by Inhibiting STAT3-IL-6 Signaling

    Youn Kyung Choi

    2014-01-01

    Full Text Available Cancer inflammation promotes cancer progression, resulting in a high risk of cancer. Here, we demonstrate that our new herbal extract, SH003, suppresses both tumor growth and metastasis of MDA-MB-231 breast cancer cells via inhibiting STAT3-IL-6 signaling path. Our new herbal formula, SH003, mixed extract from Astragalus membranaceus, Angelica gigas, and Trichosanthes kirilowii Maximowicz, suppressed MDA-MB-231 tumor growth and lung metastasis in vivo and reduced the viability and metastatic abilities of MDA-MB-231 cells in vitro. Furthermore, SH003 inhibited STAT3 activation, which resulted in a reduction of IL-6 production. Therefore, we conclude that SH003 suppresses highly metastatic breast cancer growth and metastasis by inhibiting STAT3-IL-6 signaling path.

  18. Direct RNA sequencing mediated identification of mRNA localized in protrusions of human MDA-MB-231 metastatic breast cancer cells

    Jakobsen, Kristine Raaby; Sørensen, Emilie; Brøndum, Karin Kathrine;

    2013-01-01

    To describe genome wide RNA localized in protrusions of the metastatic human breast cancer cell line MDA-MB-231 we used Boyden chamber based methodology followed by direct mRNA sequencing. Results In the hereby identified group of protrusion localized mRNA some previously were described to be...... localized exemplified by mRNA for Ras-Related protein 13 (RAB13) and p0071 (Plakophilin-4/PKP4). For other transcripts, exemplified by mRNA for SH3PXD2A/TKS5 and PPFIA1/Liprin-α1, only the corresponding proteins previously were described to have protrusion localization. Finally, a cohort of MDA-MB-231...... protrusion localized transcripts represents novel candidates to mediate cancer cell subcellular region specific functions through mRNA direction to protrusions. We included a further characterization of p0071, an armadillo repeat protein of adherence junctions and desmosomes, in MDA-MB-231 and non...

  19. The multi-phase winds of Markarian 231: from the hot, nuclear, ultra-fast wind to the galaxy-scale, molecular outflow

    Feruglio, C.; Fiore, F.; Carniani, S.; Piconcelli, E.; Zappacosta, L.; Bongiorno, A.; Cicone, C.; Maiolino, R.; Marconi, A.; Menci, N.; Puccetti, S.; Veilleux, S.

    2015-01-01

    Mrk 231 is a nearby ultra-luminous IR galaxy exhibiting a kpc-scale, multi-phase AGN-driven outflow. This galaxy represents the best target to investigate in detail the morphology and energetics of powerful outflows, as well as their still poorly-understood expansion mechanism and impact on the host galaxy. In this work, we present the best sensitivity and angular resolution maps of the molecular disk and outflow of Mrk 231, as traced by CO(2−1) and (3−2) observations obtained with the IRAM/P...

  20. Cinnamomum cassia Suppresses Caspase-9 through Stimulation of AKT1 in MCF-7 Cells but Not in MDA-MB-231 Cells

    Sima Kianpour Rad; Kanthimathi, M. S.; Sri Nurestri Abd Malek; Guan Serm Lee; Chung Yeng Looi; Won Fen Wong

    2015-01-01

    Background Cinnamomum cassia bark is a popular culinary spice used for flavoring and in traditional medicine. C. cassia extract (CE) induces apoptosis in many cell lines. In the present study, particular differences in the mechanism of the anti-proliferative property of C. cassia on two breast cancer cell lines, MCF-7 and MDA-MB-231, were elucidated. Methodology/Principal Findings The hexane extract of C. cassia demonstrated high anti-proliferative activity against MCF-7 and MDA-MB-231 cells ...

  1. Roles for GP IIb/IIIa and αvβ3 integrins in MDA-MB-231 cell invasion and shear flow-induced cancer cell mechanotransduction.

    Zhao, Fenglong; Li, Li; Guan, Liuyuan; Yang, Hong; Wu, Chunhui; Liu, Yiyao

    2014-03-01

    Adhesion of cancer cell to endothelial cells and the subsequent trans-endothelial migration are key steps in hematogenous metastasis. However, the molecular mechanisms of cancer cell/endothelial cell interaction under hemodynamic shear flow and how shear flow-induced cancer cell mechanotransduction are yet to be fully defined. In this study, we identified that the integrins of both platelet glycoprotein IIb/IIIa (GP IIb/IIIa) and αvβ3 were crucial for hematogenous metastasis of human breast carcinoma MDA-MB-231 cells. The cell migration and invasion were studied by using Millicell cell culture insert system. The numbers of invaded MDA-MB-231 cells significantly increased by thrombin-activated platelets and reduced by eptifibatide, a platelet inhibitor. Meanwhile, RGDWE peptides, a specific inhibitor of αvβ3 integrin, also inhibited MDA-MB-231 cell invasion. We further used a parallel-plate flow chamber to investigate MDA-MB-231 cell adhesion under flow conditions. Alike in static condition, the adhesion capability of MDA-MB-231 cells to endothelial monolayer was also significantly affected by GP IIb/IIIa and αvβ3 integrins. The expression of matrix metalloproteinase-2 (MMP-2), MMP-9 and αvβ3 integrin in MDA-MB-231 cells were up-regulated after low shear stress exposure (1.84 dynes/cm(2), 2 h). Moreover, we also demonstrated that low shear stress induced a sustained activation of p85 (a regulatory subunit of PI3K) and Akt. Pre-treating MDA-MB-231 cells with the specific PI3K inhibitor of LY294002 abolished the shear stress induced-Akt activation, and the expression of MMP-2, MMP-9, vascular endothelial growth factor (VEGF) and αvβ3 integrin were also down-regulated. Immunofluorescence assay showed that low shear stress also induced αvβ3 integrin clustering and nuclear factor-κB (NF-κB) activation. Interestingly, shear stress-induced activation of Akt and NF-κB was attenuated by LM609, a specific antibody of αvβ3 integrin. It suggests that αvβ3

  2. Tanshinone IIA inhibits human breast cancer MDA-MB-231 cells by decreasing LC3-II, Erb-B2 and NF-κBp65

    Su, Chin-Cheng; Chien, Su-Yu; Kuo, Shou-Jen; Chen, Yao-Li; CHENG, CHUN-YUAN; Chen, Dar-Ren

    2012-01-01

    The ability of tanshinone IIA (Tan-IIA) to inhibit the proliferation of human breast cancer cell lines in vitro and in vivo is well documented. However, the molecular mechanisms have not been fully elucidated. In the present study, MDA-MB-231 cells were treated with different concentrations of Tan-IIA for 48 h, followed by protein extraction for western blotting. For an in vivo study, MDA-MB-231 cells were implanted directly into female SCID mice which were divided randomly into three groups ...

  3. Induction of apoptosis and oxidative stress in estrogen receptor-negative breast cancer, MDA-MB231 cells, by ethanolic mango seed extract

    Abdullah, Al-Shwyeh Hussah; Mohammed, Abdulkarim Sabo; Rasedee, Abdullah; Mirghani, Mohamed Elwathig Saeed; Al-Qubaisi, Mothanna Sadiq

    2015-01-01

    Background In this study, the effect of mango kernel extract in the induction of apoptosis of the breast cancer (MDA-MB-231) cell line was examined. This is an attempt to discover alternatives to current therapeutic regimes in the treatment of breast cancers. Methods The pro-apoptotic markers, Bax, cytochrome c, caspases-. -8 and −9, and anti-apoptotic markers, Bcl-2, p53 and glutathione were determined in MDA-MB231 cells treated for 12 and 24 h with mango kernel extract. Results The results ...

  4. Blueberry Phytochemicals Inhibit Growth and Metastatic Potential of MDA-MB-231 Breast Cancer Cells Through Modulation of the Phosphatidylinositol 3-Kinase Pathway

    Adams, Lynn S.; Phung, Sheryl; Yee, Natalie; Seeram, Navindra P.; Li, Liya; Chen, Shiuan

    2010-01-01

    Dietary phytochemicals are known to exhibit a variety of anti-carcinogenic properties. This study investigated the chemopreventive activity of blueberry extract in triple negative breast cancer cell lines in vitro and in vivo. Blueberry decreased cell proliferation in HCC38, HCC1937 and MDA-MB-231 cells with no effect on the non-tumorigenic MCF-10A cell line. Decreased metastatic potential of MDA-MB-231 cells by blueberry was shown through inhibition of cell motility using wound healing assay...

