WorldWideScience

Sample records for zymomonas mobilis structural

  1. Biochemical and genetic improvement of Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Ingram, L O; Carey, V C; Dombek, K M; Holt, A S; Holt, W A; Osman, Y A; Walia, S K

    1984-01-01

    Zymomonas mobilis offers many advantages for alcohol production including three- to five-fold higher rates of substrate conversion. Current progress and approaches are discussed for the biochemical and genetic improvement of this organism. These include the isolation of salt-resistant mutants and low pH-tolerant mutants. Gene banks of Lactobacillus heterohiochi are being screened for genes encoding alcohol resistance which can be subsequently introduced into Zymomonas mobilis. In addition, an enteric lactose operon has been inserted into Zymomonas mobilis and is expressed. These new strains are being further modified to increase the substrate range of Zymomonas mobilis to include lactose. This lactose operon serves as a model system to investigate the expression of foreign genes in Zymomonas mobilis. 25 references.

  2. Ethanologenic Enzymes of Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Ingram, Lonnie O' Neal

    1999-03-01

    Zymomonas mobilis is a unique microorganism in being both obligately fermentative and utilizing a Entner-Doudoroff pathway for glycolysis. Glycolytic flux in this organism is readily measured as evolved carbon dioxide, ethanol, or glucose consumed and exceeds 1 {micro}mole glucose/min per mg cell protein. To support this rapid glycolysis, approximately 50% of cytoplasmic protein is devoted to the 13 glycolytic and fermentative enzymes which constitute this central catabolic pathway. Only 1 ATP (net) is produced from each glucose metabolized. During the past grant period, we have completed the characterization of 11 of the 13 glycolytic genes from Z. mobilis together with complementary but separate DOE-fimded research by a former post-dot and collaborator, Dr. Tyrrell Conway. Research funded in my lab by DOE, Division of Energy Biosciences can be divided into three sections: A. Fundamental studies; B. Applied studies and utility; and C. Miscellaneous investigations.

  3. Crystal structure of cbbF from Zymomonas mobilis and its functional implication

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Hyo-Jeong; Park, Suk-Youl; Kim, Jeong-Sun, E-mail: jsunkim@chonnam.ac.kr

    2014-02-28

    Highlights: • The crystal structure of one cbbF from Zymomonas mobilis was revealed. • Scores of residues form two secondary structures with a non-polar protruded residue. • It exists as a dimeric form in solution. - Abstract: A phosphate group at the C1-atom of inositol-monophosphate (IMP) and fructose-1,6-bisphosphate (FBP) is hydrolyzed by a phosphatase IMPase and FBPase in a metal-dependent way, respectively. The two enzymes are almost indiscernible from each other because of their highly similar sequences and structures. Metal ions are bound to residues on the β1- and β2-strands and one mobile loop. However, FBP has another phosphate and FBPases exist as a higher oligomeric state, which may discriminate FBPases from IMPases. There are three genes annotated as FBPases in Zymomonas mobilis, termed also cbbF (ZmcbbF). The revealed crystal structure of one ZmcbbF shows a globular structure formed by five stacked layers. Twenty-five residues in the middle of the sequence form an α-helix and a β-strand, which occupy one side of the catalytic site. A non-polar Leu residue among them is protruded to the active site, pointing out unfavorable access of a bulky charged group to this side. In vitro assays have shown its dimeric form in solution. Interestingly, two β-strands of β1 and β2 are disordered in the ZmcbbF structure. These data indicate that ZmcbbF might structurally belong to IMPase, and imply that its active site would be reorganized in a yet unreported way.

  4. Formation of ethanol from lactose by Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Goodman, A E; Strzelecki, A T; Rogers, P L

    1984-01-01

    The lactose transposon Tn951 on the IncP plasmid RP1, was introduced into a strain of Zymomonas mobilis. The lac Z gene was expressed and US -galactosidase was produced. The synthesis of US -galactosidase was induced by either isopropyl-US -D-thiogalactopyranoside or lactose, and was not sensitive to catabolite repression. Cells of Zymomonas mobilis containing Tn951 were unable to form colonies on lactose plates, but in liquid medium produced ethanol from lactose as the sole carbon source. The original strain of Zymomonas mobilis without Tn951 produced little or no US -galactosidase and was unable to produce ethanol from lactose in liquid medium.

  5. Zymomonas mobilis: a bacterium for ethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Baratti, J.C.; Bu' Lock, J.D.

    1986-01-01

    Zymomonas mobilis is a facultative anaerobic gram negative bacterium first isolated in tropical countries from alcoholic beverages like the African palm wine, the Mexican pulque and also as a contaminant of cider (cider sickness) or beer in the European countries. It is one of the few facultative anaerobic bacteria degrading glucose by the Entner-Doudoroff pathway usually found in strictly aerobic microorganisms. Some work was devoted to this bacterium in the 50s and 60s and was reviewed by Swings and De Ley in their classical paper published in 1977. During the 70s there was very little work on the bacterium until 1979 and the first report by the Australian group of P.L. Rogers on the great potentialities of Z. mobilis for ethanol production. At that time the petroleum crisis had led the developed countries to search for alternative fuel from renewable resources. The Australian group clearly demonstrated the advantages of the bacterium compared to the yeasts traditionally used for the alcoholic fermentation. As a result, there was a considerable burst in the Zymomonas literature which started from nearly zero in the late 70s to attain 70 papers published in the field in 1984. In this article, papers published from 1982 to 1986 are reviewed.

  6. Optimization of levan production by Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    V. K Ananthalakshmy

    1999-01-01

    Full Text Available Effect of different fermentation conditions on levan production by Zymomonas mobilis B-4286 was studied. Levan production increased from 5.7-g/l to 12.6-g/l with an increase in initial sucrose concentration (50-150 g/l. Above 15% (20 and 25% sucrose concentration, there was no increase in the biomass. The sucrose hydrolysis and levan production occurred even in the absence of significant growth of cells. Maximum amount of levan was produced (14.5 g/l at pH 5 and 15 g /l at 25(0C temperature. At temperature between 35(0C and 40(0C, levan production was not detected. Presence of glucose in the medium considerably reduced levan production (2.8 g/l than fructose 6.7g/l.O efeito de diferentes condições de fermentação na produção de levan por Zymomonas mobilis B-4286 foi estudado. A produção de Levan aumentou de 5.7-g/l a 12.6-g/l com o aumento da concentração inicial de sacarose (50-150 g/l. Acima de 15%, 20 e 25% a concentração de sacarose, não propiciou nenhum acréscimo na formação de biomassa. A hidrólise da sacarose e produção de Levan ocorreram de forma normal na ausência de um crescimento celular significativo. A concentração máxima de levan produzida foi (14.5 g/l em pH 5, 15 g /l a 25(0 C. Na temperatura entre 35(0C e 40(0 C, não ocorreu a produção de levan. A presença de glicose no meio de cultivo reduziu consideravelmente a produção média de levan (2.8 g/l bem como a de frutose (6.7g/l..

  7. Modelling of the metabolism of Zymomonas mobilis growing on a defined medium

    Energy Technology Data Exchange (ETDEWEB)

    Posten, C

    1989-08-07

    A structured model of Zymomonas mobilis is presented using fermentation data of a defined aspartate medium. After some remarks on the structure of the metabolism the model is derived by considering sub-models, e.g. balance equations, and by identifying the unknown parameters separately for each sub-model. Some results are the elemental composition of Zymomonas mobilis, a description of the substrate uptake during substrate limitation and the growth inhibition during substrate saturation. The results are shown as simulation and are discussed in relation to the inhibitory effect of ethanol on the bacterial cell. (orig.).

  8. Modelling of the metabolism of Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Posten, C; Thoma, M

    1986-01-01

    In order to optimize fermentations with respect to media, reactor configuration, and control a structured model of the metabolism of Zymononas mobilis has been developed. The model is based on structure of metabolism, rate limiting steps, energy balance and metabolic elemental balances. A three-fold effect of ethanol has been observed concerning substrate-turnover, ammonia uptake and energy consumption. In addition to the metabolic view a structured cell-membrane-model should be considered.

  9. Structure of the Zymomonas mobilis respiratory chain: oxygen affinity of electron transport and the role of cytochrome c peroxidase.

    Science.gov (United States)

    Balodite, Elina; Strazdina, Inese; Galinina, Nina; McLean, Samantha; Rutkis, Reinis; Poole, Robert K; Kalnenieks, Uldis

    2014-09-01

    The genome of the ethanol-producing bacterium Zymomonas mobilis encodes a bd-type terminal oxidase, cytochrome bc1 complex and several c-type cytochromes, yet lacks sequences homologous to any of the known bacterial cytochrome c oxidase genes. Recently, it was suggested that a putative respiratory cytochrome c peroxidase, receiving electrons from the cytochrome bc1 complex via cytochrome c552, might function as a peroxidase and/or an alternative oxidase. The present study was designed to test this hypothesis, by construction of a cytochrome c peroxidase mutant (Zm6-perC), and comparison of its properties with those of a mutant defective in the cytochrome b subunit of the bc1 complex (Zm6-cytB). Disruption of the cytochrome c peroxidase gene (ZZ60192) caused a decrease of the membrane NADH peroxidase activity, impaired the resistance of growing culture to exogenous hydrogen peroxide and hampered aerobic growth. However, this mutation did not affect the activity or oxygen affinity of the respiratory chain, or the kinetics of cytochrome d reduction. Furthermore, the peroxide resistance and membrane NADH peroxidase activity of strain Zm6-cytB had not decreased, but both the oxygen affinity of electron transport and the kinetics of cytochrome d reduction were affected. It is therefore concluded that the cytochrome c peroxidase does not terminate the cytochrome bc1 branch of Z. mobilis, and that it is functioning as a quinol peroxidase. © 2014 The Authors.

  10. Zymomonas mobilis for fuel ethanol and higher value products.

    Science.gov (United States)

    Rogers, P L; Jeon, Y J; Lee, K J; Lawford, H G

    2007-01-01

    High oil prices, increasing focus on renewable carbohydrate-based feedstocks for fuels and chemicals, and the recent publication of its genome sequence, have provided continuing stimulus for studies on Zymomonas mobilis. However, despite its apparent advantages of higher yields and faster specific rates when compared to yeasts, no commercial scale fermentations currently exist which use Z. mobilis for the manufacture of fuel ethanol. This may change with the recent announcement of a Dupont/Broin partnership to develop a process for conversion of lignocellulosic residues, such as corn stover, to fuel ethanol using recombinant strains of Z. mobilis. The research leading to the construction of these strains, and their fermentation characteristics, are described in the present review. The review also addresses opportunities offered by Z. mobilis for higher value products through its metabolic engineering and use of specific high activity enzymes.

  11. Ethanol production from soybean molasses by Zymomonas mobilis

    International Nuclear Information System (INIS)

    Letti, Luiz Alberto Junior; Karp, Susan Grace; Woiciechowski, Adenise Lorenci; Soccol, Carlos Ricardo

    2012-01-01

    This work deals with the utilization of soybean molasses (a low cost byproduct) to produce ethanol, an important biofuel, using the microorganism Zymomonas mobilis NRRL 806, a gram negative bacterium. At the first part of the work, laboratorial scale tests, using 125 mL flasks were performed to evaluate the effect of three variables on ethanol production: soybean molasses concentration (the sole carbon and nitrogen source), pH and period of previous aerobial phase. The optimal soybean concentration was around 200 g L -1 of soluble solids, pH between 6.0 and 7.0, and the period of previous aerobial phase did not provide significant effect. At the second part, kinetic tests were performed to compare the fermentation yields of Zymomonas mobilis NRRL 806 in flasks and in a bench scale batch reactor (it was obtained respectively 78.3% and 96.0% of the maximum theoretical yields, with productions of 24.2 and 29.3 g L -1 of ethanol). The process with a reactor fermentation using Saccharomyces cerevisiae LPB1 was also tested (it was reached 89.3% of the theoretical maximum value). A detailed kinetic behavior of the molasses sugars metabolism for Z. mobilis was also shown, either in reactor or in flasks. This work is a valuable tool for further works in the subject of ethanol production from agro-industrial by-products. -- Highlights: ► Zymomonas mobilis was able to grow and produce ethanol on diluted soybean molasses. ► Best conditions for ethanol production:200g L -1 of soluble solids; pH around 6,5. ► Z. mobilis had better ethanol production and yield when compared to S. cerevisiae. ► In reactor, Z. mobilis produced 29.3 g L -1 of ethanol, 96.0% of the maximum yield.

  12. Single zymomonas mobilis strain for xylose and arabinose fermentation

    Science.gov (United States)

    Zhang, Min; Chou, Yat-Chen; Picataggio, Stephen K.; Finkelstein, Mark

    1998-01-01

    This invention relates to single microorganisms which normally do not ferment pentose sugars which are genetically altered to ferment the pentose sugars, xylose and arabinose, to produce ethanol, and a fermentation process utilizing the same. Examples include Zymomonas mobilis which has been transformed with a combination of E. coli genes for xylose isomerase, xylulokinase, L-arabinose isomerase, L-ribulokinase, L-ribulose 5-phosphate 4-epimerase, transaldolase and transketolase. Expression of added genes are under the control of Z. mobilis promoters. These newly created microorganisms are useful for fermenting glucose, xylose and arabinose, produced by hydrolysis of hemicellulose and cellulose or starch, to produce ethanol.