  5. Platycodin D from Platycodonis Radix enhances the anti-proliferative effects of doxorubicin on breast cancer MCF-7 and MDA-MB-231 cells

    Tang, Zheng-Hai; Li, Ting; Gao, Hong-wei; Sun, Wen; Chen, Xiu-Ping; Wang, Yi-Tao; Lu, Jin-jian

    2014-01-01

    Background It has been demonstrated that platycodin D (PD) exhibits anti-cancer activities. This study aims to investigate the anti-proliferative effects of the combination of PD and doxorubicin (DOX) on human breast cancer cells (MCF-7 and MDA-MB-231 cells). Methods The anti-proliferative effects of different dosages of PD, DOX, and PD + DOX on MCF-7 and MDA-MB-231 cells were determined by the MTT assay. The 10 μM PD, 5 μM DOX, and 10 μM PD + 5 μM DOX induced-protein expression of apoptosis-...

  6. Ginsenoside Rg3 Inhibits Constitutive Activation of NF-κB Signaling in Human Breast Cancer (MDA-MB-231) Cells: ERK and Akt as Potential Upstream Targets

    Kim, Bo-Min; Kim, Do-hee; Park, Jeong-Hill; Surh, Young-Joon; Na, Hye-Kyung

    2014-01-01

    Ginsenoside Rg3, one of the major ingredients of heat-processed ginseng, has been reported to inhibit the growth of various cancer cells. We previously reported that Rg3 inhibited the proliferation and induced apoptosis of breast cancer (MDA-MB-231) cells. In the present study, we have explored the mechanism underlying the anti-proliferative and proapoptotic effects of Rg3 in MDA-MB-231 cells, which have constitutively activated NF-κB and the mutant form of p53. Rg3 inhibited DNA binding and ...

  7. Data on cell cycle in breast cancer cell line, MDA-MB-231 with ferulic acid treatment.

    Park, Eunmi

    2016-06-01

    Inhibition to repair DNA metabolism to respond to damaged DNA can lead to genetic instability, resulting in cancer cell death (Audeh et al., 2010; Bryant et al., 2005; Farmer et al., 2005; Lukas et al., 2003; Tutt et al., 2010) [1], [2], [6], [8], [11]. Despite of various studies demonstrating efficiency of combination therapy through down-regulation of DNA repair pathway, the suppression effects of DNA repair pathway by chemotherapeutic agents from natural bioactive compounds are less understood (Eitsuka et al., 2014; Kastan et al., 2004; Kawabata et al., 2000; Mancuso et al., 2014) [5], [7], [9]. Here, the data shows that ferulic acid reduced the S-phases post to UV treatment in breast cancer cells and was hypersensitive in breast cancer cells, MDA-MB-231. PMID:26958638

  8. Clinical and liver biopsy pathological features in military patients with liver diseases: An analysis of 231 cases

    Yan-ling SUN

    2012-06-01

    Full Text Available Objective  To explore epidemiological, serological and histopathological (by liver biopsy features of liver diseases, and clinical manifestations in patients of the Chinese armed forces. Methods  The clinical data of 231 cases of military patients with liver diseases in our hospital were retrospectively analyzed in terms of their age, gender, location of enlistment, services, official rank, clinical manifestation, and laboratory examination, and also pathological characteristics of liver biopsy. Results  Among the 231 hospitalized military patients, 202 were male and 29 were female. The age at onset of the disease ranged from 18 to 73 years (mean age 29.7±9.1. Higher morbidity (48.1% was found in the 18-25 year age bracket, while lower (only about 7.4% in above 55-year-old age bracket. Virus infection accounted for 68.0% and non-virus infection accounted for 32.0%. About 64.9% of the patients suffered from chronic liver disease, while 35.1% from acute liver disease. In addition, the prevalence of liver disease was as high as 47.2% in the soldiers, slightly higher than that in the officers (about 38.1%. Transmission of the disease between comrades in arms accounted approximately for 14.0%. Conclusions  The mean age of onset of liver disease in military personnel is younger, ranging from 18 to 25 years old predominantly, and the incidence is gradually decreased along with the age. The prevalence of liver disease may be higher in soldiers than in officers. There is a higher percentage of virus infection-associated liver ailment and chronic liver ailment. For acute liver ailment, pathological diagnosis by liver biopsy should be made, and timely therapeutic measures should be taken to prevent transformation of acute to chronic stage.

  9. Evaluation of anticancer potential of Bacopa monnieri L. against MCF-7 and MDA-MB 231 cell line

    Md. Nasar Mallick

    2015-01-01

    Full Text Available Background: The ethanolic extract of Bacopa monnieri contains bacoside A and B, brahmin, cucurbitacins, and betulinic acid. Currently, cucurbitacins have also been reported for their strong anti-tumorigenic and anti-proliferative activity by inducing cell cycle arrest at the G2/M phase and formation of multiplied cells. The present study was carried out to evaluate the in vitro cytotoxic activity of ethanolic extract of dichloromethane (DCM fraction of B. monnieri on two different cell lines. Materials and Methods: The ethanolic extract of B. monnieri was prepared using soxhlet extraction method and different fractions (hexane, DCM, methanol, acetone, and water of ethanolic extracts were prepared. The 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide assay of ethanolic extract and of all fractions was carried out on MCF-7 and MDA-MB 231 cell lines. The presence of cucurbitacins and betulinic acid in these fractions was confirmed by high-performance thin layer chromatography. Results: The IC50 values of ethanolic extract of B. monnieri in MCF-7 and MDA-MB 231 cell lines were 72.0 μg/mL and 75.0 μg/mL, respectively. The DCM fraction of B. monnieri showed maximum cytotoxic activity among all fraction upto 72 h and was found to be 57.0 μg/mL and 42.0 μg/mL, respectively. Conclusion: The results showed good cytotoxic activity in DCM fraction in both the cell lines may be due to the presence of cucurbitacins and betulinic acid in DCM fraction.

  10. {\\it NuSTAR} Reveals an Intrinsically X-ray Weak Broad Absorption Line Quasar in the Ultraluminous Infrared Galaxy Markarian 231

    Teng, Stacy H; Harrison, F A; Luo, B; Alexander, D M; Bauer, F E; Boggs, S E; Christensen, F E; Comastri, A; Craig, W W; Fabian, A C; Farrah, D; Fiore, F; Gandhi, P; Grefenstette, B W; Hailey, C J; Hickox, R C; Madsen, K K; Ptak, A F; Rigby, J R; Risaliti, G; Saez, C; Stern, D; Veilleux, S; Walton, D J; Wik, D R; Zhang, W W

    2014-01-01

    We present high-energy (3--30 keV) {\\it NuSTAR} observations of the nearest quasar, the ultraluminous infrared galaxy (ULIRG) Markarian 231 (Mrk 231), supplemented with new and simultaneous low-energy (0.5--8 keV) data from {\\it Chandra}. The source was detected, though at much fainter levels than previously reported, likely due to contamination in the large apertures of previous non-focusing hard X-ray telescopes. The full band (0.5--30 keV) X-ray spectrum suggests the active galactic nucleus (AGN) in Mrk 231 is absorbed by a patchy and Compton-thin (N$_{\\rm H} \\sim1.2^{+0.3}_{-0.3}\\times10^{23}$ cm$^{-2}$) column. The intrinsic X-ray luminosity (L$_{\\rm 0.5-30 keV}\\sim1.0\\times10^{43}$ erg s$^{1}$) is extremely weak relative to the bolometric luminosity where the 2--10 keV to bolometric luminosity ratio is $\\sim$0.03% compared to the typical values of 2--15%. Additionally, Mrk 231 has a low X-ray-to-optical power law slope ($\\alpha_{\\rm OX}\\sim-1.7$). It is a local example of a low-ionization broad absorpti...

  11. Cytotoxicity enhancement in MDA-MB-231 cells by the combination treatment of tetrahydropalmatine and berberine derived from Corydalis yanhusuo W. T. Wang

    Yan Zhao

    2014-04-01

    Conclusion: Our findings suggested that the combination of THP and Ber might be beneficial for anti-proliferation of MDA-MB-231 breast cancer cells through a significant synergy effect. [J Intercult Ethnopharmacol 2014; 3(2.000: 68-72

  12. The Size of the Extragalactic Source J1801-231 and the Association of Pulsar PSR B1758-23 with the Supernova Remnant W28

    Claussen, M J; Desai, K M; Brogan, C L

    2002-01-01

    We have used the NRAO Very Large Array (VLA) in conjunction with the Very Long Baseline Array (VLBA) Pie Town antenna as a real-time interferometer system to measure the size of the extragalactic source J1801-231 as a function of frequency from 1285 to 4885 MHz. These observations were made in an attempt to determine the effect interstellar scattering has on the observed sizes of OH (1720 MHz) masers in the nearby (d=2.5 kpc) supernova remnant W28. The observations clearly show that J1801-231 displays angular broadening due to turbulence in the Galaxy's interstellar medium. The minimum distance of the nearby (two arcminutes from J1801-231) pulsar PSR B1758-23 is constrained to be 9.4 +/- 2.4 kpc. This value is based on both the measured size of 220 mas for J1801-231 at 1715 MHz and the temporal broadening of the pulsar. A single thin scattering screen along the line of sight to the W28 OH(1720 MHz) masers must be at 4.7 +/- 1.2 kpc for this minimum pulsar distance. The screen may be placed closer to the Earth...

  13. Effect of 3-bromopyruvate acid on the redox equilibrium in non-invasive MCF-7 and invasive MDA-MB-231 breast cancer cells.

    Kwiatkowska, Ewa; Wojtala, Martyna; Gajewska, Agnieszka; Soszyński, Mirosław; Bartosz, Grzegorz; Sadowska-Bartosz, Izabela

    2016-02-01

    Novel approaches to cancer chemotherapy employ metabolic differences between normal and tumor cells, including the high dependence of cancer cells on glycolysis ("Warburg effect"). 3-Bromopyruvate (3-BP), inhibitor of glycolysis, belongs to anticancer drugs basing on this principle. 3-BP was tested for its capacity to kill human non-invasive MCF-7 and invasive MDA-MB-231 breast cancer cells. We found that 3-BP was more toxic for MDA-MB-231 cells than for MCF-7 cells. In both cell lines, a statistically significant decrease of ATP and glutathione was observed in a time- and 3-BP concentration-dependent manner. Transient increases in the level of reactive oxygen species and reactive oxygen species was observed, more pronounced in MCF-7 cells, followed by a decreasing tendency. Activities of glutathione peroxidase, glutathione reductase (GR) and glutathione S-transferase (GST) decreased in 3-BP treated MDA-MB-231 cells. For MCF-7 cells decreases of GR and GST activities were noted only at the highest concentration of 3-BP.These results point to induction of oxidative stress by 3-BP via depletion of antioxidants and inactivation of antioxidant enzymes, more pronounced in MDA-MB-231 cells, more sensitive to 3-BP. PMID:26715289

  14. Cross sections of the reaction Pa-231(d,3n)U-230 for the production of U-230/Th-226 for targeted alpha therapy

    Morgenstern, A.; Lebeda, Ondřej; Štursa, Jan; Capote, R.; Sin, M.; Bruchertseifer, F.; Zielinska, B.; Apostolidis, C.

    2009-01-01

    Roč. 80, č. 5 (2009), 054612/1-054612/6. ISSN 0556-2813 Institutional research plan: CEZ:AV0Z10480505 Keywords : Pa-231 * U-230 * Th-226 * reaction cross section * targeted alpha therapy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.477, year: 2009

  15. Familial microduplication of 17q23.1–q23.2 involving TBX4 is associated with congenital clubfoot and reduced penetrance in females.

    Peterson, Jess F; Ghaloul-Gonzalez, Lina; Madan-Khetarpal, Suneeta; Hartman, Jessica; Surti, Urvashi; Rajkovic, Aleksandar; Yatsenko, Svetlana A

    2014-02-01

    Congenital clubfoot is a heterogeneous disorder that can result in functional disability, deformity, and pain if left untreated. Although the etiology is considered multifactorial in the majority of cases, a 17q23.1–q23.2 duplication has been reported in families with congenital clubfoot characterized by variable expressivity and incomplete penetrance. The candidate gene within the duplicated region is TBX4, a T-box transcription factor required for normal hind limb development. We describe a familial 2.15 Mb duplication in the 17q23.1–q23.2 region identified in a mother, daughter, and two sons. The male proband was referred for genetic evaluation due to multiple congenital anomalies including bilateral clubfoot, dysplastic hips, multiple heart defects, microcephaly, midfacial hypoplasia, brain anomalies on MRI scan, seizure disorder, optic nerve hypoplasia, hearing loss, and bilateral vocal cord paralysis. Cytogenetic testing on family members identified the 17q23.1–q23.2 duplication in both older siblings and the mother. In this family both male siblings had clubfoot, while females were phenotypically normal. Although TBX4 remains the candidate gene for congenital clubfoot involving 17q23.1–q23.2 duplications, the explanation for variable expressivity and penetrance remains unknown. PMID:24592505

  16. 40 CFR 264.231 - Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27.

    2010-07-01

    ... HAZARDOUS WASTE TREATMENT, STORAGE, AND DISPOSAL FACILITIES Surface Impoundments § 264.231 Special requirements for hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27. (a) Hazardous Wastes FO20, FO21, FO22... surface impoundments managing hazardous wastes FO20, FO21, FO22, FO23, FO26, and FO27 in order to...

  17. 钢板固定治疗胫骨平台骨折231例临床疗效观察%Observation on Clinical Effect of Plate Fixation for Tibial Plateau Fracture in 231 Cases

    王春鹏

    2015-01-01

    Objective To discuss the clinical effect of different plate ifxation methods for tibial plateau fracture. Methods 231 patients with tibial plateau fracture were given plate ifxation in our hospital from 2012 to 2014. The clinical effects were made a retrospective analysis. 112 cases with unilateral locking plate ifxation was A group, 119 cases with bilateral anatomic plate ifxation was B group. The healing time of patients with fracture ifxation and their function of knee joint were compared between the two groups. Results The healing time and knee function in group A were signiifcantly better than the control group, P<0.05, there were differences. Conclusion Unilateral locking plate fixation for tibial plateau fracture can shorten the fracture healing time, make knee joint rehabilitation early and the knee functions are better.%目的:探讨不同钢板固定方式治疗胫骨平台骨折的效果。方法回顾性分析2012~2014年在我院进行胫骨平台骨折内固定治疗的患者231例,其中112例采用单侧锁定钢板内固定为A组,119例采用双侧解剖钢板内固定为B组,对比两组不同内固定方式患者的骨折愈合时间,膝关节功能。结果 A组患者的骨折愈合时间,以及膝关节功能优于对照组,P<0.05,差异有统计学意义。结论单侧锁定钢板内固定治疗胫骨平台骨折,骨折能够较早的愈合,膝关节得到较早的康复锻炼,膝关节功能较好。

  18. NuSTAR reveals an intrinsically X-ray weak broad absorption line quasar in the ultraluminous infrared galaxy Markarian 231

    Teng, Stacy H.; Rigby, J. R. [Observational Cosmology Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Brandt, W. N.; Luo, B. [Department of Astronomy and Astrophysics, 525 Davey Lab, The Pennsylvania State University, University Park, PA 16802 (United States); Harrison, F. A.; Grefenstette, B. W.; Madsen, K. K. [Cahill Center for Astronomy and Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Alexander, D. M.; Gandhi, P. [Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom); Bauer, F. E. [Departamento de Astronomía y Astrofísica, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Boggs, S. E.; Craig, W. W. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, F. E. [DTU Space, National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Comastri, A. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Fabian, A. C. [Institute of Astronomy, Madingley Road, Cambridge CB3 0HA (United Kingdom); Farrah, D. [Department of Physics, Virginia Tech, Blacksburg, VA 24061 (United States); Fiore, F. [Osservatorio Astronomico di Roma, via Frascati 33, I-00040 Monteporzio Catone (Italy); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Hickox, R. C. [Department of Physics and Astronomy, Dartmouth College, 6127 Wilder Laboratory, Hanover, NH 03755 (United States); Ptak, A. F., E-mail: stacy.h.teng@nasa.gov [X-ray Astrophysics Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); and others

    2014-04-10

    We present high-energy (3-30 keV) NuSTAR observations of the nearest quasar, the ultraluminous infrared galaxy (ULIRG) Markarian 231 (Mrk 231), supplemented with new and simultaneous low-energy (0.5-8 keV) data from Chandra. The source was detected, though at much fainter levels than previously reported, likely due to contamination in the large apertures of previous non-focusing hard X-ray telescopes. The full band (0.5-30 keV) X-ray spectrum suggests the active galactic nucleus (AGN) in Mrk 231 is absorbed by a patchy and Compton-thin (N{sub H}∼1.2{sub −0.3}{sup +0.3}×10{sup 23} cm{sup –2}) column. The intrinsic X-ray luminosity (L {sub 0.5–30} {sub keV} ∼ 1.0 × 10{sup 43} erg s{sup –1}) is extremely weak relative to the bolometric luminosity where the 2-10 keV to bolometric luminosity ratio is ∼0.03% compared to the typical values of 2%-15%. Additionally, Mrk 231 has a low X-ray-to-optical power law slope (α{sub OX} ∼ –1.7). It is a local example of a low-ionization broad absorption line quasar that is intrinsically X-ray weak. The weak ionizing continuum may explain the lack of mid-infrared [O IV], [Ne V], and [Ne VI] fine-structure emission lines which are present in sources with otherwise similar AGN properties. We argue that the intrinsic X-ray weakness may be a result of the super-Eddington accretion occurring in the nucleus of this ULIRG, and may also be naturally related to the powerful wind event seen in Mrk 231, a merger remnant escaping from its dusty cocoon.