  13. Transcriptome profiling of Zymomonas mobilis under furfural stress.

    Science.gov (United States)

    He, Ming-xiong; Wu, Bo; Shui, Zong-xia; Hu, Qi-chun; Wang, Wen-guo; Tan, Fu-rong; Tang, Xiao-yu; Zhu, Qi-li; Pan, Ke; Li, Qing; Su, Xiao-hong

    2012-07-01

    Furfural from lignocellulosic hydrolysates is the prevalent inhibitor to microorganisms during cellulosic ethanol production, but the molecular mechanisms of tolerance to this inhibitor in Zymomonas mobilis are still unclear. In this study, genome-wide transcriptional responses to furfural were investigated in Z. mobilis using microarray analysis. We found that 433 genes were differentially expressed in response to furfural. Furfural up- or down-regulated genes related to cell wall/membrane biogenesis, metabolism, and transcription. However, furfural has a subtle negative effect on Entner-Doudoroff pathway mRNAs. Our results revealed that furfural had effects on multiple aspects of cellular metabolism at the transcriptional level and that membrane might play important roles in response to furfural. This research has provided insights into the molecular response to furfural in Z. mobilis, and it will be helpful to construct more furfural-resistant strains for cellulosic ethanol production.

  14. Advances and prospects in metabolic engineering of Zymomonas mobilis.

    Science.gov (United States)

    Wang, Xia; He, Qiaoning; Yang, Yongfu; Wang, Jingwen; Haning, Katie; Hu, Yun; Wu, Bo; He, Mingxiong; Zhang, Yaoping; Bao, Jie; Contreras, Lydia M; Yang, Shihui

    2018-04-05

    Biorefinery of biomass-based biofuels and biochemicals by microorganisms is a competitive alternative of traditional petroleum refineries. Zymomonas mobilis is a natural ethanologen with many desirable characteristics, which makes it an ideal industrial microbial biocatalyst for commercial production of desirable bioproducts through metabolic engineering. In this review, we summarize the metabolic engineering progress achieved in Z. mobilis to expand its substrate and product ranges as well as to enhance its robustness against stressful conditions such as inhibitory compounds within the lignocellulosic hydrolysates and slurries. We also discuss a few metabolic engineering strategies that can be applied in Z. mobilis to further develop it as a robust workhorse for economic lignocellulosic bioproducts. In addition, we briefly review the progress of metabolic engineering in Z. mobilis related to the classical synthetic biology cycle of "Design-Build-Test-Learn", as well as the progress and potential to develop Z. mobilis as a model chassis for biorefinery practices in the synthetic biology era. Copyright © 2018 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  15. Zymomonas mobilis: a novel platform for future biorefineries.

    Science.gov (United States)

    He, Ming Xiong; Wu, Bo; Qin, Han; Ruan, Zhi Yong; Tan, Fu Rong; Wang, Jing Li; Shui, Zong Xia; Dai, Li Chun; Zhu, Qi Li; Pan, Ke; Tang, Xiao Yu; Wang, Wen Guo; Hu, Qi Chun

    2014-01-01

    Biosynthesis of liquid fuels and biomass-based building block chemicals from microorganisms have been regarded as a competitive alternative route to traditional. Zymomonas mobilis possesses a number of desirable characteristics for its special Entner-Doudoroff pathway, which makes it an ideal platform for both metabolic engineering and commercial-scale production of desirable bio-products as the same as Escherichia coli and Saccharomyces cerevisiae based on consideration of future biomass biorefinery. Z. mobilis has been studied extensively on both fundamental and applied level, which will provide a basis for industrial biotechnology in the future. Furthermore, metabolic engineering of Z. mobilis for enhancing bio-ethanol production from biomass resources has been significantly promoted by different methods (i.e. mutagenesis, adaptive laboratory evolution, specific gene knock-out, and metabolic engineering). In addition, the feasibility of representative metabolites, i.e. sorbitol, bionic acid, levan, succinic acid, isobutanol, and isobutanol produced by Z. mobilis and the strategies for strain improvements are also discussed or highlighted in this paper. Moreover, this review will present some guidelines for future developments in the bio-based chemical production using Z. mobilis as a novel industrial platform for future biofineries.

  16. Optimization of asparaginase production from Zymomonas mobilis by continuous fermentation

    Directory of Open Access Journals (Sweden)

    Francieli Bortoluzzi Menegat

    2016-10-01

    Full Text Available Asparaginase is an enzyme used in clinical treatments as a chemotherapeutic agent and in food technology to prevent acrylamide formation in fried and baked foods. Asparaginase is industrially produced by microorganisms, mainly gram-negative bacteria. Zymomonas mobilis is a Gram-negative bacterium that utilizes glucose, fructose and sucrose as carbon source and has been known for its efficiency in producing ethanol, sorbitol, levan, gluconic acid and has recently aroused interest for asparaginase production. Current assay optimizes the production of Z. mobilis asparaginase by continuous fermentation using response surface experimental design and methodology. The studied variables comprised sucrose, yeast extract and asparagine. Optimized condition obtained 117.45 IU L-1 with dilution rate 0.20 h-1, yeast extract 0.5 g L-1, sucrose 20 g L-1 and asparagine 1.3 g L-1. Moreover, carbon:nitrogen ratio (1:0.025 strongly affected the response of asparaginase activity. The use of Z. mobilis by continuous fermentation has proved to be a promising alternative for the biotechnological production of asparaginase.

  17. Transcriptome profiling of Zymomonas mobilis under ethanol stress

    Directory of Open Access Journals (Sweden)

    He Ming-xiong

    2012-10-01

    Full Text Available Abstract Background High tolerance to ethanol is a desirable characteristics for ethanologenic strains used in industrial ethanol fermentation. A deeper understanding of the molecular mechanisms underlying ethanologenic strains tolerance of ethanol stress may guide the design of rational strategies to increase process performance in industrial alcoholic production. Many extensive studies have been performed in Saccharomyces cerevisiae and Escherichia coli. However, the physiological basis and genetic mechanisms involved in ethanol tolerance for Zymomonas mobilis are poorly understood on genomic level. To identify the genes required for tolerance to ethanol, microarray technology was used to investigate the transcriptome profiling of the ethanologenic Z. mobilis in response to ethanol stress. Results We successfully identified 127 genes which were differentially expressed in response to ethanol. Ethanol up- or down-regulated genes related to cell wall/membrane biogenesis, metabolism, and transcription. These genes were classified as being involved in a wide range of cellular processes including carbohydrate metabolism, cell wall/membrane biogenesis, respiratory chain, terpenoid biosynthesis, DNA replication, DNA recombination, DNA repair, transport, transcriptional regulation, some universal stress response, etc. Conclusion In this study, genome-wide transcriptional responses to ethanol were investigated for the first time in Z. mobilis using microarray analysis.Our results revealed that ethanol had effects on multiple aspects of cellular metabolism at the transcriptional level and that membrane might play important roles in response to ethanol. Although the molecular mechanism involved in tolerance and adaptation of ethanologenic strains to ethanol is still unclear, this research has provided insights into molecular response to ethanol in Z. mobilis. These data will also be helpful to construct more ethanol resistant strains for cellulosic

  18. Ethanol production with a flocculating mutant of Zymomonas mobilis and immobilized glycoside hydrolases. Ethanolgewinnung mit einer flockenden Mutante von Zymomonas mobilis und immobilisierten Glycosidhydrolasen

    Energy Technology Data Exchange (ETDEWEB)

    Tramm-Werner, S.

    1987-05-25

    A method to extend the substrate spectrum of Z. mobilis was developed. Higher ethanol yields were achieved by simultaneous use of hydrolases cross-linked with glutar aldehyde together with the flocculating Zymomonas cells (TW 602). Apart from the high product yields, the method is characterized by low susceptibility to infections.

  19. Xylose utilizing zymomonas mobilis with improved ethanol production in biomass hydrolysate medium

    Science.gov (United States)

    Caimi, Perry G; Hitz, William D; Stieglitz, Barry; Viitanen, Paul V

    2013-07-02

    Xylose-utilizing, ethanol producing strains of Zymomonas mobilis with improved performance in medium comprising biomass hydrolysate were isolated using an adaptation process. Independently isolated strains were found to have independent mutations in the same coding region. Mutation in this coding may be engineered to confer the improved phenotype.

  20. Three new shuttle vectors for heterologous expression in Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    Qinghua Cao

    2016-01-01

    Conclusions: These results indicated that these expression vectors are useful tools for gene expression in Z. mobilis and this could provide a solid foundation for further studies of heterologous gene expression in Z. mobilis.

  1. OPTIMASI FERMENTASI BAGAS TEBU OLEH Zymomonas mobilis CP4 (NRRL B-14023 UNTUK PRODUKSI BIOETANOL (Optimization of Sugarcane Bagasse Fermentation by Zymomonas mobilis CP4 (NRRL B-14023 for Bioethanol Production

    Directory of Open Access Journals (Sweden)

    Atmiral Ernes

    2014-10-01

    (v/v. Berdasarkan hasil penelitian, kadar etanol optimal diperoleh sebesar 1,213% (v/v, yang menunjukkan hasil yang tidak berbeda jauh dengan prediksi model. Yield etanol yang diperoleh sebesar 0,479 dengan efi siensi fermentasi 93,9%. Hasil penelitian ini membuktikan bahwa strain bakteri Zymomonas mobilis CP4 memiliki potensi yang cukup menjanjikan sebagai mikroba penghasil etanol. Kata kunci: Bioetanol, bagas tebu, Zymomonas mobilis CP4, optimasi fermentasi

  2. Ethanol Production from Kitchen Garbage Using Zymomonas mobilis: Optimization of Parameters through Statistical Experimental Designs

    OpenAIRE

    Ma, H.; Wang, Q.; Gong, L.; Wang, X.; Yin, W.

    2008-01-01

    Plackett-Burman design was employed to screen 8 parameters for ethanol production from kitchen garbage by Zymomonas mobilis in simultaneous saccharification and fermentation. The parameters were divided into two parts, four kinds of enzymes and supplementation nutrients. The result indicated that the nutrient inside kitchen garbage could meet the requirement of ethanol production without supplementation, only protease and glucoamylase were needed to accelerate the ethanol production. The opti...

  3. Construction of an Unmarked Zymomonas mobilis Mutant Using a Site-Specific FLP Recombinase

    Directory of Open Access Journals (Sweden)

    Shao-Lan Zou

    2012-01-01

    Full Text Available Flippase expression was carried out in Zymomonas mobilis strain ZM4. The FRT-flanked selection marker gene was first integrated into the ZM4 chromosome by homologous recombination. The Saccharomyces cerevisiae flp gene was then introduced under the control of the ZM4 gap gene promoter (Pgap, encoding glyceraldehyde-3-phosphate dehydrogenase or the λ bacteriophage cI857-pR contained in the broad-host-range cloning vector pBBR1-MCS-2. This study demonstrated that flp was expressed and that the deletion frequency of the FRT-flanked marker gene was very high (approx. 100 %. In addition, the flp gene expression vector could be conveniently removed from the resulting unmarked Z. mobilis mutants by serially transferring the cells three times into antibiotic-free medium, thereby establishing an efficient method for constructing unmarked Z. mobilis mutants.

  4. Ethanol fermentation by immobilized cells of Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Grote, W.

    1985-01-01

    Previous studies have shown that immobilized yeast cell cultures have commercial potential for fuel ethanol production. In this study the suitability of strains of Z. mobilis for whole cell immobilization was investigated. Experiments revealed that immobilization in Ca-alginate or K-carrageenan gel or use of flocculating strains was effective for ethanol production at relatively high productivities. Two laboratory size reactors were designed and constructed. These were a compartmented multiple discshaft column and a tower fermentor. Results of this work supported other studies that established that growth and fermentation could be uncoupled. The data indicated that specific metabolic rates were dependent on the nature of the fermentation media. The addition of lactobacilli to Z. mobilis continuous fermentations had only a transient effect, and was unlikely to affect an immobilized Z. mobilis process. With 150 gl/sup -1/ glucose media and a Z. mobilis ZM4 immobilized cell reactor, a maximum volumetric ethanol productivity of 55 gl/sup -1/h/sup -1/ was obtained. The fermentation of sucrose media or sucrose-based raw materials (molasses, cane juice, synthetic mill liquor) by immobilized Z. mobilis ZM4 revealed a pattern of rapid sucrose hydrolysis, preferential glucose utilization and the conversion of fructose to the undesirable by-products levan and sorbitol.

  5. N2 gas is an effective fertilizer for bioethanol production by Zymomonas mobilis

    Science.gov (United States)

    Kremer, Timothy A.; LaSarre, Breah; Posto, Amanda L.; McKinlay, James B.