  19. The anticancer potential of steroidal saponin, dioscin, isolated from wild yam (Dioscorea villosa) root extract in invasive human breast cancer cell line MDA-MB-231 in vitro.

    Aumsuwan, Pranapda; Khan, Shabana I; Khan, Ikhlas A; Ali, Zulfiqar; Avula, Bharathi; Walker, Larry A; Shariat-Madar, Zia; Helferich, William G; Katzenellenbogen, Benita S; Dasmahapatra, Asok K

    2016-02-01

    Previously, we observed that wild yam (Dioscorea villosa) root extract (WYRE) was able to activate GATA3 in human breast cancer cells targeting epigenome. This study aimed to find out if dioscin (DS), a bioactive compound of WYRE, can modulate GATA3 functions and cellular invasion in human breast cancer cells. MCF-7 and MDA-MB-231 cells were treated in the absence/presence of various concentrations of DS and subjected to gene analysis by RT-qPCR, immunoblotting, and immunocytochemistry. We determined the ability of MDA-MB-231 cells to migrate into wound area and examined the effects of DS on cellular invasion using invasion assay. DS reduced cell viability of both cell lines in a concentration and time-dependent manner. GATA3 expression was enhanced by DS (5.76 μM) in MDA-MB-231 cells. DS (5.76 μM)-treated MDA-MB-231 cells exhibited the morphological characteristic of epithelial-like cells; mRNA expression of DNMT3A, TET2, TET3, ZFPM2 and E-cad were increased while TET1, VIM and MMP9 were decreased. Cellular invasion of MDA-MB-231 was reduced by 65 ± 5% in the presence of 5.76 μM DS. Our data suggested that DS-mediated pathway could promote GATA3 expression at transcription and translation levels. We propose that DS has potential to be used as an anti-invasive agent in breast cancer. PMID:26682631

  20. Biodegradable Eri silk nanoparticles as a delivery vehicle for bovine lactoferrin against MDA-MB-231 and MCF-7 breast cancer cells.

    Roy, Kislay; Patel, Yogesh S; Kanwar, Rupinder K; Rajkhowa, Rangam; Wang, Xungai; Kanwar, Jagat R

    2016-01-01

    This study used the Eri silk nanoparticles (NPs) for delivering apo-bovine lactoferrin (Apo-bLf) (~2% iron saturated) and Fe-bLf (100% iron saturated) in MDA-MB-231 and MCF-7 breast cancer cell lines. Apo-bLf and Fe-bLf-loaded Eri silk NPs with sizes between 200 and 300 nm (±10 nm) showed a significant internalization within 4 hours in MDA-MB-231 cells when compared to MCF-7 cells. The ex vivo loop assay with chitosan-coated Fe-bLf-loaded silk NPs was able to substantiate its future use in oral administration and showed the maximum absorption within 24 hours by ileum. Both Apo-bLf and Fe-bLf induced increase in expression of low-density lipoprotein receptor-related protein 1 and lactoferrin receptor in epidermal growth factor (EGFR)-positive MDA-MB-231 cells, while transferrin receptor (TfR) and TfR2 in MCF-7 cells facilitated the receptor-mediated endocytosis of NPs. Controlled and sustained release of both bLf from silk NPs was shown to induce more cancer-specific cytotoxicity in MDA-MB-231 and MCF-7 cells compared to normal MCF-10A cells. Due to higher degree of internalization, the extent of cytotoxicity and apoptosis was significantly higher in MDA-MB-231 (EGFR+) cells when compared to MCF-7 (EGFR-) cells. The expression of a prominent anticancer target, survivin, was found to be downregulated at both gene and protein levels. Taken together, all the observations suggest the potential use of Eri silk NPs as a delivery vehicle for an anti-cancer milk protein, and indicate bLf for the treatment of breast cancer. PMID:26730188

  1. Antioxidant Activity and ROS-Dependent Apoptotic Effect of Scurrula ferruginea (Jack) Danser Methanol Extract in Human Breast Cancer Cell MDA-MB-231

    Marvibaigi, Mohsen; Amini, Neda; Supriyanto, Eko; Abdul Majid, Fadzilah Adibah; Kumar Jaganathan, Saravana; Jamil, Shajarahtunnur; Hamzehalipour Almaki, Javad; Nasiri, Rozita

    2016-01-01

    Scurrula ferruginea (Jack) Danser is one of the mistletoe species belonging to Loranthaceae family, which grows on the branches of many deciduous trees in tropical countries. This study evaluated the antioxidant activities of S. ferruginea extracts. The cytotoxic activity of the selected extracts, which showed potent antioxidant activities, and high phenolic and flavonoid contents, were investigated in human breast cancer cell line (MDA-MB-231) and non-cancer human skin fibroblast cells (HSF-1184). The activities and characteristics varied depending on the different parts of S. ferruginea, solvent polarity, and concentrations of extracts. The stem methanol extract showed the highest amount of both phenolic (273.51 ± 4.84 mg gallic acid/g extract) and flavonoid contents (163.41 ± 4.62 mg catechin/g extract) and strong DPPH• radical scavenging (IC50 = 27.81 μg/mL) and metal chelation activity (IC50 = 80.20 μg/mL). The stem aqueous extract showed the highest ABTS•+ scavenging ability. The stem methanol and aqueous extracts exhibited dose-dependent cytotoxic activity against MDA-MB-231 cells with IC50 of 19.27 and 50.35 μg/mL, respectively. Furthermore, the extracts inhibited the migration and colony formation of MDA-MB-231 cells in a concentration-dependent manner. Morphological observations revealed hallmark properties of apoptosis in treated cells. The methanol extract induced an increase in ROS generation and mitochondrial depolarization in MDA-MB-231 cells, suggesting its potent apoptotic activity. The present study demonstrated that the S. ferruginea methanol extract mediated MDA-MB-231 cell growth inhibition via induction of apoptosis which was confirmed by Western blot analysis. It may be a potential anticancer agent; however, its in vivo anticancer activity needs to be investigated. PMID:27410459

  2. Stimulation of angiogenesis resulting from cooperation between macrophages and MDA-MB-231 breast cancer cells: proposed molecular mechanism and effect of tetrathiomolybdate

    Infiltration by macrophages (Mφ) indicates a poor prognosis in breast cancers, in particular by inducing angiogenesis. Our study aimed 1) to investigate the mechanism by which cooperation between Mφ and aggressive breast cancer cells (MDA-MB-231) induces angiogenesis; 2) to examine the effect of tetrathiomolybdate (TM) on this angiogenic activity. Mφ coincubated with MDA-MB-231 were used as a model to mimic the inflammatory microenvironment. Angiogenesis induced by the culture media was tested in the chick chorioallantoic membrane (CAM). Mφ phenotype was evaluated by 1) expression of the M1 marker CD80, and secretion of interleukin 10 (IL-10), an M2 marker; 2) capacity to secrete Tumour Necrosis Factor α (TNFα) when stimulated by lipopolysaccharide/interferon γ (LPS/IFNγ); 3) ability to induce MDA-MB-231 apoptosis. To explore the molecular mechanisms involved, cytokine profiles of conditioned media from MDA-MB-231, Mφ and the coculture were characterised by an antibody cytokine array. All experiments were carried out both in presence and in absence of TM. Incubation of Mφ with MDA-MB-231 induced a pro-angiogenic effect in the CAM. It emerged that the angiogenic activity of the coculture is due to the capacity of Mφ to switch from M1 Mφ towards M2, probably due to an increase in Macrophage Colony Stimulating Factor. This M1-M2 switch was shown by a decreased expression of CD80 upon LPS/IFNγ stimulation, an increased secretion of IL-10, a decreased secretion of TNFα in response to LPS/IFNγ and an inability to potentiate apoptosis. At the molecular level, the angiogenic activity of the coculture medium can be explained by the secretion of CXC chemokines/ELR+ and CC chemokines. Although TM did not modify either the M2 phenotype in the coculture or the profile of the secreted chemokines, it did decrease the angiogenic activity of the coculture medium, suggesting that TM inhibited angiogenic activity by interfering with the endothelial cell signalling

  3. The Vascular-Ablative Agent VEGF121/rGel Inhibits Pulmonary Metastases of MDA-MB-231 Breast Tumors

    Sophia Ran

    2005-05-01

    Full Text Available VEGF121/rGel, a fusion protein composed of the growth factor VEGF121 and the recombinant toxin gelonin (rGel, targets the tumor neovasculature and exerts impressive cytotoxic effects by inhibiting protein synthesis. We evaluated the effect of VEGF121/rGel on the growth of metastatic MDA-MB-231 tumor cells in SCID mice. VEGF121/rGel treatment reduced surface lung tumor foci by 58% compared to controls (means were 22.4 and 53.3, respectively; P < .05 and the mean area of lung colonies by 50% (210 ± 37 m2vs 415 ± 10 m2 for VEGF121/rGel and control, respectively; P < .01. In addition, the vascularity of metastatic foci was significantly reduced: (198 ± 37 vs 388 ± 21 vessels/mm2 for treated and control, respectively. Approximately 62% of metastatic colonies from the VEGF121/rGel-treated group had fewer than 10 vessels per colony compared to 23% in the control group. The VEGF receptor Flk-1 was intensely detected on the metastatic vessels in the control but not in the VEGF121/rGel-treated group. Metastatic foci present in lungs had a three-fold lower Ki-67 labeling index compared to control tumors. Thus, the antitumor vascular-ablative effect of VEGF121/rGel may be utilized not only for treating primary tumors but also for inhibiting metastatic spread and vascularization of metastases.

  4. Metabolomic Dynamic Analysis of Hypoxia in MDA-MB-231 and the Comparison with Inferred Metabolites from Transcriptomics Data

    Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis

  5. Compact radio cores in three Seyfert galaxies - high resolution studies of Mkn 3, Mkn 231, and Mkn 463

    The small-scale morphologies of Mkn 231 and Mkn 463 have been investigated using the European VLBI Network (EVN) at 1.6 GHz and the VLA at 15 and 22 GHz. Mkn 3 has been studied using the EVN at 1.4 and 1.6 GHz. All of the galaxies have a substantial fraction of their core radio flux in linear or elongated structures, typically tens of parsecs in extent. Agreement between the parsec- and kiloparsec-scale position angles of continuum radio emission suggests collimated outflow from the galaxy centers that continues over several orders of magnitude in scale. Supernova rates of order one hundred per year on scales of tens of parsecs are required to explain the nuclear radio emission as the result of bursts of star formation. The luminosities, small extents, and linear morphologies of the radio sources all support the idea that the nuclear radio sources are energized by active galactic nuclei and therefore support the more general picture of Seyfert galaxy nuclei being low-luminosity quasars. All of the galaxies appear to have undergone violent interactions in the recent past. 55 references

  6. Quantification of Malignant Breast Cancer Cell MDA-MB-231 Transmigration Across Brain and Lung Microvascular Endothelium.

    Fan, Jie; Fu, Bingmei M

    2016-07-01

    Tumor cell extravasation through the endothelial barrier forming the microvessel wall is a crucial step during tumor metastasis. However, where, how and how fast tumor cells transmigrate through endothelial barriers remain unclear. Using an in vitro transwell model, we performed a transmigration assay of malignant breast tumor cells (MDA-MB-231) through brain and lung microvascular endothelial monolayers under control and pathological conditions. The locations and rates of tumor cell transmigration as well as the changes in the structural components (integrity) of endothelial monolayers were quantified by confocal microscopy. Endothelial monolayer permeability to albumin P (albumin) was also quantified under the same conditions. We found that about 98% of transmigration occurred at the joints of endothelial cells instead of cell bodies; tumor cell adhesion and transmigration degraded endothelial surface glycocalyx and disrupted endothelial junction proteins, consequently increased P (albumin); more tumor cells adhered to and transmigrated through the endothelial monolayer with higher P (albumin); P (albumin) and tumor transmigration were increased by vascular endothelial growth factor, a representative of cytokines, and lipopolysaccharides, a typical systemic inflammatory factor, but reduced by adenosine 3',5'-cyclic monophosphate. These results suggest that reinforcing endothelial structural integrity is an effective approach for inhibiting tumor extravasation. PMID:26603751

  7. Anti-proliferative effect of biogenic gold nanoparticles against breast cancer cell lines (MDA-MB-231 & MCF-7)

    K. S., Uma Suganya; Govindaraju, K.; Ganesh Kumar, V.; Prabhu, D.; Arulvasu, C.; Stalin Dhas, T.; Karthick, V.; Changmai, Niranjan

    2016-05-01

    Breast cancer is a major complication in women and numerous approaches are being developed to overcome this problem. In conventional treatments such as chemotherapy and radiotherapy the post side effects cause an unsuitable effect in treatment of cancer. Hence, it is essential to develop a novel strategy for the treatment of this disease. In the present investigation, a possible route for green synthesis of gold nanoparticles (AuNPs) using leaf extract of Mimosa pudica and its anticancer efficacy in the treatment of breast cancer cell lines is studied. The synthesized nanoparticles were found to be effective in killing cancer cells (MDA-MB-231 & MCF-7) which were studied using various anticancer assays (MTT assay, cell morphology determination, cell cycle analysis, comet assay, Annexin V-FITC/PI staining and DAPI staining). Cell morphological analysis showed the changes occurred in cancer cells during the treatment with AuNPs. Cell cycle analysis revealed apoptosis in G0/G1 to S phase. Similarly in Comet assay, there was an increase in tail length in treated cells in comparison with the control. Annexin V-FITC/PI staining assay showed prompt fluorescence in treated cells indicating the translocation of phosphatidylserine from the inner membrane. PI and DAPI staining showed the DNA damage in treated cells.

  8. Diagnostic Performance of Computed Tomography Colonography and Colonoscopy: A Prospective and Validated Analysis of 231 Paired Examinations

    Arnesen, R.B.; Benzon, E. von; Adamsen, S.; Svendsen, L.B.; Raaschou, H.O.; Hart Hansen, O. [Dept. of Surgery and Dept. of Radiology, Hilleroed Hospital, Hi lleroed (Denmark)

    2007-10-15

    Background: Detection of colorectal tumors with computed tomography colonography (CTC) is an alternative to conventional colonoscopy (CC), and clarification of the diagnostic performance is essential for cost-effective use of both technologies. Purpose: To evaluate the diagnostic performance of CTC compared with CC. Material and Methods: 231 consecutive CTCs were performed prior to same-day scheduled CC. The radiologist and endoscopists were blinded to each other's findings. Patients underwent a polyethylene glycol bowel preparation, and were scanned in prone and supine positions using a single-detector helical CT scanner and commercially available software for image analysis. Findings were validated (matched) in an unblinded comparison with video-recordings of the CCs and re-CCs in cases of doubt. Results: For patients with polyps 5 mm and 10 mm, the sensitivity was 69% (95% CI 58-80%) and 81% (68-94%), and the specificity was 91% (84-98%) and 98% (93-100%), respectively. For detection of polyps 5 mm and 10 mm, the sensitivity was 66% (57-75%) and 77% (65-89%). A flat, elevated low-grade carcinoma was missed by CTC. One cancer relapse was missed by CC, and a cecal cancer was missed by an incomplete CC and follow-up double-contrast barium enema. Conclusion: CC was superior to CTC and should remain first choice for the diagnosis of colorectal polyps. However, for diagnosis of lesions 10 mm, CTC and CC should be considered as complementary methods.

  9. Diagnostic Performance of Computed Tomography Colonography and Colonoscopy: A Prospective and Validated Analysis of 231 Paired Examinations

    Background: Detection of colorectal tumors with computed tomography colonography (CTC) is an alternative to conventional colonoscopy (CC), and clarification of the diagnostic performance is essential for cost-effective use of both technologies. Purpose: To evaluate the diagnostic performance of CTC compared with CC. Material and Methods: 231 consecutive CTCs were performed prior to same-day scheduled CC. The radiologist and endoscopists were blinded to each other's findings. Patients underwent a polyethylene glycol bowel preparation, and were scanned in prone and supine positions using a single-detector helical CT scanner and commercially available software for image analysis. Findings were validated (matched) in an unblinded comparison with video-recordings of the CCs and re-CCs in cases of doubt. Results: For patients with polyps 5 mm and 10 mm, the sensitivity was 69% (95% CI 58-80%) and 81% (68-94%), and the specificity was 91% (84-98%) and 98% (93-100%), respectively. For detection of polyps 5 mm and 10 mm, the sensitivity was 66% (57-75%) and 77% (65-89%). A flat, elevated low-grade carcinoma was missed by CTC. One cancer relapse was missed by CC, and a cecal cancer was missed by an incomplete CC and follow-up double-contrast barium enema. Conclusion: CC was superior to CTC and should remain first choice for the diagnosis of colorectal polyps. However, for diagnosis of lesions 10 mm, CTC and CC should be considered as complementary methods