    2015-01-01

    A nascent cellulosic ethanol industry is struggling to become cost-competitive against corn ethanol and gasoline. Millions of dollars are spent on nitrogen supplements to make up for the low nitrogen content of the cellulosic feedstock. Here we show for the first time to our knowledge that the ethanol-producing bacterium, Zymomonas mobilis, can use N2 gas in lieu of traditional nitrogen supplements. Despite being an electron-intensive process, N2 fixation by Z. mobilis did not divert electrons away from ethanol production, as the ethanol yield was greater than 97% of the theoretical maximum. In a defined medium, Z. mobilis produced ethanol 50% faster per cell and generated half the unwanted biomass when supplied N2 instead of ammonium. In a cellulosic feedstock-derived medium, Z. mobilis achieved a similar cell density and a slightly higher ethanol yield when supplied N2 instead of the industrial nitrogen supplement, corn steep liquor. We estimate that N2-utilizing Z. mobilis could save a cellulosic ethanol production facility more than $1 million/y. PMID:25646422

  6. Synthesis of sorbitol by Zymomonas mobilis under high osmotic pressure Síntese de sorbitol por Zymomonas mobilis sob elevada pressão osmótica

    Directory of Open Access Journals (Sweden)

    Márcio de Barros

    2006-09-01

    Full Text Available The bacterium Zymomonas mobilis presents potential for sorbitol production when grown in culture medium with high sugar concentration. Sorbitol is produced and accumulated in the periplasma of the bacterium to protect the cells from the harmful effects of high osmotic pressure that results from the action of invertase on sucrose. The conversion of sucrose into glucose and fructose increases the osmolarity of the medium. However, an excessive increase in the osmotic pressure may decrease the sorbitol production. In this work Saccharomyces cerevisiae invertase was added two media containing sucrose 200 and 300 g.L-1. Sorbitol production in sucrose at 200 g.L-1 was 42.35 and 38.42 g.L-1, with and without the invertase treatment, respectively. In the culture medium with 300 g.L-1 sucrose, production reached 60.4 g.L-1 and with invertase treatment was 19.14 g.L-1. These results indicated that the excessive rise in osmotic pressure led to a significant decrease in sorbitol production by the Zymomonas mobilis bacterium in the sucrose medium treated with invertase.A bactéria Zymomonas mobilis, apresenta potencial para produção de sorbitol quando crescida em meio com alta concentração de açúcar. O sorbitol produzido é acumulado no periplasma da bactéria para conter os efeitos prejudiciais da elevada pressão osmótica, que resulta pela ação da enzima invertase, que promove hidrólise da sacarose. A conversão da sacarose em glicose e frutose aumentando a osmolaridade do meio. Entretanto, um aumento excessivo na pressão osmótica pode inibir a produção de sorbitol pela bactéria. Este trabalho empregou invertase de Saccharomyces cerevisiae nos meios de fermentação com sacarose a 200 e 300 g.L-1. A produção de sorbitol no meio com sacarose a 200 g.L-1 foi de 42,35 g.L-1 e 38,42 g.L-1 com e sem tratamento com invertase respectivamente. No meio com 300 g.L-1 sem tratamento, a produção foi de 60,42 e com tratamento 19,14 g.L-1. Estes

  7. Mechanism of ethanol inhibition of fermentation in Zymomonas mobilis CP4

    International Nuclear Information System (INIS)

    Osman, Y.A.; Ingram, L.O.

    1985-01-01

    Accumulation of alcohol during fermentation is accompanied by a progressive decrease in the rate of sugar conversion to ethanol. In this study, the authors provided evidence that inhibition of fermentation by ethanol can be attributed to an indirect effect of ethanol on the enzymes of glycolysis involving the plasma membrane. Ethanol decreased the effectiveness of the plasma membrane as a semipermeable barrier, allowing leakage of essential cofactors and coenzymes. This leakage of cofactors and coenzymes, coupled with possible additional leakage of intermediary metabolites en route to ethanol formation, is sufficient to explain the inhibitory effects of ethanol on fermentation in Zymomonas mobilis

  8. STATE ESTIMATION IN ALCOHOLIC CONTINUOUS FERMENTATION OF ZYMOMONAS MOBILIS USING RECURSIVE BAYESIAN FILTERING: A SIMULATION APPROACH

    Directory of Open Access Journals (Sweden)

    Olga Lucia Quintero

    2008-05-01

    Full Text Available This work presents a state estimator for a continuous bioprocess. To this aim, the Non Linear Filtering theory based on the recursive application of Bayes rule and Monte Carlo techniques is used. Recursive Bayesian Filters Sampling Importance Resampling (SIR is employed, including different kinds of resampling. Generally, bio-processes have strong non-linear and non-Gaussian characteristics, and this tool becomes attractive. The estimator behavior and performance are illustrated with the continuous process of alcoholic fermentation of Zymomonas mobilis. Not too many applications with this tool have been reported in the biotechnological area.

  9. Modeling of Zymomonas mobilis central metabolism for novel metabolic engineering strategies.

    Science.gov (United States)

    Kalnenieks, Uldis; Pentjuss, Agris; Rutkis, Reinis; Stalidzans, Egils; Fell, David A

    2014-01-01

    Mathematical modeling of metabolism is essential for rational metabolic engineering. The present work focuses on several types of modeling approach to quantitative understanding of central metabolic network and energetics in the bioethanol-producing bacterium Zymomonas mobilis. Combined use of Flux Balance, Elementary Flux Mode, and thermodynamic analysis of its central metabolism, together with dynamic modeling of the core catabolic pathways, can help to design novel substrate and product pathways by systematically analyzing the solution space for metabolic engineering, and yields insights into the function of metabolic network, hardly achievable without applying modeling tools.

  10. Bioethanol Production from Iles-Iles (Amorphopallus campanulatus Flour by Fermentation using Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    Kusmiyati Kusmiyati

    2016-02-01

    Full Text Available Due to the depletion of fossil oil sources, Indonesia attempts to search new source of bioenergy including bioethanol. One of this sources is Iles-iles tubers (Amorphophallus campanulatus, which is abundantly available in Java Indonesia. The carbohydrate content in Iles-Iles tuber flour was 77% and it can be converted to ethanol by three consecutive steps methods consist of liquefaction-saccharification using α and β-amylase, respectively and then followed by fermentation by using Z. mobilis. The objective of this research was to convert the Iles-iles flour to bioethanol by fermentation process with Z.mobilis. The ethanol production process was studied at various starch concentration 15-30% g/L, Z. mobilis concentration (10-40% and pH fermentation of (4-6. The result showed that the yield of bioethanol (10.33% was the highest at 25% starch concentration and 25% of Z.mobilis concentration. The optimum conditions was found at 4.5, 30°C, 10%, 120 h for pH, temperature, Z. mobilis concentration and fermentation time, respectively  at which  ACT tuber flour produced a maximum ethanol of 10.33 % v/v.Article History: Received November 12nd 2015; Received in revised form January 25th 2016; Accepted January 29th 2016; Available online How to Cite This Article: Kusmiyati , Hadiyanto,H  and Kusumadewi, I (2016. Bioethanol Production from Iles-Iles (Amorphopallus campanulatus Flour by Fermentation using Zymomonas mobilis. Int. Journal of Renewable Energy Development, 9(1, 9-14 http://dx.doi.org/10.14710/ijred.5.1.9-14 

  11. Using the CRISPR/Cas9 system to eliminate native plasmids of Zymomonas mobilis ZM4.

    Science.gov (United States)

    Cao, Qing-Hua; Shao, Huan-Huan; Qiu, Hui; Li, Tao; Zhang, Yi-Zheng; Tan, Xue-Mei

    2017-03-01

    The CRISPR/Cas system can be used to simply and efficiently edit the genomes of various species, including animals, plants, and microbes. Zymomonas mobilis ZM4 is a highly efficient, ethanol-producing bacterium that contains five native plasmids. Here, we constructed the pSUZM2a-Cas9 plasmid and a single-guide RNA expression plasmid. The pSUZM2a-Cas9 plasmid was used to express the Cas9 gene cloned from Streptococcus pyogenes CICC 10464. The single-guide RNA expression plasmid pUC-T7sgRNA, with a T7 promoter, can be used for the in vitro synthesis of single-guide RNAs. This system was successfully employed to knockout the upp gene of Escherichia coli and the replicase genes of native Z. mobilis plasmids. This is the first study to apply the CRISPR/Cas9 system of S. pyogenes to eliminate native plasmids in Z. mobilis. It provides a new method for plasmid curing and paves the way for the genomic engineering of Z. mobilis.

  12. Pre-treatment step with Leuconostoc mesenteroides or L. pseudomesenteroides strains removes furfural from Zymomonas mobilis ethanolic fermentation broth

    Science.gov (United States)

    Furfural (furan-2-carboxaldehyde), formed during dilute acid hydrolysis of biomass, is an inhibitor of growth and ethanol production by Zymomonas mobilis. The present study used a biological pre-treatment to reduce that amount of furfural in a model biofuel fermentation broth. The pre-treatment in...

  13. Continuous ethanol production from sugar beet molasses using an osmotolerant mutant strain of zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Park, S.C.; Baratti, J.C. (Univ. de Provence, Marseille (France). Centre National de la Recherche Scientifique)

    1992-01-25

    In conventional alcohol fermentation processes using yeast species, the substrate cost represents a major fraction of the total production cost. Therefore, it may be very attractive to use the bacterium Zymomonas mobilis, since it has shown higher ethanol yields than yeasts when grown on a glucose-based medium. A report is made on the use of mutant strain of Zymomonas mobilis for ethanol production from hydrolyzed sugar beet molasses in a two-stage continuous culture which showed high ethanol yield and an ethanol concentration sufficiently high for economical recovery. A single stage continuous culture was first operated in an attempt to reduce the formation of sorbitol. Further on, a second fermentor was added with additional substrate feeding to increase the effluent ethanol concentration. An ethanol concentration of 59.9g/l was obtained at 97% sugar conversion and at high ethanol yield. The volumetric ethanol productivity was superior to that of batch fermentation but inferior to that of a single-stage continuous system with the same medium. However, the ethanol concentration was increased to a level acceptable for economical recovery. 18 refs., 3 figs., 5 tabs.

  14. Effect of initial pH in levan production by Zymomonas mobilis immobilized in sodium alginate

    Directory of Open Access Journals (Sweden)

    Vidiany Aparecida Queiroz Santos

    2014-04-01

    Full Text Available Zymomonas mobilis was immobilized using a cell suspension fixed to 8.6 x 107 CFU mL-1 by spectrophotometry. This biomass was suspended in sodium alginate solution (3% that was dropped with a hypodermic syringe into 0.2 M calcium chloride solution. Was test two initial pH of fermentation medium (4 and 5 and different sucrose concentrations 15, 20, 25, 30 and 35% at 30˚C, without stirring for 24, 48, 72 and 96 hours. The levan production to pH 4 was high in sucrose 25% for 24 (16.51 g L-1 and 48 (15.31 g L-1 hours. The best values obtained to pH 5 was in sucrose 35% during 48 (22.39 g L-1 and 96 (23.5 g L-1 hours, respectively. The maximum levan yield was 40.8% and 22.47% in sucrose 15% to pH 4 and 5, respectively. Substrate consumption to pH 4 was bigger in sucrose 15 (56.4% and 20% (59.4% and to pH 5 was in 25 (68.85% and 35% (64.64%. In relation to immobilization efficiency, Zymomonas mobilis showed high adhesion and colonization in support, indicated by cell growth increased from 107 to 109 CFU mL-1 during fermentation time.

  15. The Zymomonas mobilis regulator hfq contributes to tolerance against multiple lignocellulosic pretreatment inhibitors

    Directory of Open Access Journals (Sweden)

    Lu Tse-Yuan S

    2010-05-01

    Full Text Available Abstract Background Zymomonas mobilis produces near theoretical yields of ethanol and recombinant strains are candidate industrial microorganisms. To date, few studies have examined its responses to various stresses at the gene level. Hfq is a conserved bacterial member of the Sm-like family of RNA-binding proteins, coordinating a broad array of responses including multiple stress responses. In a previous study, we observed Z. mobilis ZM4 gene ZMO0347 showed higher expression under anaerobic, stationary phase compared to that of aerobic, stationary conditions. Results We generated a Z. mobilis hfq insertion mutant AcRIM0347 in an acetate tolerant strain (AcR background and investigated its role in model lignocellulosic pretreatment inhibitors including acetate, vanillin, furfural and hydroxymethylfurfural (HMF. Saccharomyces cerevisiae Lsm protein (Hfq homologue mutants and Lsm protein overexpression strains were also assayed for their inhibitor phenotypes. Our results indicated that all the pretreatment inhibitors tested in this study had a detrimental effect on both Z. mobilis and S. cerevisiae, and vanillin had the most inhibitory effect followed by furfural and then HMF for both Z. mobilis and S. cerevisiae. AcRIM0347 was more sensitive than the parental strain to the inhibitors and had an increased lag phase duration and/or slower growth depending upon the conditions. The hfq mutation in AcRIM0347 was complemented partially by trans-acting hfq gene expression. We also assayed growth phenotypes for S. cerevisiae Lsm protein mutant and overexpression phenotypes. Lsm1, 6, and 7 mutants showed reduced tolerance to acetate and other pretreatment inhibitors. S. cerevisiae Lsm protein overexpression strains showed increased acetate and HMF resistance as compared to the wild-type, while the overexpression strains showed greater inhibition under vanillin stress conditions. Conclusions We have shown the utility of the pKNOCK suicide plasmid for

  16. Quantifying the metabolic capabilities of engineered Zymomonas mobilis using linear programming analysis

    Directory of Open Access Journals (Sweden)