  10. Inhibition of Hypoxia-Induced Cell Motility by p16 in MDA-MB-231 Breast Cancer Cells

    Liyuan Li, Yi Lu

    2010-01-01

    Full Text Available Our previous studies indicated that p16 suppresses breast cancer angiogenesis and metastasis, and downregulates VEGF gene expression by neutralizing the transactivation of the VEGF transcriptional factor HIF-1α. Hypoxia stimulates tumor malignant progression and induces HIF-1α. Because p16 neutralizes effect of HIF-1α and attenuates tumor metastatic progression, we intended to investigate whether p16 directly affects one or more aspects of the malignant process such as adhesion and migration of breast cancer cells. To approach this aim, MDA-MB-231 and other breast cancer cells stably transfected with Tet-on inducible p16 were used to study the p16 effect on growth, adhesion and migration of the cancer cells. We found that p16 inhibits breast cancer cell proliferation and migration, but has no apparent effect on cell adhesion. Importantly, p16 inhibits hypoxia-induced cell migration in breast cancer in parallel with its inhibition of HIF-1α transactivation activity. This study suggests that p16's ability to suppress tumor metastasis may be partially resulted from p16's inhibition on cell migration, in addition to its known functions on inhibition of cell proliferation, angiogenesis and induction of apoptosis.

  11. Fluvastatin mediated breast cancer cell death: a proteomic approach to identify differentially regulated proteins in MDA-MB-231 cells.

    Anantha Koteswararao Kanugula

    Full Text Available Statins are increasingly being recognized as anti-cancer agents against various cancers including breast cancer. To understand the molecular pathways targeted by fluvastatin and its differential sensitivity against metastatic breast cancer cells, we analyzed protein alterations in MDA-MB-231 cells treated with fluvastatin using 2-DE in combination with LC-MS/MS. Results revealed dys-regulation of 39 protein spots corresponding to 35 different proteins. To determine the relevance of altered protein profiles with breast cancer cell death, we mapped these proteins to major pathways involved in the regulation of cell-to-cell signaling and interaction, cell cycle, Rho GDI and proteasomal pathways using IPA analysis. Highly interconnected sub networks showed that vimentin and ERK1/2 proteins play a central role in controlling the expression of altered proteins. Fluvastatin treatment caused proteolysis of vimentin, a marker of epithelial to mesenchymal transition. This effect of fluvastatin was reversed in the presence of mevalonate, a downstream product of HMG-CoA and caspase-3 inhibitor. Interestingly, fluvastatin neither caused an appreciable cell death nor did modulate vimentin expression in normal mammary epithelial cells. In conclusion, fluvastatin alters levels of cytoskeletal proteins, primarily targeting vimentin through increased caspase-3- mediated proteolysis, thereby suggesting a role for vimentin in statin-induced breast cancer cell death.

  12. Metabolomic Dynamic Analysis of Hypoxia in MDA-MB-231 and the Comparison with Inferred Metabolites from Transcriptomics Data

    Yufeng Jane Tseng

    2013-05-01

    Full Text Available Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis.

  13. Metabolomic Dynamic Analysis of Hypoxia in MDA-MB-231 and the Comparison with Inferred Metabolites from Transcriptomics Data

    Tsai, I-Lin [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Kuo, Tien-Chueh [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Graduate Institute of Biomedical Electronic and Bioinformatics, National Taiwan University, Room 410 BL Building, No. 1, Roosevelt Road, Sec. 4, Taipei 106, Taiwan (China); Ho, Tsung-Jung [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Harn, Yeu-Chern [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Graduate Institute of Networking and Multimedia, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Wang, San-Yuan [The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China); Fu, Wen-Mei [Department of Pharmacology, National Taiwan University, 11 F No. 1 Sec. 1, Ren-ai Rd., Taipei 10051, Taiwan (China); Kuo, Ching-Hua, E-mail: kuoch@ntu.edu.tw [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Tseng, Yufeng Jane, E-mail: kuoch@ntu.edu.tw [Department of Pharmacy, National Taiwan University, No. 1, Jen-Ai Road, Section 1 Taipei 10051, Taiwan (China); The Metabolomics Group, National Taiwan University, Taipei 106, Taiwan (China); Center for Genomic Medicine, National Taiwan University, Taipei 10051, Taiwan (China); Graduate Institute of Biomedical Electronic and Bioinformatics, National Taiwan University, Room 410 BL Building, No. 1, Roosevelt Road, Sec. 4, Taipei 106, Taiwan (China); Department of Computer Science and Information Engineering, National Taiwan University, No. 1, Sec. 4, Roosevelt Rd., Taipei 10617, Taiwan (China)

    2013-05-03

    Hypoxia affects the tumor microenvironment and is considered important to metastasis progression and therapy resistance. Thus far, the majority of global analyses of tumor hypoxia responses have been limited to just a single omics level. Combining multiple omics data can broaden our understanding of tumor hypoxia. Here, we investigate the temporal change of the metabolite composition with gene expression data from literature to provide a more comprehensive insight into the system level in response to hypoxia. Nuclear magnetic resonance spectroscopy was used to perform metabolomic profiling on the MDA-MB-231 breast cancer cell line under hypoxic conditions. Multivariate statistical analysis revealed that the metabolic difference between hypoxia and normoxia was similar over 24 h, but became distinct over 48 h. Time dependent microarray data from the same cell line in the literature displayed different gene expressions under hypoxic and normoxic conditions mostly at 12 h or earlier. The direct metabolomic profiles show a large overlap with theoretical metabolic profiles deduced from previous transcriptomic studies. Consistent pathways are glycolysis/gluconeogenesis, pyruvate, purine and arginine and proline metabolism. Ten metabolic pathways revealed by metabolomics were not covered by the downstream of the known transcriptomic profiles, suggesting new metabolic phenotypes. These results confirm previous transcriptomics understanding and expand the knowledge from existing models on correlation and co-regulation between transcriptomic and metabolomics profiles, which demonstrates the power of integrated omics analysis.

  14. Survey and analysis on microbiaI contamination of 231 instant foods%231份即食食品中微生物污染状况调查分析

    李卫东; 刘晓娟; 郑秀清; 赵丽萍; 李伟昊

    2012-01-01

    目的 了解邯郸市即食食品中微生物污染状况,提高我市食源性疾病检测、预警和控制能力,为食物中毒监测提供科学依据,以保障我市居民饮食安全.方法 依据GB4789 - 2010和《2011年河北省食源性疾病监测技术指南》对我市的熟肉制品、即食非发酵豆制品、中式凉拌菜、鲜榨果汁、夹心饼干和盒饭6类即食食品进行微生物学检测.检测项目:卫生学指标(菌落总数、大肠菌群)和6种致病菌(沙门氏菌、金黄色葡萄球菌、O157:H7/NM、单核细胞增生李斯特氏菌、志贺氏菌、腊样芽孢杆菌).结果 231份样品中合格72份,合格率为31.17%,其中夹心饼干类合格率最高为93.33%;其他类别的样品的合格率均较低,即食非发酵豆制品的合格率低至13.33%.结论 我市即食食品卫生状况极差,部分食品还检出食源性致病菌,存在细菌性食物中毒的隐患,有关部门应加大监管力度,以保障居民的食品安全.%Objective To understand the microbial contamination of instant food in Handan City, improve the detection, warning and control abilities of foodborne diseases in our city, and provide scientific basis for food poisoning mornitoring so as to safeguard food safety of residents. Method Conduct microbial detection for the 6 kinds of instant food, namely, cooked meat products, instant non - fermented bean products, Chinese cold dishes, freshly squeezed juice, sandwich biscuits, and box lunch, in accordance with GB4789 -2010 and Monitoring Technical Guideline on Foodborne Diseases in Hebei Province in 2011. The detection items included hygienics indexes (total number of bacterial colony and coliform colony) and 6 kinds of pathogens ( salmonella, staphyloccus aureus, 0157; H7/NM, listeria monocytogens, shigella and bacilus cereus) . Results Among the 231 samples, 72 were qualified, and the qualified rate was 31. 17%. The sandwich biscuits had the highest qualified rate (93. 33% ); and

  15. PI3K/Akt/mTOR activation by suppression of ELK3 mediates chemosensitivity of MDA-MB-231 cells to doxorubicin by inhibiting autophagy.