    Tsantili Ivi C

    2007-03-01

    Full Text Available Abstract Background The need for discovery of alternative, renewable, environmentally friendly energy sources and the development of cost-efficient, "clean" methods for their conversion into higher fuels becomes imperative. Ethanol, whose significance as fuel has dramatically increased in the last decade, can be produced from hexoses and pentoses through microbial fermentation. Importantly, plant biomass, if appropriately and effectively decomposed, is a potential inexpensive and highly renewable source of the hexose and pentose mixture. Recently, the engineered (to also catabolize pentoses anaerobic bacterium Zymomonas mobilis has been widely discussed among the most promising microorganisms for the microbial production of ethanol fuel. However, Z. mobilis genome having been fully sequenced in 2005, there is still a small number of published studies of its in vivo physiology and limited use of the metabolic engineering experimental and computational toolboxes to understand its metabolic pathway interconnectivity and regulation towards the optimization of its hexose and pentose fermentation into ethanol. Results In this paper, we reconstructed the metabolic network of the engineered Z. mobilis to a level that it could be modelled using the metabolic engineering methodologies. We then used linear programming (LP analysis and identified the Z. mobilis metabolic boundaries with respect to various biological objectives, these boundaries being determined only by Z. mobilis network's stoichiometric connectivity. This study revealed the essential for bacterial growth reactions and elucidated the association between the metabolic pathways, especially regarding main product and byproduct formation. More specifically, the study indicated that ethanol and biomass production depend directly on anaerobic respiration stoichiometry and activity. Thus, enhanced understanding and improved means for analyzing anaerobic respiration and redox potential in vivo are

  17. Inhibition of Xanthomonas citri subsp. citri, causal agent of citrus canker, by a strain of Zymomonas mobilis mobilis isolated from sugarcane

    OpenAIRE

    Romero, María E.; Ramallo, C. Jacqueline; Ploper, L. Daniel

    2008-01-01

    Zymomonas mobilis mobilis (Zm) produce factores antimicrobianos que actúan sobre un amplio espectro de microorganismos patógenos para el hombre, animales y plantas. Un problema importante a resolver en los tratamientos con antimicrobianos, es el desarrollo de resistencia a compuestos empleados actualmente, no siendo las bacterias fitopatógenas una excepción. En el presente trabajo se realizaron ensayos de antagonismo con células (pruebas de estrías cruzadas) y sobrenadantes concentrados (Sc) ...

  18. Recombinant L-Asparaginase from Zymomonas mobilis: A Potential New Antileukemic Agent Produced in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Karen Einsfeldt

    Full Text Available L-asparaginase is an enzyme used as a chemotherapeutic agent, mainly for treating acute lymphoblastic leukemia. In this study, the gene of L-asparaginase from Zymomonas mobilis was cloned in pET vectors, fused to a histidine tag, and had its codons optimized. The L-asparaginase was expressed extracellularly and intracellularly (cytoplasmically in Escherichia coli in far larger quantities than obtained from the microorganism of origin, and sufficient for initial cytotoxicity tests on leukemic cells. The in silico analysis of the protein from Z. mobilis indicated the presence of a signal peptide in the sequence, as well as high identity to other sequences of L-asparaginases with antileukemic activity. The protein was expressed in a bioreactor with a complex culture medium, yielding 0.13 IU/mL extracellular L-asparaginase and 3.6 IU/mL intracellular L-asparaginase after 4 h of induction with IPTG. The cytotoxicity results suggest that recombinant L-asparaginase from Z. mobilis expressed extracellularly in E.coli has a cytotoxic and cytostatic effect on leukemic cells.

  19. Fermentasi Etanol Sari Buah Semu Jambu Mete (Anacardium occidentale L. oleh Zymomonas mobilis dengan Penambahan Urea

    Directory of Open Access Journals (Sweden)

    RATNA SETYANINGSIH

    2006-11-01

    Full Text Available Cashew present in abundant amount in Indonesia but they had not muchbeen exploited. This research was to study ethanol fermentation from cashew juice by Zymomonas mobilis using urea as nitrogen source. The aims of this research was to know the best urea concentration and optimum fermentation duration to produce the highest content of ethanol in ethanol fermentation from cashew juice by Z. mobilis. The urea concentration in media was prepared 0%; 0.2% and 0.4%. The media cashew juice + urea (100 mL was inoculated with 1 mL Z. mobilis 2x108 cell/mL. Initial pH, reducing sugar, amount of microorganism and concentration of ethanol was calculated everyday during 3 days. It could be concluded that 0.2% of urea produced the highest content of ethanol that was an amount 40.51%, followed by urea 0% was 30.59% and urea 0.4% was 25.63%. The optimum fermentation duration to produce the highest content of ethanol was 2 days.

  20. Adaptive laboratory evolution of ethanologenic Zymomonas mobilis strain tolerant to furfural and acetic acid inhibitors.

    Science.gov (United States)

    Shui, Zong-Xia; Qin, Han; Wu, Bo; Ruan, Zhi-yong; Wang, Lu-shang; Tan, Fu-Rong; Wang, Jing-Li; Tang, Xiao-Yu; Dai, Li-Chun; Hu, Guo-Quan; He, Ming-Xiong

    2015-07-01

    Furfural and acetic acid from lignocellulosic hydrolysates are the prevalent inhibitors to Zymomonas mobilis during cellulosic ethanol production. Developing a strain tolerant to furfural or acetic acid inhibitors is difficul by using rational engineering strategies due to poor understanding of their underlying molecular mechanisms. In this study, strategy of adaptive laboratory evolution (ALE) was used for development of a furfural and acetic acid-tolerant strain. After three round evolution, four evolved mutants (ZMA7-2, ZMA7-3, ZMF3-2, and ZMF3-3) that showed higher growth capacity were successfully obtained via ALE method. Based on the results of profiling of cell growth, glucose utilization, ethanol yield, and activity of key enzymes, two desired strains, ZMA7-2 and ZMF3-3, were achieved, which showed higher tolerance under 7 g/l acetic acid and 3 g/l furfural stress condition. Especially, it is the first report of Z. mobilis strain that could tolerate higher furfural. The best strain, Z. mobilis ZMF3-3, has showed 94.84% theoretical ethanol yield under 3-g/l furfural stress condition, and the theoretical ethanol yield of ZM4 is only 9.89%. Our study also demonstrated that ALE method might also be used as a powerful metabolic engineering tool for metabolic engineering in Z. mobilis. Furthermore, the two best strains could be used as novel host for further metabolic engineering in cellulosic ethanol or future biorefinery. Importantly, the two strains may also be used as novel-tolerant model organisms for the genetic mechanism on the "omics" level, which will provide some useful information for inverse metabolic engineering.

  1. Fructose production by Zymomonas mobilis in fed-batch culture with minimal sorbitol formation

    Energy Technology Data Exchange (ETDEWEB)

    Edye, L A; Johns, M R; Ewings, K N

    1989-08-01

    Fed-batch cultures of Zymomonas mobilis (UQM 2864), a mutant unable to metabolise fructose, grown on diluted sugar cane syrup (200 g/l sucrose) achieved yields of 90.5 g/l fructose and 48.3 g/l ethanol with minimal sorbitol formation and complete utilization of the substrate. The effect of inoculum size on sorbitol formation in the batch stage of fed-batch fermentation are reported. Fermentation of sucrose (350 g/l) supplemented with nutrients yielded 142 g/l fructose and 76.5 g/l ethanol. Some fructose product loss at high fructose concentrations was observed. The fed-batch fermentation process offers a method for obtaining high concentrations of fructose and ethanol from sucrose materials. (orig.).

  2. Ethanol production from molasses by immobilized cells of zymomonas mobilis EMCC 1546

    International Nuclear Information System (INIS)

    Meliegy, S.A.; Abdelaziz, A.H.

    2004-01-01

    Ethanol production from beet molasses by zymomonas mobilis EMCC 1546 was studied using continuous processes in which immobilized bacterial cells of Z.mobilis EMCC 1546 was grown on both sodium alginate and polyvinyl alcohol(PVA). The fermentation was performed in a shaking incubation and 1-liter ferment or with final working 750 ml. The initial sugar concentration studied was 50, 100,150, 200 and 250 g/l. The results showed that optimum initial sugar for ethanol production was 200 g/l. In batch fermentation, the highest ethanol concentration was 28.50 g/. Also effect of gamma irradiation was studied to enhance ethanol production. The highest ethanol production at dose dose 0.25 kGy was 34.82 g/l. The results showed that continuous fermentation, at dilution rate 1.36 (I/h), helped to increase the ethanol production significantly and continuous fermentation with immobilized cells in alginate gave higher ethanol production, 35.8 (g/I), as compared with those immobilized in hydrogel (PVA)

  3. Improving furfural tolerance of Zymomonas mobilis by rewiring a sigma factor RpoD protein.

    Science.gov (United States)

    Tan, Fu-Rong; Dai, Li-Chun; Wu, Bo; Qin, Han; Shui, Zong-Xia; Wang, Jing-Li; Zhu, Qi-Li; Hu, Qi-Chun; Ruan, Zhi-Yong; He, Ming-Xiong

    2015-06-01

    Furfural from lignocellulosic hydrolysates is the key inhibitor for bio-ethanol fermentation. In this study, we report a strategy of improving the furfural tolerance in Zymomonas mobilis on the transcriptional level by engineering its global transcription sigma factor (σ(70), RpoD) protein. Three furfural tolerance RpoD mutants (ZM4-MF1, ZM4-MF2, and ZM4-MF3) were identified from error-prone PCR libraries. The best furfural-tolerance strain ZM4-MF2 reached to the maximal cell density (OD600) about 2.0 after approximately 30 h, while control strain ZM4-rpoD reached its highest cell density of about 1.3 under the same conditions. ZM4-MF2 also consumed glucose faster and yield higher ethanol; expression levels and key Entner-Doudoroff (ED) pathway enzymatic activities were also compared to control strain under furfural stress condition. Our results suggest that global transcription machinery engineering could potentially be used to improve stress tolerance and ethanol production in Z. mobilis.

  4. Aktivitas Zymomonas mobilis pada produk etanol dari buah semu jambu mete (Anacardium occidentale dengan variasi sumber nitrogen

    Directory of Open Access Journals (Sweden)

    AKHMAD MUSTOFA

    2010-05-01

    Full Text Available Mustofa A, Suranto. 2010. Aktivitas Zymomonas mobilis pada produk etanol daribuah semu jambu mete (Anacardium occidentale dengan variasi sumber nitrogen. Bioteknologi 7: 1-9. Penelitian ini bertujuan mengetahui kemampuan Zymomonas mobilis dalam memproduksi etanol melalui proses fermentasi batch (selama 24, 48 dan 72 jam, menggunakan sumber karbon sari buah jambu mete (varietas merah, hijau dan kuning dan sumber nitrogen berupa urea, ammonium sulfat, ekstrak kecambah kacang hijau dan ekstrak kacang koro (Mucuna pruriens. Hasil penelitian menunjukkan bahwa varietas buah jambu mete hijau dengan sumber nitrogen ammonium sulfat dan lama fermentasi 24 jam memberikan hasil etanol yang paling optimal. Pada perlakuan tersebut diperoleh nilai pH 5,87, kadar gula reduksi 7,64 g/100 mL (tingkat konsumsi 48,44%, jumlah bakteri 8,0x107 (µ = 0,154 dan etanol sebesar 33,02 g/L (Ye = 90,19%.

  5. Production of ethanol by Saccharomyces cerevisiae and Zymomonas mobilis Coimmobilized: proposal for the use of organic waste

    OpenAIRE

    Ruiz-Marín, Alejandro; Canedo-López, Yunuén; Narváez-García, Asteria; Robles-Heredia, J. Carlos

    2016-01-01

    Abstract: Fermentation technologies were developed to improve the production of ethanol and an alternative is the immobilization technology, which offers advantages in comparison with free cells culture, such as the possibility of efficiently incorporating symbiotic bacteria in the same matrix. The aim of this study was to evaluate, in equivalent medium, the use of mango (Mangifera indica) waste to produce ethanol. The study compared the production of ethanol by using Zymomonas mobilis and Sa...

  6. Evaluation of wheat stillage for ethanol production by recombinant Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Davis, L.; Peiris, P. [University of Western Sydney, Penrith (Australia). School of Science, Food and Horticulture; Young-Jae Jeon; Svenson, C.; Rogers, P. [University of New South Wales, Sydney (Australia). School of Biotechnology and Biomolecular Sciences; Pearce, J. [Manildra Group, Bomaderry (Australia)

    2005-07-01

    Stillage is the main residue from the starch-to-ethanol fermentation process.Carbohydrates (hemicellulose and cellulose) comprise approximately 50% (w/w)of the total components of stillage. Conversion of the hemicellulose and cellulose to fermentable sugars and then to ethanol has the potential to significantly increase the efficiency of the process. The hydrolysis of stillage to fermentable sugars was optimised using 2% (v/v) H{sub 2}SO{sub 4} at 100{sup o}C for 5.5 h and produced 18 g/L xylose, 11.5 g/L arabinose and 6.5 g/L glucose from 120 g/L stillage. Further hydrolysis using enzymes increased the release of glucose by 61%. Furfural, acetate and lactate were the main inhibitors present in the acid hydrolysate of stillage. The lignin-derived inhibitors hydroxymethylfuraldehyde, hydroxybenzaldehyde, vanillin and syringaldehyde were not detected. Neutralisation of the hydrolysate with lime to pH 5 decreased the concentration of furfural by 50%. Fermentation of hydrolysate supplemented with glucose 10 g/L, by recombinant Zymomonas mobilis ZM4(pZB5), produced 11 g/L of ethanol after 70 h, with residual xylose 12 g/L. Supplementation of the hydrolysate with 5 g/L yeast extract and 40 g/L glucose produced 28 g/L ethanol with 2.6 g/L residual xylose after 18 h. Arabinose was not utilised by this particular recombinant strain. From the results, Z. mobilis ZM4(pZB5) may be a suitable candidate for the fermentation of both glucose and xylose in stillage acid hydrolysates. (author)

  7. Transcriptomic and metabolomic profiling of Zymomonas mobilis during aerobic and anaerobic fermentations

    Directory of Open Access Journals (Sweden)

    Palumbo Anthony V

    2009-01-01

    Full Text Available Abstract Background Zymomonas mobilis ZM4 (ZM4 produces near theoretical yields of ethanol with high specific productivity and recombinant strains are able to ferment both C-5 and C-6 sugars. Z. mobilis performs best under anaerobic conditions, but is an aerotolerant organism. However, the genetic and physiological basis of ZM4's response to various stresses is understood poorly. Results In this study, transcriptomic and metabolomic profiles for ZM4 aerobic and anaerobic fermentations were elucidated by microarray analysis and by high-performance liquid chromatography (HPLC, gas chromatography (GC and gas chromatography-mass spectrometry (GC-MS analyses. In the absence of oxygen, ZM4 consumed glucose more rapidly, had a higher growth rate, and ethanol was the major end-product. Greater amounts of other end-products such as acetate, lactate, and acetoin were detected under aerobic conditions and at 26 h there was only 1.7% of the amount of ethanol present aerobically as there was anaerobically. In the early exponential growth phase, significant differences in gene expression were not observed between aerobic and anaerobic conditions via microarray analysis. HPLC and GC analyses revealed minor differences in extracellular metabolite profiles at the corresponding early exponential phase time point. Differences in extracellular metabolite profiles between conditions became greater as the fermentations progressed. GC-MS analysis of stationary phase intracellular metabolites indicated that ZM4 contained lower levels of amino acids such as alanine, valine and lysine, and other metabolites like lactate, ribitol, and 4-hydroxybutanoate under anaerobic conditions relative to aerobic conditions. Stationary phase microarray analysis revealed that 166 genes were significantly differentially expressed by more than two-fold. Transcripts for Entner-Doudoroff (ED pathway genes (glk, zwf, pgl, pgk, and eno and gene pdc, encoding a key enzyme leading to ethanol

  8. Comparative study of bio-ethanol production from mahula (Madhuca latifolia L.) flowers by Saccharomyces cerevisiae and Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Behera, Shuvashish; Mohanty, Rama Chandra [Department of Botany, Utkal University, Vanivihar, Bhubaneswar 751004, Orissa (India); Ray, Ramesh Chandra [Microbiology Laboratory, Central Tuber Crops Research Institute (Regional Centre), Bhubaneswar 751019, Orissa (India)

    2010-07-15

    Mahula (Madhuca latifolia L.) flower is a suitable alternative cheaper carbohydrate source for production of bio-ethanol. Recent production of bio-ethanol by microbial fermentation as an alternative energy source has renewed research interest because of the increase in the fuel price. Saccharomyces cerevisiae (yeast) and Zymomonas mobilis (bacteria) are two most widely used microorganisms for ethanol production. In this study, experiments were carried out to compare the potential of the yeast S. cerevisiae (CTCRI strain) with the bacterium Z. mobilis (MTCC 92) for ethanol fermentation from mahula flowers. The ethanol production after 96 h fermentation was 149 and 122.9 g kg{sup -1} flowers using free cells of S. cerevisiae and Z. mobilis, respectively. The S. cerevisiae strain showed 21.2% more final ethanol production in comparison to Z. mobilis. Ethanol yield (Yx/s), volumetric product productivity (Qp), sugar to ethanol conversion rate (%) and microbial biomass concentration (X) obtained by S. cerevisiae were found to be 5.2%, 21.1%, 5.27% and 134% higher than Z. mobilis, respectively after 96 h of fermentation. (author)

  9. Comparative study of bio-ethanol production from mahula (Madhuca latifolia L.) flowers by Saccharomyces cerevisiae and Zymomonas mobilis

    International Nuclear Information System (INIS)

    Behera, Shuvashish; Mohanty, Rama Chandra; Ray, Ramesh Chandra

    2010-01-01

    Mahula (Madhuca latifolia L.) flower is a suitable alternative cheaper carbohydrate source for production of bio-ethanol. Recent production of bio-ethanol by microbial fermentation as an alternative energy source has renewed research interest because of the increase in the fuel price. Saccharomyces cerevisiae (yeast) and Zymomonas mobilis (bacteria) are two most widely used microorganisms for ethanol production. In this study, experiments were carried out to compare the potential of the yeast S. cerevisiae (CTCRI strain) with the bacterium Z. mobilis (MTCC 92) for ethanol fermentation from mahula flowers. The ethanol production after 96 h fermentation was 149 and 122.9 g kg -1 flowers using free cells of S. cerevisiae and Z. mobilis, respectively. The S. cerevisiae strain showed 21.2% more final ethanol production in comparison to Z. mobilis. Ethanol yield (Yx/s), volumetric product productivity (Qp), sugar to ethanol conversion rate (%) and microbial biomass concentration (X) obtained by S. cerevisiae were found to be 5.2%, 21.1%, 5.27% and 134% higher than Z. mobilis, respectively after 96 h of fermentation. (author)

  10. Flocculating Zymomonas mobilis is a promising host to be engineered for fuel ethanol production from lignocellulosic biomass.

    Science.gov (United States)

    Zhao, Ning; Bai, Yun; Liu, Chen-Guang; Zhao, Xin-Qing; Xu, Jian-Feng; Bai, Feng-Wu

    2014-03-01

    Whereas Saccharomyces cerevisiae uses the Embden-Meyerhof-Parnas pathway to metabolize glucose, Zymomonas mobilis uses the Entner-Doudoroff (ED) pathway. Employing the ED pathway, 50% less ATP is produced, which could lead to less biomass being accumulated during fermentation and an improved yield of ethanol. Moreover, Z. mobilis cells, which have a high specific surface area, consume glucose faster than S. cerevisiae, which could improve ethanol productivity. We performed ethanol fermentations using these two species under comparable conditions to validate these speculations. Increases of 3.5 and 3.3% in ethanol yield, and 58.1 and 77.8% in ethanol productivity, were observed in ethanol fermentations using Z. mobilis ZM4 in media containing ∼100 and 200 g/L glucose, respectively. Furthermore, ethanol fermentation bythe flocculating Z. mobilis ZM401 was explored. Although no significant difference was observed in ethanol yield and productivity, the flocculation of the bacterial species enabled biomass recovery by cost-effective sedimentation, instead of centrifugation with intensive capital investment and energy consumption. In addition, tolerance to inhibitory byproducts released during biomass pretreatment, particularly acetic acid and vanillin, was improved. These experimental results indicate that Z. mobilis, particularly its flocculating strain, is superior to S. cerevisiae as a host to be engineered for fuel ethanol production from lignocellulosic biomass. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Optimization of ethanol production by Zymomonas mobilis in sugar cane molasses fermentation

    Directory of Open Access Journals (Sweden)

    Marcos Roberto Oliveira

    2005-02-01

    Full Text Available The present study aimed at the optimization of the ethanol production by Zymomonas mobilis CP4, during the fermentation of sugar cane molasses. As for the optimization process, the response surface methodology was applied, using a 33 incomplete factorial design, being the independent variables: total reducing sugar (TRS concentration in the molasses from 10, 55 and 100 g/L (x1; yeast extract concentration from 2, 11 and 20 g/L (x2, and fermentation time from 6, 15 and 24 hours (x3. The dependant variables or answers were the production and productivity of ethanol. By the analysis of the results, a good adjustment of the model to the experimental data was obtained. In the levels studied, the best condition for the production of ethanol was with 100 g/L TRS in the syrup, 2.0 g/L of yeast extract and the fermentation time between 20 and 24 hours, producing 30 g/L of ethanol.

  12. A kinetic model and simulation of starch saccharification and simultaneous ethanol fermentation by amyloglucosidase and Zymomonas mobilis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, C G [Michigan Univ., Ann Arbor, MI (United States). Dept. of Chemical Engineering; Kim, C H; Rhee, S K [Korea Inst. of Science and Technology, Taejon (Korea, Republic of). Genetic Engineering Research Inst.

    1992-07-01

    A mathematical model is described for the simultaneous saccharification and ethanol fermentation (SSF) of sago starch using amyloglycosidase (AMG) and Zymomonas mobilis. By introducing the degree of polymerization (DP) of oligosaccharides produced from sago starch treated with {alpha}-amylase, a series of Michaelis-Menten equations was obtained. After determining kinetic parameters from the results of simple experiments and from the subsite mapping theory, this model was adapted to simulate the SSF process. The results of simulation for SSF are in good agreement with experimental results. (orig.).

  13. Evaluation and optimization of ethanol production from carob pod extract by Zymomonas mobilis using response surface methodology.

    Science.gov (United States)

    Vaheed, Hossein; Shojaosadati, Seyed Abbas; Galip, Hasan

    2011-01-01

    In this research, ethanol production from carob pod extract (extract) using Zymomonas mobilis with medium optimized by Plackett-Burman (P-B) and response surface methodologies (RSM) was studied. Z. mobilis was recognized as useful for ethanol production from carob pod extract. The effects of initial concentrations of sugar, peptone, and yeast extract as well as agitation rate (rpm), pH, and culture time in nonhydrolyzed carob pod extract were investigated. Significantly affecting variables (P = 0.05) in the model obtained from RSM studies were: weights of bacterial inoculum, initial sugar, peptone, and yeast extract. Acid hydrolysis was useful to complete conversion of sugars to glucose and fructose. Nonhydrolyzed extract showed higher ethanol yield and residual sugar compared with hydrolyzed extract. Ethanol produced (g g(-1) initial sugar, as the response) was not significantly different (P = 0.05) when Z. mobilis performance was compared in hydrolyzed and nonhydrolyzed extract. The maximum ethanol of 0.34 ± 0.02 g g(-1) initial sugar was obtained at 30°C, initial pH 5.2, and 80 rpm, using concentrations (g per 50 mL culture media) of: inoculum bacterial dry weight, 0.017; initial sugar, 5.78; peptone, 0.43; yeast extract, 0.43; and culture time of 36 h.

  14. The Low Energy-Coupling Respiration in Zymomonas mobilis Accelerates Flux in the Entner-Doudoroff Pathway.

    Directory of Open Access Journals (Sweden)

    Reinis Rutkis

    Full Text Available Performing oxidative phosphorylation is the primary role of respiratory chain both in bacteria and eukaryotes. Yet, the branched respiratory chains of prokaryotes contain alternative, low energy-coupling electron pathways, which serve for functions other than oxidative ATP generation (like those of respiratory protection, adaptation to low-oxygen media, redox balancing, etc., some of which are still poorly understood. We here demonstrate that withdrawal of reducing equivalents by the energetically uncoupled respiratory chain of the bacterium Zymomonas mobilis accelerates its fermentative catabolism, increasing the glucose consumption rate. This is in contrast to what has been observed in other respiring bacteria and yeast. This effect takes place after air is introduced to glucose-consuming anaerobic cell suspension, and can be simulated using a kinetic model of the Entner-Doudoroff pathway in combination with a simple net reaction of NADH oxidation that does not involve oxidative phosphorylation. Although aeration hampers batch growth of respiring Z. mobilis culture due to accumulation of toxic byproducts, nevertheless under non-growing conditions respiration is shown to confer an adaptive advantage for the wild type over the non-respiring Ndh knock-out mutant. If cells get occasional access to limited amount of glucose for short periods of time, the elevated glucose uptake rate selectively improves survival of the respiring Z. mobilis phenotype.

  15. An evolved xylose transporter from Zymomonas mobilis enhances sugar transport in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Zhang Jingqing

    2009-12-01

    Full Text Available Abstract Background Xylose is a second most abundant sugar component of lignocellulose besides glucose. Efficient fermentation of xylose is important for the economics of biomass-based biorefineries. However, sugar mixtures are sequentially consumed in xylose co-fermentation with glucose due to carbon catabolite repression (CCR in microorganisms. As xylose transmembrance transport is one of the steps repressed by CCR, it is therefore of interest to develop a transporter that is less sensitive to the glucose inhibition or CCR. Results The glucose facilitator protein Glf transporter from Zymomonas mobilis, also an efficient transporter for xylose, was chosen as the target transporter for engineering to eliminate glucose inhibition on xylose uptake. The evolution of Glf transporter was carried out with a mixture of glucose and xylose in E. coli. Error-prone PCR and random deletion were employed respectively in two rounds of evolution. Aided by a high-throughput screening assay using xylose analog p-nitrophenyl-β-D-xylopyranoside (pNPX in 96-well plates, a best mutant 2-RD5 was obtained that contains several mutations, and a deletion of 134 residues (about 28% of total residues, or three fewer transmembrane sections (TMSs. It showed a 10.8-fold improvement in terms of pNPX transport activity in the presence of glucose. The fermentation performance results showed that this mutant improved xylose consumption by 42% with M9 minimal medium containing 20 g L-1 xylose only, while with the mixture sugar of xylose and glucose, 28% more glucose was consumed, but no obvious co-utilization of xylose was observed. Further glucose fed-batch experiments suggested that the intracellular metabolism of xylose was repressed by glucose. Conclusions Through random mutagenesis and partial deletion coupled with high-throughput screening, a mutant of the Glf transporter (2-RD5 was obtained that relieved the inhibition of xylose transport by glucose. The fermentation

  16. Performance testing of Zymomonas mobilis metabolically engineered for cofermentation of glucose, xylose, and arabinose.