    Park, Ji-Hoon; Kim, Keun Pil; Ko, Jeong-Jae; Park, Kyung-Soon

    2016-08-19

    Drug resistance in breast cancer remains a major obstacle of clinical therapy. We found that suppression of ELK3 in the triple negative breast cancer cell line MDA-MB-231 impaired autophagy and led to a hypersensitive response to doxorubicin treatment. In ELK3-knockdown MDA-MB-231 cells (ELK3 KD), autophagy was not activated under starvation conditions, which is a major stimulus of autophagy activation. We revealed that activation of the PI3K/Akt pathway was the main cause of impaired autophagy in ELK3 KD. Our results suggest that targeting ELK3 may be a potential approach to overcome doxorubicin resistance in breast cancer therapeutics. PMID:27301639

  16. NuSTAR reveals an intrinsically x-ray weak broad absorption line quasar in the ultraluminous infrared galaxy Markarian 231

    Teng, Stacy H.; Brandt, W. N.; Harrison, F. A.;

    2014-01-01

    -ionization broad absorption line quasar that is intrinsically X-ray weak. The weak ionizing continuum may explain the lack of mid-infrared [O IV], [Ne V], and [Ne VI] fine-structure emission lines which are present in sources with otherwise similar AGN properties. We argue that the intrinsic X-ray weakness may be......We present high-energy (3-30 keV) NuSTAR observations of the nearest quasar, the ultraluminous infrared galaxy (ULIRG) Markarian 231 (Mrk 231), supplemented with new and simultaneous low-energy (0.5-8 keV) data from Chandra. The source was detected, though at much fainter levels than previously...

  17. A comparative study of protein patterns of human estrogen receptor positive (MCF-7) and negative (MDA-MB-231) breast cancer cell lines.

    Flodrova, Dana; Toporova, Lucia; Macejova, Dana; Lastovickova, Marketa; Brtko, Julius; Bobalova, Janette

    2016-07-01

    In the present study, we analyzed the cell lysates of human tumour cell lines representing two major clinically different types of breast cancer. Our main goal was to show the differences between them on proteomic level. Gel electrophoresis followed by MALDI-TOF MS analysis was used for proteins determination. Exactly 98 proteins were unequivocally identified and 60 of them were expressed differentially between MDA-MB-231 and MCF-7 cell lines. Among the proteins reported here, some well-known breast cancer markers (e.g., annexin A1, annexin A2 and vimentin) were identified in the MDA-MB-231 cell line and thus we were able to distinguish both cell lines sufficiently. PMID:27174898

  18. Effects of exosomes derived from MDA-MB-231 on proliferation of endothelial cells and the role of MAPK/ERK and PI3K/Akt pathways

    Shuang LONG

    2012-11-01

    Full Text Available Objective  To investigate the effects of exosomes derived from breast cancer cell line MDA-MB-231 on proliferation of human umbilical cord vein endothelial cells (HUVECs, and evaluate the role of MAPK/ERK and PI3K/Akt signal transduction pathway during the process. Methods  Exosomes were derived and purified from MDA-MB-231 by cryogenic ultracentrifugation and density gradient centrifugation. MTT assay was carried out for measurement of cell proliferation in HUVECs with exosome of 50, 100, 200 and 400μg/ml. The states of cell cycle of HUVECs co-cultured with 200μg/ml exosomes were detected by flow cytometry. The effects of 200μg/ml exosomes on the expression of ERK, Akt and phosphorylated ERK, Akt in HUVECs were detected with Western blotting. Results  Exosomes derived from MDA-MB-231 significantly promoted HUVECs proliferation in a classical time-and dose-dependent manner. Flow cytometry revealed that, co-cultured with 200μg/ml exosomes for 24h, S-phase cells in HUVECs increased, while G1/S phase cells in HUVECs decreased. Western blotting showed that, cocultured with 200μg/ml exosomes for 24h, 48h and 72h, the expressions of phosphorylated ERK and Akt were up-regulated in a time-dependent manner. Conclusion  Exosomes derived from breast cancer cell line MDA-MB-231 may promote HUVECs proliferation, the changes in cell cycle and the continuous activation of the MAPK/ERK and PI3K/Akt signal transduction pathways may be the underlying mechanism.

  19. Evaluation and Comparison of the In Vitro Cytotoxic Activity of Withania somnifera Methanolic and Ethanolic Extracts against MDA-MB-231 and Vero Cell Lines

    Srivastava, A. N.; Ahmad, Rumana; Khan, Mohsin Ali

    2015-01-01

    Withania somnifera Dunal (WS), commonly known as Ashwagandha in India, belongs to the family Solanaceae. It is extensively used in most of the Indian herbal pharmaceuticals and nutraceuticals. In the current study, the in vitro cytotoxic activity of methanolic, ethanolic, and aqueous extracts of WS stems was evaluated using cytometry and the MTT assay against the MDA-MB-231 human breast cancer cell line. Methanolic and ethanolic extracts of WS showed potent anticancer activity on the MDA-MB-2...

  20. ESTRATÉGIAS DE RESPONSABILIDADE SOCIAL CORPORATIVA: UM ESTUDO SOBRE OS 231 CASOS CONCRETOS DO INSTITUTO ETHOS [doi: 10.5329/RECADM.20060501004

    Franciara Maria de Oliveira

    2006-01-01

    ResumoUm perfil das estratégias de Responsabilidade Social Corporativa adotadas por empresas no Brasil é o objetivoprincipal deste trabalho. Utilizou-se como universo de estudo os 231 Casos Concretos preenchidosespontaneamente pelas empresas filiadas na página web do Instituto Ethos de Empresa e ResponsabilidadeSocial (Instituto Ethos). Os casos foram analisados pelo software alemão de análise de dados qualitativosdenominado Atlas.ti 5.0, sob o enfoque metod...

  1. β-sitosterol induces G1 arrest and causes depolarization of mitochondrial membrane potential in breast carcinoma MDA-MB-231 cells

    Vundru, Shanthi Sri; Kale, Raosaheb K.; Singh, Rana P.

    2013-01-01

    Backgrounds It is suggested that dietary phytosterols, such as β-sitosterol (ST), have cancer chemopreventive effects; however, studies are limited to support such claims. Here, we evaluated the efficacy of ST on three different human cancer cell lines including skin epidermoid carcinoma A431 cells, lung epithelial carcinoma A549 cells and breast adenocarcinoma MDA-MB-231. Methods Cell growth assay, cell cycle analysis, FACS, JC-1 staining, annexin V staining and immunoblotting were used to s...

  2. Combined xanthorrhizol-curcumin exhibits synergistic growth inhibitory activity via apoptosis induction in human breast cancer cells MDA-MB-231

    Azimahtol Hawariah

    2009-01-01

    Full Text Available Abstract Background It has been suggested that combined effect of natural products may improve the treatment effectiveness in combating proliferation of cancer cells. The present study was undertaken to evaluate the possibility that the combination of xanthorrhizol and curcumin might show synergistic growth inhibitory effect towards MDA-MB-231 human breast cancer cells via apoptosis induction. The effective dose that produced 50% growth inhibition (GI50 was calculated from the log dose-response curve of fixed-combinations of xanthorrhizol and curcumin generated from the sulforhodamine B (SRB assay. The experimental GI50 value was used to determine the synergistic activity of the combination treatment by isobolographic analysis and combination-index method. Further investigation of mode of cell death induced by the combination treatment was conducted in the present study. Results Isobole analysis revealed that substances interaction was synergistic when xanthorrhizol and curcumin were added concurrently to the cultures but merely additive when they were added sequentially. The synergistic combination treatment was then applied to the cultures to investigate the mode of cell death induced by the treatment. Immunofluorescence staining using antibody MitoCapture™ revealed the possibility of altered mitochondrial transmembrane potential, which is one of the hallmark of apoptosis. Hoechst 33258 nuclear staining assay showed the rate of apoptosis of MDA-MB-231 cells to increase in response to the treatment. Apoptotic cell death was further confirmed by DNA fragmentation assay, where internucleosomal excision of DNA was induced upon treatment with xanthorrhizol-curcumin. Conclusion This is the first time the combined cytotoxic effect of xanthorrhizol and curcumin on MDA-MB-231 cells has been documented and our findings provide experimental support to the hypothesis that combined xanthorrhizol-curcumin showed synergistic growth inhibitory activity on

  3. Inhibition of MMP-3 activity and invasion of the MDA-MB-231 human invasive breast carcinoma cell line by bioflavonoids

    Kanokkarn PHROMNOI; Supachai YODKEEREE; Songyot ANUCHAPREEDA; Pornngarm LIMTRAKUL

    2009-01-01

    Aim: Stromelysin 1 (matrix metalloproteinase 3; MMP-3) is an enzyme known to be involved in tumor invasion and metastasis. In this study, flavonoids from vegetables and fruits, such as quercetin, kaempferol, genistein, genistin, and daidzein, were tested for their abil-ity to modulate the secretion and activity of MMP-3 in the MDA-MB-231 breast cancer cell line. In addition, we investigated the in vitro effects of flavonoids on MDA-MB-231 cell invasion.Methods: The toxic concentration range of flavonoids was evaluated using the MTr assay. The ability of MDA-MB-231 cells to invade was evaluated using a modified Boyden chamber system. The activity of MMP-3 was determined by casein zymography. The secretion of MMP-3 was evaluated using Western blotting, casein zymography and confirmed by ELISA.Results: Some putative flavonoids, ie, quercetin and kaempferol (flavonols), significantly inhibited the in vitro invasion of MDA-MB-231cells in a concentration-dependent manner, with IC50 values of 27 and 30 pmol/L, respectively. Quercetin and kaempferol also reduced MMP-3 activity in a dose-dependent manner, with IC50 values in the range of 30 μmol/L and 45 μmol/L, respectively. None of the flavonoids had a significant effect on the secretion of MMP-3.Conclusion: These data show that the flavonols quercetin and kaempferol have higher anti-invasion potency and higher MMP-3 inhibi-tory activity than isoflavones genistein, genistin and daidzein. In contrast, neither flavonols nor isofiavones have any effect on MMP-3 secretion.