    Science.gov (United States)

    Lawford, Hugh G; Rousseau, Joyce D

    2002-01-01

    IOGEN Corporation of Ottawa, Canada, has recently built a 40t/d biomass-to-ethanol demonstration plant adjacent to its enzyme production facility. It has partnered with the University of Toronto to test the C6/C5 cofermenta-tion performance characteristics of the National Renewable Energy Labora-tory's metabolically engineered Zymomonas mobilis using various biomass hydrolysates. IOGEN's feedstocks are primarily agricultural wastes such as corn stover and wheat straw. Integrated recombinant Z. mobilis strain AX101 grows on D-xylose and/or L-arabinose as the sole carbon/energy sources and ferments these pentose sugars to ethanol in high yield. Strain AX101 lacks the tetracycline resistance gene that was a common feature of other recombinant Zm constructs. Genomic integration provides reliable cofermentation performance in the absence of antibiotics, another characteristic making strain AX101 attractive for industrial cellulosic ethanol production. In this work, IOGEN's biomass hydrolysate was simulated by a pure sugar medium containing 6% (w/v) glucose, 3% xylose, and 0.35% arabinose. At a level of 3 g/L (dry solids), corn steep liquor with inorganic nitrogen (0.8 g/L of ammonium chloride or 1.2 g/L of diammonium phosphate) was a cost-effective nutritional supplement. In the absence of acetic acid, the maximum volumetric ethanol productivity of a continuous fermentation at pH 5.0 was 3.54 g/L x h. During prolonged continuous fermentation, the efficiency of sugar-to-ethanol conversion (based on total sugar load) was maintained at >85%. At a level of 0.25% (w/v) acetic acid, the productivity decreased to 1.17 g/L x h at pH 5.5. Unlike integrated, xylose-utilizing rec Zm strain C25, strain AX101 produces less lactic acid as byproduct, owing to the fact that the Escherichia coli arabinose genes are inserted into a region of the host chromosome tentatively assigned to the gene for D-lactic acid dehydrogenase. In pH-controlled batch fermentations with sugar mixtures, the

  17. Stillage as a Source of Growth Promoting Biofactors and a Stimulator of Levan and Extracellular Levansucrase Synthesis for Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    Mara Grube

    2002-01-01

    Full Text Available In the present work, the fermentation of simultaneous production of ethanol and levan by Zymomonas mobilis grown on different growth media has been studied. Yeast extract, rye stillage or sugar beet molasses stillage were used as additives to the basic sucrose media and the chemical composition, including vitamins, of the cultivation liquids have been determined. It has been shown that 0.5 % of yeast extract dry weight additive could be substituted by 10.0 % of native stillage additive. It was established that molasses stillage stimulates the ethanol synthesis, but rye stillage additive is more preferable for levan production. The extracellular levansucrase obtained from the culture liquid resulted in similar fructooligosaccharide-producing activities using all the above-mentioned media additives.

  18. Identification and Characterization of 5′ Untranslated Regions (5′UTRs in Zymomonas mobilis as Regulatory Biological Parts

    Directory of Open Access Journals (Sweden)

    Seung Hee Cho

    2017-12-01

    Full Text Available Regulatory RNA regions within a transcript, particularly in the 5′ untranslated region (5′UTR, have been shown in a variety of organisms to control the expression levels of these mRNAs in response to various metabolites or environmental conditions. Considering the unique tolerance of Zymomonas mobilis to ethanol and the growing interest in engineering microbial strains with enhanced tolerance to industrial inhibitors, we searched natural cis-regulatory regions in this microorganism using transcriptomic data and bioinformatics analysis. Potential regulatory 5′UTRs were identified and filtered based on length, gene function, relative gene counts, and conservation in other organisms. An in vivo fluorescence-based screening system was developed to confirm the responsiveness of 36 5′UTR candidates to ethanol, acetate, and xylose stresses. UTR_ZMO0347 (5′UTR of gene ZMO0347 encoding the RNA binding protein Hfq was found to down-regulate downstream gene expression under ethanol stress. Genomic deletion of UTR_ZMO0347 led to a general decrease of hfq expression at the transcript level and increased sensitivity for observed changes in Hfq expression at the protein level. The role of UTR_ZMO0347 and other 5′UTRs gives us insight into the regulatory network of Z. mobilis in response to stress and unlocks new strategies for engineering robust industrial strains as well as for harvesting novel responsive regulatory biological parts for controllable gene expression platforms in this organism.

  19. Pre-treatment step with Leuconostoc mesenteroides or L. pseudomesenteroides strains removes furfural from Zymomonas mobilis ethanolic fermentation broth.

    Science.gov (United States)

    Hunter, William J; Manter, Daniel K

    2014-10-01

    Furfural is an inhibitor of growth and ethanol production by Zymomonas mobilis. This study used a naturally occurring (not GMO) biological pre-treatment to reduce that amount of furfural in a model fermentation broth. Pre-treatment involved inoculating and incubating the fermentation broth with strains of Leuconostoc mesenteroides or Leuconostoc pseudomesenteroides. The Leuconostoc strains converted furfural to furfuryl alcohol without consuming large amounts of dextrose in the process. Coupling this pre-treatment to ethanolic fermentation reduced furfural in the broth and improved growth, dextrose uptake and ethanol formation. Pre-treatment permitted ethanol formation in the presence of 5.2 g L(-1) furfural, which was otherwise inhibitive. The pre-treatment and presence of the Leuconostoc strains in the fermentation broth did not interfere with Z. mobilis ethanolic fermentation or the amounts of ethanol produced. The method suggests a possible technique for reducing the effect that furfural has on the production of ethanol for use as a biofuel. Published by Elsevier Ltd.

  20. The relationship between sucrose hydrolysis, sorbitol formation and mineral ion concentration during bioethanol formation using Zymomonas mobilis 2716

    Energy Technology Data Exchange (ETDEWEB)

    Doelle, M.B.; Doelle, H.W. (Queensland Univ., St. Lucia (Australia). Dept. of Microbiology); Greenfield, P.F. (Queensland Univ., St. Lucia (Australia). Dept. of Chemical Engineering)

    1990-11-01

    Investigations into the relationship between sucrose hydrolysis, sorbitol formation and mineral ion concentration during bioethanol formation by Zymomonas mobilis 2716 revealed two distinct phenomena responsible for carbon flow diversion, a 'sucrose effect' and a 'salt effect'. Neither of the two phenomena affects sucrose hydrolysis, but they divert carbon flow of the fructose monomer leading to its own accumulation, sorbitol or oligosaccharide formation. Sucrose concentrations in excess of 15% (w/v) led to sorbitol formation, the level of which may exceed 2% (w/v) depending upon glucose accumulation during sucrose hydrolysis. Increasing mineral ion concentrations led initially to carbon losses and finally to fructose accumulation instead of sorbitol formation. This carbon loss can be corrected by the addition of invertase, which in turn leads to an increase in sorbitol, fructose and ethanol. Potassium and chloride are the dominant ions responsible for suppression of sorbitol formation and fructose uptake, encouraging oligosaccharide formation. These fructooligosaccharides must be of a type which can be converted to fructose, sorbitol and ethanol through the action of invertase. The requirement of invertase addition to prevent fructooligosaccharide formation is indirect evidence that Z. mobilis 2716 does not produce invertase. (orig.).

  1. Furfural-tolerant Zymomonas mobilis derived from error-prone PCR-based whole genome shuffling and their tolerant mechanism.

    Science.gov (United States)

    Huang, Suzhen; Xue, Tingli; Wang, Zhiquan; Ma, Yuanyuan; He, Xueting; Hong, Jiefang; Zou, Shaolan; Song, Hao; Zhang, Minhua

    2018-04-01

    Furfural-tolerant strain is essential for the fermentative production of biofuels or chemicals from lignocellulosic biomass. In this study, Zymomonas mobilis CP4 was for the first time subjected to error-prone PCR-based whole genome shuffling, and the resulting mutants F211 and F27 that could tolerate 3 g/L furfural were obtained. The mutant F211 under various furfural stress conditions could rapidly grow when the furfural concentration reduced to 1 g/L. Meanwhile, the two mutants also showed higher tolerance to high concentration of glucose than the control strain CP4. Genome resequencing revealed that the F211 and F27 had 12 and 13 single-nucleotide polymorphisms. The activity assay demonstrated that the activity of NADH-dependent furfural reductase in mutant F211 and CP4 was all increased under furfural stress, and the activity peaked earlier in mutant than in control. Also, furfural level in the culture of F211 was also more rapidly decreased. These indicate that the increase in furfural tolerance of the mutants may be resulted from the enhanced NADH-dependent furfural reductase activity during early log phase, which could lead to an accelerated furfural detoxification process in mutants. In all, we obtained Z. mobilis mutants with enhanced furfural and high concentration of glucose tolerance, and provided valuable clues for the mechanism of furfural tolerance and strain development.

  2. Acción inhibitoria de una cepa de Zymomonas mobilis mobilis aislada de caña de azúcar sobre Xanthomonas citri subsp. citri, agente causal de la cancrosis de los cítricos Inhibition of Xanthomonas citri subsp. citri, causal agent of citrus canker, by a strain of Zymomonas mobilis mobilis isolated from sugarcane

    Directory of Open Access Journals (Sweden)

    María E. Romero

    2008-06-01

    Full Text Available Zymomonas mobilis mobilis (Zm produce factores antimicrobianos que actúan sobre un amplio espectro de microorganismos patógenos para el hombre, animales y plantas. Un problema importante a resolver en los tratamientos con antimicrobianos, es el desarrollo de resistencia a compuestos empleados actualmente, no siendo las bacterias fitopatógenas una excepción. En el presente trabajo se realizaron ensayos de antagonismo con células (pruebas de estrías cruzadas y sobrenadantes concentrados (Sc (por difusión en agar preparados a partir de cultivos de Zm (aislada de jugo de caña de azúcar producido en Tucumán, frente a la bacteria causal de la cancrosis: Xanthomonas citri subsp. citri. Se evaluaron aislamientos de Xcc sensibles (Xc y resistentes (Xcr a compuestos a base de cobre. Los resultados obtenidos mostraron que la bacteria testigo fue inhibida totalmente por las células de Zm, ejerciendo un efecto bactericida. En los ensayos de difusión en el agar se observó que tanto Xc, como Xcr fueron sensibles al Sc de Zm. Se sabe, por estudios anteriores, que los metabolitos de Zymomonas tienen un efecto deletéreo en la membrana celular de E. coli AB1133, inhibiéndose la respiración de la bacteria inmediatamente de agregado Sc (60 UA. En el presente trabajo se observó el mismo efecto, inhibición total de la respiración en Xc, luego del agregado del Sc (60 UA. Por lo observado, se deduce que el blanco de acción de los metabolitos antimicrobianos de Sc en Xc, sería el mismo que el de E. coli AB1133. Con los resultados obtenidos se considera de interés encarar el estudio de los compuestos de Zm para ser empleados en el control de enfermedades que afectan los cultivos de valor económico de la región, como es el caso de la cancrosis, como así también profundizar acerca de la acción de dichos metabolitos en la membrana de Xanthomonas citri subsp. citri.Zymomonas mobilis mobilis (Zm produces antimicrobial factors, which have an effect on

  3. Hybrid neural network model for simulating sorbitol synthesis by glucose-fructose oxidoreductase in Zymomonas mobilis CP4

    Directory of Open Access Journals (Sweden)

    Bravo S.

    2004-01-01

    Full Text Available A hybrid neural network model for simulating the process of enzymatic reduction of fructose to sorbitol process catalyzed by glucose-fructose oxidoreductase in Zymomonas mobilis CP4 is presented. Data used to derive and validate the model was obtained from experiments carried out under different conditions of pH, temperature and concentrations of both substrates (glucose and fructose involved in the reaction. Sonicated and lyophilized cells were used as source of the enzyme. The optimal pH for sorbitol synthesis at 30º C is 6.5. For a value of pH of 6, the optimal temperature is 35º C. The neural network in the model computes the value of the kinetic relationship. The hybrid neural network model is able to simulate changes in the substrates and product concentrations during sorbitol synthesis under pH and temperature conditions ranging between 5 and 7.5 and 25 and 40º C, respectively. Under these conditions the rate of sorbitol synthesis shows important differences. Values computed using the hybrid neural network model have an average error of 1.7·10-3 mole.