  4. A Breast Cell Atlas: Organelle analysis of the MDA-MB-231 cell line by density-gradient fractionation using isotopic marking and label-free analysis

    Marianne Sandin

    2015-09-01

    Full Text Available Protein translocation between organelles in the cell is an important process that regulates many cellular functions. However, organelles can rarely be isolated to purity so several methods have been developed to analyse the fractions obtained by density gradient centrifugation. We present an analysis of the distribution of proteins amongst organelles in the human breast cell line, MDA-MB-231 using two approaches: an isotopic labelling and a label-free approach.

  5. Phenotypic and Molecular Convergence of 2q23.1 Deletion Syndrome with Other Neurodevelopmental Syndromes Associated with Autism Spectrum Disorder

    Sureni V. Mullegama

    2015-04-01

    Full Text Available Roughly 20% of autism spectrum disorders (ASD are syndromic with a well-established genetic cause. Studying the genes involved can provide insight into the molecular and cellular mechanisms of ASD. 2q23.1 deletion syndrome (causative gene, MBD5 is a recently identified genetic neurodevelopmental disorder associated with ASD. Mutations in MBD5 have been found in ASD cohorts. In this study, we provide a phenotypic update on the prevalent features of 2q23.1 deletion syndrome, which include severe intellectual disability, seizures, significant speech impairment, sleep disturbance, and autistic-like behavioral problems. Next, we examined the phenotypic, molecular, and network/pathway relationships between nine neurodevelopmental disorders associated with ASD: 2q23.1 deletion Rett, Angelman, Pitt-Hopkins, 2q23.1 duplication, 5q14.3 deletion, Kleefstra, Kabuki make-up, and Smith-Magenis syndromes. We show phenotypic overlaps consisting of intellectual disability, speech delay, seizures, sleep disturbance, hypotonia, and autistic-like behaviors. Molecularly, MBD5 possibly regulates the expression of UBE3A, TCF4, MEF2C, EHMT1 and RAI1. Network analysis reveals that there could be indirect protein interactions, further implicating function for these genes in common pathways. Further, we show that when MBD5 and RAI1 are haploinsufficient, they perturb several common pathways that are linked to neuronal and behavioral development. These findings support further investigations into the molecular and pathway relationships among genes linked to neurodevelopmental disorders and ASD, which will hopefully lead to common points of regulation that may be targeted toward therapeutic intervention.

  6. G-231A and G+70C polymorphisms of endothelin receptor type-A gene could affect the psoriasis area and severity index score and endothelin 1 levels

    Gökhan Okan

    2015-01-01

    Full Text Available Background: The etiopathogenesis of psoriasis has not been clearly elucidated although the role of chronic inflammation, imbalance between pro- and anti-inflammatory cytokines, and many immunological events have been established. Endothelin 1 (EDN1 and endothelin receptor type-A (EDNRA are implicated in the inflammatory process. The relationships between EDN1 and EDNRA polymorphisms with several diseases have been found. Aims and Objectives: This study examined the possible association of EDN1 (G5665T and T-1370G and EDNRA (G-231A and G + 70C single nucleotide polymorphisms (SNPs with the occurence of psoriasis, and evaluated the relationship between genotypes and clinical/laboratory manifestation of psoriasis. Materials and Methods: We analyzed genotype and allele distributions of the above-mentioned polymorphisms in 151 patients with psoriasis and 152 healthy controls by real-time PCR combined with melting curve analysis. Results: We did not find significant differences in the genotype and allele distributions of EDN1 T-1370G, EDNRA G-231A, and EDNRA G+70C polymorphisms between patients with psoriasis and healthy controls. Psoriasis area and severity index (PASI score of EDNRA -231 polymorphic A allele carrying subjects (AA and AA + AG was higher than that of wild homozygotes (P = 0.044 and P = 0.027, respectively. In addition, EDN1 levels in EDNRA+70 polymorphic C allele carriers (CC + CG were elevated when compared with GG genotype; however, the difference was at borderline significance (P = 0.05. Conclusion: Although there were no associations between studied polymorphisms and psoriasis susceptibility, the PASI score and EDN1 levels seem to be affected by EDNRA G-231A and G + 70C polymorphisms.

  7. Altered Localization of Retinoid X Receptor α Coincides with Loss of Retinoid Responsiveness in Human Breast Cancer MDA-MB-231 Cells

    Tanaka, T; Dancheck, B. L.; Trifiletti, L. C.; Birnkrant, R. E.; Taylor, B J; Garfield, S. H.; Thorgeirsson, U; De Luca, L M

    2004-01-01

    To understand the mechanism of retinoid resistance, we studied the subcellular localization and function of retinoid receptors in human breast cancer cell lines. Retinoid X receptor α (RXRα) localized throughout the nucleoplasm in retinoid-sensitive normal human mammary epithelial cells and in retinoid-responsive breast cancer cell line (MCF-7), whereas it was found in the splicing factor compartment (SFC) of the retinoid-resistant MDA-MB-231 breast cancer cell line and in human breast carcin...

  8. Melatonin Suppresses the Expression of 45S Preribosomal RNA and Upstream Binding Factor and Enhances the Antitumor Activity of Puromycin in MDA-MB-231 Breast Cancer Cells

    Ji Hoon Jung; Eun Jung Sohn; Eun Ah Shin; Duckgue Lee; Bonglee Kim; Deok-Beom Jung; Ji-Hyun Kim; Miyong Yun; Hyo-Jeong Lee; Yong Koo Park; Sung-Hoon Kim

    2013-01-01

    Since the dysregulation of ribosome biogenesis is closely associated with tumor progression, in the current study, the critical role of ribosome biogenesis related signaling was investigated in melatonin and/or puromycin induced apoptosis in MDA-MB-231 breast cancer cells. Despite its weak cytotoxicity, melatonin from 3 mM attenuated the expression of 45S pre-ribosomal RNA (pre-rRNA), UBF as a nucleolar transcription factor, and fibrillarin at mRNA level and consistently downregulated nucleol...

  9. Induction of G1-phase cell cycle arrest and apoptosis pathway in MDA-MB-231 human breast cancer cells by sulfated polysaccharide extracted from Laurencia papillosa

    Murad, Hossam; Hawat, Mohammad; Ekhtiar, Adnan; ALJAPAWE, ABDULMUNIM; Abbas, Assef; Darwish, Hussein; Sbenati, Oula; Ghannam, Ahmed

    2016-01-01

    Background Marine algae consumption is linked to law cancer incidences in countries that traditionally consume marine products. Hence, Phytochemicals are considered as potential chemo-preventive and chemotherapeutic agents against cancer. We investigated the effects of the algal sulfated polysaccharide extract (ASPE) from the red marine alga L. papillosa on MDA-MB-231 human breast cancer cell line. Methods Flow cytometry analysis was performed to study the cell viability, cell cycle arrest an...

  10. In vitro evaluation of Pandanus amaryllifolius ethanol extract for induction of cell death on non-hormone dependent human breast adenocarcinoma MDA-MB-231 cell via apoptosis

    Chong Hueh; Yeap Swee; Rahmat Asmah; Akim Abdah; Alitheen Noorjahan; Othman Fauziah; Gwendoline-Ee Cheng

    2012-01-01

    Abstract Background Our previous study had shown that P. amaryllifolius was able to selectively inhibit cell proliferation of hormone independent breast cancer cell line MDA-MB-231. To understand the mode of killing and mechanism of action for P. amaryllifolius, the ethanol extract was evaluated for their alteration of cell cycle progression, PS externalization, DNA fragmentation and expression of anti/pro-apoptotic related protein. Results Cell cycle progression analysis, Annexin V and Tunel...