  4. The effects of potassium and chloride ions on the ethanolic fermentation of sucrose by Zymomonas mobilis 2716

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, L A; Doelle, H W [Queensland Univ., Brisbane (Australia). Dept. of Microbiology

    1992-04-01

    The inclusion of specific salts in Zymomonas mobilis batch sucrose fermentations can limit by-product formation. Sorbitol and fructo-oligosaccharide formation can be reduced and ethanol production enhanced by manipulating mineral salt concentrations. Chloride salts reduced the production of biomass and sorbitol in favour of fructo-obligosaccharide formation at concentrations lower than 10 g NaCl/l or MgCl{sub 2}. Higher concentrations led to the accumulation of glucose and fructose. Low concentrations of KH{sub 2}PO{sub 4} (<20 g/l) enhanced biomass formation, and the concomitant reduction in sorbitol and fructo-obligosaccharides favoured enhanced ethanol formation. At concentrations above 20 g/l, its effects were similar to those obtained with the chloride salts. Invertase addition at the start of fermentation increased sorbitol formation, whereas addition after the completion of sucrose hydrolysis resulted in the conversion of fructo-obligosaccharides formed into fructose or ethanol. Fermentation with 250 g/l of sugar-cane syrup (=130 g sucrose/l) in the presence of 8 g KH{sub 2}PO{sub 4}/l, with 0.05 g invertase/l added on the completion of sucrose hydrolysis, resulted in a conversion efficiency of 94% with complete carbon accountability, and only 7 g sorbitol/l. (orig.).

  5. Application of fractional factorial design to levan production by Zymomonas mobilis Aplicação do planejamento fatorial fracionário para a produção de levana por Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    I.R. Melo

    2007-03-01

    Full Text Available Levan is a non-toxic, biologically active, extra cellular polysaccharide composed solely by fructose units. Optimization of levan production by Zymomonas mobilis strain ZAG-12 employing a 2(4-1 fractional factorial design was performed to analyze the influence of the temperature (20, 25 e 30ºC agitation (50, 75 e 100 rpm, and the initial concentrations of both sucrose (150, 200 e 250 g.L-1 and yeast extract (2.0, 3.5 e 5.0g.L-1 on final levan concentration. Aerobic fermentation was performed batchwise in 500mL Pyrex flasks for 72 hours. Biomass, ethanol, levan and sucrose were determined at beginning and also at end of the fermentations. The experiments showed that the final levan concentration depended on initial sucrose concentration, temperature and agitation velocity and that the initial concentration of yeast extract did not influence levan production. However, when the production of ethanol and biomass were considered, it became evident that yeast extract was a significant variable. The best conditions for levan production occurred at 100 rpm agitation, 20ºC and 250g.L-1 of initial sucrose resulting in 14.67g.L-1 of levan.Levana é um polissacarídeo extracelular, biologicamente ativo, não tóxico, contendo em sua estrutura apenas frutose. A maximização da produção de levana, por via fermentativa, pela linhagem de Zymomonas mobilis ZAG-12, foi estudada utilizando-se um planejamento fatorial de dois níveis 2(4-1, variando-se as concentrações iniciais de sacarose (150, 200 e 250 g.L-1 , extrato de levedura (2.0, 3.5 e 5.0 g.L-1, temperatura (20, 25 e 30ºC e agitação (50, 75 e 100 rpm. As fermentações foram desenvolvidas por processos descontínuos em frascos Pyrex roscados, de 500 mL, contendo 300 mL de meio a base de sacarose, por 72 horas. No início e ao final do processo, foram dosados: biomassa, etanol, levana e sacarose como açúcares redutores totais. A análise dos dados mostra que o aumento da produção de levana

  6. Development of High-Productivity Continuous Ethanol Production using PVA-Immobilized Zymomonas mobilis in an Immobilized-Cells Fermenter

    Directory of Open Access Journals (Sweden)

    Nurhayati Nurhayati

    2015-07-01

    Full Text Available Ethanol as one of renewable energy was being considered an excellent alternative clean-burning fuel to replace gasoline. Continuous ethanol fermentation systems had offered important economic advantages compared to traditional systems. Fermentation rates were significantly improved, especially when continuous fermentation was integrated with cell immobilization techniques to enrich the cells concentration in fermentor. Growing cells of Zymomonas mobilis immobilized in polyvinyl alcohol (PVA gel beads were employed in an immobilized-cells fermentor for continuous ethanol fermentation from glucose. The glucose loading, dilution rate, and cells loading were varied in order to determine which best condition employed in obtaining both high ethanol production and low residual glucose with high dilution rate. In this study, 20 g/L, 100 g/L, 125 g/L and 150 g/L of glucose concentration and 20% (w/v, 40% (w/v and 50% (w/v of cells loading were employed with range of dilution rate at 0.25 to 1 h-1. The most stable production was obtained for 25 days by employing 100 g/L of glucose loading. Meanwhile, the results also exhibited that 125 g/L of glucose loading as well as 40% (w/v of cells loading yielded high ethanol concentration, high ethanol productivity, and acceptable residual glucose at 62.97 g/L, 15.74 g/L/h and 0.16 g/L, respectively. Furthermore, the dilution rate of 4 hour with 100 g/L and 40% (w/v of glucose and cells loading was considered as the optimum condition with ethanol production, ethanol productivity and residual glucose obtained were 49.89 g/L, 12.47 g/L/h, and 2.04 g/L, respectively. This recent study investigated ethanol inhibition as well. The present research had proved that high sugar concentration was successfully converted to ethanol. These achieved results were promising for further study.

  7. Continuous fermentation using low concentration of sugar cane and Zymomonas mobilis CP4 for ethanol production

    Directory of Open Access Journals (Sweden)

    João Batista Buzato

    2001-01-01

    Full Text Available Effect of dilution rate in continuous fermentation of 20g sucrose/L and Z. mobilis CP4 was studied for ethanol production at 28oC + 1, without pH control. Four dilution rates were compared: 0.045; 0.14; 0.23 and 0.34 h-1. In dilution rates 0.045; 0.14 and 0.23 h-1 were produced 9,4g/L of ethanol and in dilution rate 0.34 h-1 was produced 8,8 g/L. Ethanol conversion efficiency were of 91% in dilution rates 0.045; 0.14 and 0. 23 h-1. In dilution rate 0.34 h-1 the conversion efficiency was of 85%.

  8. Development of corn silk as a biocarrier for Zymomonas mobilis biofilms in ethanol production from rice straw.

    Science.gov (United States)

    Todhanakasem, Tatsaporn; Tiwari, Rashmi; Thanonkeo, Pornthap

    2016-01-01

    Z. mobilis cell immobilization has been proposed as an effective means of improving ethanol production. In this work, polystyrene and corn silk were used as biofilm developmental matrices for Z. mobilis ethanol production with rice straw hydrolysate as a substrate. Rice straw was hydrolyzed by dilute sulfuric acid (H2SO4) and enzymatic hydrolysis. The final hydrolysate contained furfural (271.95 ± 76.30 ppm), 5-hydroxymethyl furfural (0.07 ± 0.00 ppm), vanillin (1.81 ± 0.00 ppm), syringaldehyde (5.07 ± 0.83 ppm), 4-hydroxybenzaldehyde (4-HB) (2.39 ± 1.20 ppm) and acetic acid (0.26 ± 0.08%). Bacterial attachment or biofilm formation of Z. mobilis strain TISTR 551 on polystyrene and delignified corn silk carrier provided significant ethanol yields. Results showed up to 0.40 ± 0.15 g ethanol produced/g glucose consumed when Z. mobilis was immobilized on a polystyrene carrier and 0.51 ± 0.13 g ethanol produced/g glucose consumed when immobilized on delignified corn silk carrier under batch fermentation by Z. mobilis TISTR 551 biofilm. The higher ethanol yield from immobilized, rather than free living, Z. mobilis could possibly be explained by a higher cell density, better control of anaerobic conditions and higher toxic tolerance of Z. mobilis biofilms over free cells.

  9. Utilization of raw materials from agroindustry – sugar cane juice and yeast extract – for asparaginase production by Zymomonas mobilis CP4/ Uso de matérias primas da agroindústria – garapa e extrato de levedura – na produção de asparaginase por Zymomonas mobilis CP4

    Directory of Open Access Journals (Sweden)

    Maria Antonia Pedrine Colabone Celligoi

    2007-08-01

    Full Text Available Sugar cane juice and yeast extract have been used for asparaginase production by Z. mobilis CP4. A complete factorial design of two variables (yeast extract and asparagin at three levels (1.0; 5.5 and 10.0 g/L with one replication at the central point was used. Batch fermentation utilised sugar cane juice diluted at 8 % (W/V of Total Sugars and an inoculum of 2 mg of cells/mL. After fermentation time of 18 hours, the highest production of asparaginase was 9.75 U/L using both yeast extract (5.5 g/L and asparagin (1.0 g/l.Garapa e extrato de levedura foram usados na produção de asparaginase por Zymomonas mobilis CP4. Na otimização utilizou metodologia de superfície de resposta com 2 variáveis (extrato de levedura e asparagina em 3 níveis (1,0; 5,5 e 10,0 g/L e uma repetição do ponto central. A fermentação em batelada utilizou garapa diluída a 8 % (P/V de Açúcares Totais e inóculo de Zymomonas mobilis CP4 na concentração de 2 mg/mL. Após a fermentação de 18 horas, a maior produção obtida de asparaginase foi de 9,75 U/L em extrato de levedura em 5,5 g/L e asparagina em 1,0 g/L.

  10. Evaluation of supplementation of sucrose medium on the synthesis of Zymomonas mobilis bio-products - doi: 10.4025/actascibiolsci.v32i3.1519

    Directory of Open Access Journals (Sweden)

    Maria Antonia Pedrini Colabone Celligoi

    2010-09-01

    Full Text Available The effect of the variables pantothenic acid, yeast extract and sodium chloride, as well as the cell permeabilization technique, were investigated on the formation of levan, ethanol, sorbitol and biomass of Zymomonas mobilis, using a 24-1 fraction factorial design. Cell growth was determined by turbidimetry at 605 nm, relating it to a biomass with a dry weight calibration curve. Reducing sugars were quantified according to Somogyi and Nelson. Total sugars were quantified by the phenol-sulfuric acid method, sorbitol by HPLC and ethanol. The levan produced was precipitated by the addition of absolute ethanol and quantified in fructose units. In levan biosynthesis, the variable that had the largest contribution was cell condition. The results suggested that the factors that most affected biomass and ethanol formation were sodium chloride concentration and cell condition that affected negatively on production. For sorbitol, the variable that had a significant effect was permeabilization, which decreased its synthesis. Studies to amplify the range of established factors would be important.The effect of the variables pantothenic acid, yeast extract and sodium chloride, as well as the cell permeabilization technique, were investigated on the formation of levan, ethanol, sorbitol and biomass of Zymomonas mobilis, using a 24-1 fraction factorial design. Cell growth was determined by turbidimetry at 605 nm, relating it to a biomass with a dry weight calibration curve. Reducing sugars were quantified according to Somogyi and Nelson. Total sugars were quantified by the phenol-sulfuric acid method, sorbitol by HPLC and ethanol. The levan produced was precipitated by the addition of absolute ethanol and quantified in fructose units. In levan biosynthesis, the variable that had the largest contribution was cell condition. The results suggested that the factors that most affected biomass and ethanol formation were sodium chloride concentration and cell

  11. Optimization of process parameters for ethanol production from sugar cane molasses by Zymomonas mobilis using response surface methodology and genetic algorithm

    Energy Technology Data Exchange (ETDEWEB)

    Maiti, Bodhisatta; Shekhawat, Mitali; Srivastava, Pradeep [Banaras Hindu Univ., Varanasi (India). School of Biochemical Engineering; Rathore, Ankita [Nizam College, Hyderabad (India). Dept. of Biotechnology; Srivastava, Saurav [National Institute of Technology, Durgapur (India). Dept. of Biotechnology

    2011-04-15

    Ethanol is a potential energy source and its production from renewable biomass has gained lot of popularity. There has been worldwide research to produce ethanol from regional inexpensive substrates. The present study deals with the optimization of process parameters (viz. temperature, pH, initial total reducing sugar (TRS) concentration in sugar cane molasses and fermentation time) for ethanol production from sugar cane molasses by Zymomonas mobilis using Box-Behnken experimental design and genetic algorithm (GA). An empirical model was developed through response surface methodology to analyze the effects of the process parameters on ethanol production. The data obtained after performing the experiments based on statistical design was utilized for regression analysis and analysis of variance studies. The regression equation obtained after regression analysis was used as a fitness function for the genetic algorithm. The GA optimization technique predicted a maximum ethanol yield of 59.59 g/L at temperature 31 C, pH 5.13, initial TRS concentration 216 g/L and fermentation time 44 h. The maximum experimental ethanol yield obtained after applying GA was 58.4 g/L, which was in close agreement with the predicted value. (orig.)

  12. Production of ethanol from mesquite [Prosopis juliflora (SW) D.C.] pods mash by Zymomonas mobilis in submerged fermentation

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Celiane Gomes Maia da [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Ciencias Domesticas; Andrade, Samara Alvachian Cardoso; Schuler, Alexandre Ricardo Pereira [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Engenharia Quimica; Souza, Evandro Leite de [Universidade Federal da Paraiba (UFPB), Joao Pessoa, PB (Brazil). Dept. de Nutricao; Stamford, Tania Lucia Montenegro [Universidade Federal de Pernambuco (UFPE), Recife, PE (Brazil). Dept. de Nutricao], E-mail: tlmstamford@yahoo.com.br

    2011-01-15

    Mesquite [Prosopis juliflora (SW) D.C.], a perennial tropical plant commonly found in Brazilian semi-arid region, is a viable raw material for fermentative processes because of its low cost and production of pods with high content of hydrolyzable sugars which generate many compounds, including ethanol. This study aimed to evaluate the use of mesquite pods as substrate for ethanol production by Z. mobilis UFPEDA- 205 in a submerged fermentation. The fermentation was assessed for rate of substrate yield to ethanol, rate of ethanol production and efficiency of fermentation. The very close theoretical (170 g L{sup -1}) and experimental (165 g L{sup -1}) maximum ethanol yields were achieved at 36 h of fermentation. The highest counts of Z. mobilis UFEPEDA-205 (both close to 6 Log cfu mL{sup -1}) were also noted at 36 h. Highest rates of substrate yield to ethanol (0.44 g ethanol g glucose{sup -1}), of ethanol production (4.69 g L{sup -1} h{sup -1}) and of efficiency of fermentation (86.81%) were found after 30 h. These findings suggest mesquite pods as an interesting substrate for ethanol production using submerged fermentation by Z. mobilis. (author)

  13. Effect of the presence of initial ethanol on ethanol production in sugar cane juice fermented by Zymomonas mobilis

    OpenAIRE

    Tano,Marcia Sadae; Buzato,João Batista

    2003-01-01

    Ethanol production in sugar cane juice in high initial sugar concentration, fermented by Z. mobilis in the presence and absence of ethanol, was evaluated. Ethanol production was low in both media. The presence of initial ethanol in the sugar cane juice reduced ethanol production by 48.8%, biomass production by 25.0% and the total sugar consumption by 28.3%. The presence of initial ethanol in the medium did not affect significantly levan production and biomass yield coefficient (g biomass/g su...

  14. Evaluation of supplementation of sucrose medium on the synthesis of Zymomonas mobilis bio-products = Avaliação da suplementação do meio de sacarose na formação de bio– produtos por Zymomonas mobilis

    Directory of Open Access Journals (Sweden)

    Raquel Renan Jorge Borsari

    2010-07-01

    Full Text Available The effect of the variables pantothenic acid, yeast extract and sodiumchloride, as well as the cell permeabilization technique, were investigated on the formation of levan, ethanol, sorbitol and biomass of Zymomonas mobilis, using a 24-1 fraction factorial design. Cell growth was determined by turbidimetry at 605 nm, relating it to a biomass with a dry weight calibration curve. Reducing sugars were quantified according to Somogyi and Nelson. Total sugars were quantified by the phenol-sulfuric acid method, sorbitol by HPLC and ethanol. The levan produced was precipitated by the addition of absolute ethanol and quantified in fructose units. In levan biosynthesis, the variable that had the largest contribution was cell condition. The results suggested that the factors that most affected biomass and ethanol formation were sodium chloride concentration and cell condition that affected negatively on production. For sorbitol, the variable that had a significant effect was permeabilization, which decreased its synthesis. Studies to amplify the range of established factors would be important.A influência das variáveis: ácido pantotênico, extrato de levedura, cloreto de sódio, e a técnica de permeabilização celular foram investigadas na formação de levana, sorbitol, etanol e biomassa de Zymomonas mobilis utilizando um delineamento estatístico fatorial fracionado 24-1. A biomassa foi determinada por turbidimetria, Os açúcares redutores foram quantificados por Somogy e Nelson, açúcartotal por Fenol Sulfúrico, sorbitol por HPLC e etanol por micro-destilação. A levana produzida foi precipitada com etanol absoluto e determinada como unidade de frutose. Na biossíntese de levana, a variável que mais contribuiu foi a condição celular. Os resultadossugerem que, para a formação da biomassa e etanol, os fatores que mais interferiram foram a concentração de cloreto de sódio e a condição celular que influencia negativamente a produ

  15. Influence of carbon source and the fermentation process on levan production by Zymomonas mobilis analyzed by the surface response method Influência da fonte de carbono e do processo fermentativo na produção de levana por Zymomonas mobilis analisada pela metodologia de superfície de resposta

    Directory of Open Access Journals (Sweden)

    Raquel Renan Jorge Borsari

    2006-09-01

    Full Text Available The aim of this study is to assess sugar cane juice and sucrose as substrates, the batch and fed batch processes and their interaction in the levan production using a complete factorial design. Zymomonas mobilis was cultivated in different sugar cane juice and sucrose concentrations in two fermentation processes at 25 °C for 20 h. A complete factorial design (2³ was used to analyze the effects of the type and concentration of the substrate, as well as the batch and fed batch processes. A complete second factorial design (2² was used to observe the importance of sugar cane juice. The results indicated that the batch process improved the levan production reaching 40.14 g/L. The addition of sugar cane juice was not statistically significant for levan formation, however sugar cane juice stimulated biomass, sorbitol and ethanol production. The best medium for levan production was 150 g/L sucrose in batch.O presente estudo avaliou caldo de cana de açúcar e sacarose como substratos e os processos batelada e batelada alimentada e suas interações na produção de levana. Zymomonas mobilis foi cultivada em diferentes concentrações de caldo de cana de açúcar e sacarose nos dois processos fermentativos a 25 °C por 20 h. Foi utilizado um delineamento fatorial completo (23 para analisar os efeitos do tipo e concentração de substratos e processos batelada e batelada alimentada. Um segundo delineamento fatorial completo (22 foi usado para confirmar a importância do caldo de cana de açúcar. Os resultados indicam que o processo batelada foi o melhor para a produção de levana, atingindo 40,14 g/L em 150 g/L de sacarose. A adição de caldo de cana de açúcar não foi estatisticamente significativa para formação de levana, porém o caldo estimulou a produção de biomassa, sorbitol e etanol.

  16. Effect of Brönsted acidic ionic liquid 1-(1-propylsulfonic)-3-methylimidazolium chloride on growth and co-fermentation of glucose, xylose and arabinose by Zymomonas mobilis AX101.

    Science.gov (United States)

    Gyamerah, M; Ampaw-Asiedu, M; Mackey, J; Menezes, B; Woldesenbet, S

    2018-06-01

    The potential of large-scale lignocellulosic biomass hydrolysis to fermentable sugars using ionic liquids has increased interest in this green chemistry route to fermentation for fuel-ethanol production. The ionic liquid 1-(1-propylsulfonic)-3-methylimidazolium chloride compared to other reported ionic liquids has the advantage of hydrolysing lignocellulosic biomass to reducing sugars at catalytic concentrations (≤0·032 mol l -1 ) in a single step. However, effects of this ionic liquid on co-fermentation of glucose, xylose and arabinose to ethanol by recombinant Zymomonas mobilisAX101 has not been studied. Authentic glucose, xylose and arabinose were used to formulate fermentation media at varying catalytic 1-(1-propylsulfonic)-3-methylimidazolium chloride concentrations for batch co-fermentation of the sugars using Z. mobilisAX101. The results showed that at 0·008, 0·016 and 0·032 mol l -1 ionic liquid in the culture medium, cell growth decreased by 10, 27 and 67% respectively compared to the control. Ethanol yields were 62·6, 61·8, 50·5 and 23·1% for the control, 0·008, 0·016 and 0·032 mol l -1 ionic liquid respectively. The results indicate that lignocellulosic biomass hydrolysed using 0·008 mol l -1 of 1-(1-propylsulfonic)-3-methylimidazolium chloride would eliminate an additional separation step and provide a ready to use fermentation substrate. This is the first reported study of the effect of the Brönsted acidic ionic liquid 1-(1-propylsulfonic)-3-methylimidazolium chloride on growth and co-fermentation of glucose, xylose and arabinose by Zymomonas mobilisAX101 in batch culture. Growth on and co-fermentation of the sugars by Z. mobilisAX 101 with no significant inhibition by the ionic liquid at the same catalytic amounts of 0·008 mol l -1 used to hydrolyse lignocellulosic biomass to reducing sugars overcome two major hurdles that adversely affect the process economics of large-scale industrial cellulosic fuel ethanol production

  17. Produção de L-asparaginase por Zymomonas mobilis durante a fermentação do melaço: otimização das condições de cultivo utilizando delineamento fatorial - DOI: 10.4025/actascitechnol.v28i2.1178

    Directory of Open Access Journals (Sweden)

    Doumit Camilios Neto

    2006-03-01

    Full Text Available A L-asparaginase é uma enzima com atividade anti-leucêmica produzida por microrganismos, principalmente bactérias gram-negativas. Zymomonas mobilis é uma bactéria gram-negativa, que apresenta potencial para produção de L-asparaginase. Esse estudo buscou a otimização da produção de L-asparaginase por Zymomonas mobilis, durante a fermentação do melaço de cana-de-açúcar, utilizando um delineamento fatorial incompleto 33. O modelo obtido através da metodologia de superfície de resposta foi otimizado pelo software Otplex. Obteve-se bom ajuste do modelo aos dados experimentais, sendo o coeficiente de determinação total (R2, 95%. A máxima atividade enzimática (16,55 UI L-1 foi obtida com uma concentração de açúcares redutores totais no melaço de 100,0 g L-1, 2,0 g L-1 de extrato de levedura e com 21 horas de fermentação. A validação experimental confirmou a capacidade preditiva do modelo, sendo a diferença entre resposta estimada(Ŷ1 e resposta observada (Y1 apenas de 1%.

  18. Production of ethanol from mesquite [Prosopis juliflora (SW D.C.] pods mash by Zymomonas mobilis in submerged fermentation Produção de etanol a partir do mosto de vagens de algaroba [Prosopis juliflora (SW D.C.] por Zymomonas mobilis em fermentação submersa

    Directory of Open Access Journals (Sweden)

    Celiane Gomes Maia da Silva

    2011-02-01

    Full Text Available Mesquite [Prosopis juliflora (SW D.C.], a perennial tropical plant commonly found in Brazilian semi-arid region, is a viable raw material for fermentative processes because of its low cost and production of pods with high content of hydrolysable sugars which generate many compounds, including ethanol. This study aimed to evaluate the use of mesquite pods as substrate for ethanol production by Z. mobilis UFPEDA205 in a submerged fermentation. The fermentation was assessed for rate of substrate yield to ethanol, rate of ethanol production and efficiency of fermentation. The very close theoretical (170 g L-1 and experimental (165 g L-1 maximum ethanol yields were achieved at 36 h of fermentation. The highest counts of Z. mobilis UFEPEDA-205 (both close to 6 Log cfu mL-1 were also noted at 36 h. Highest rates of substrate yield to ethanol (0.44 g ethanol g glucose-1, of ethanol production (4.69 g L-1 h-1 and of efficiency of fermentation (86.81% were found after 30 h. These findings suggest mesquite pods as an interesting substrate for ethanol production using submerged fermentation by Z. mobilis.A algaroba [Prosopis juliflora (SW D.C.] é uma planta tropical perene comumente encontrada no semi-árido brasileiro e apresenta-se como matéria-prima viável para o processo fermentativo por possuir baixo custo e para produzir vagens que contém um elevado teor de açúcares hidrolisáveis, os quais podem gerar diversos compostos, incluindo etanol. Avaliou-se o uso de vagens de algaroba como substrato para produção de etanol por Z. mobilis UFPEDA-205 por meio de fermentação submersa. O processo fermentativo foi avaliado por meio da mensuração da taxa de conversão de substrato em etanol, taxa de produção de etanol e eficiência de fermentação. Os valores muito próximos encontrados para o fornecimento máximo teórico (170 g L-1 e experimental (165 g L-1 de etanol foram alcançados após 36 h de fermentação. O valor de contagem experimental

  19. Evaluation of ethanol production from pito mash using Zymomonas ...

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... dinitrosalicylic acid (DNS) method, while analysis of ethanol content was performed using gas chromatography. ... Keywords: Pito mash, agro-industrial wastes, Zymomonas mobilis, ethanol, reducing sugars. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  20. Fermentation potentials of Zymomonas mobilis and its application in ...

    African Journals Online (AJOL)

    GREGORY

    2010-09-13

    Sep 13, 2010 ... rate and lower biomass (Rogers et al., 2007; Jeffries,. 2005; Rogers et al., ... above experiments were performed twice with three repeats. Sweet potato material and ..... design trends and integration opportunities. Bioresour. ... Eckert CA, Frederick Jr. WJ, Hallett JP, Leak DJ, Liotta CL, Mielenz. JR, Murphy R ...

  1. Use of Saccharomyces cerevisiae and Zymomonas mobilis for ...

    African Journals Online (AJOL)

    Biofuels have received great attention as an alternative energy source mainly due to limited oil reserves. Bioethanol can be produced from wide range of raw materials like starch, sucrose and cellulosic based sources. Sugar beet and raw juice, as its intermediate product, constitute very profitable substrates for bioethanol ...

  2. Pantothenic acid biosynthesis in zymomonas

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Luan; Tomb, Jean-Francois; Viitanen, Paul V.

    2014-07-01

    Zymomonas is unable to synthesize pantothenic acid and requires this essential vitamin in growth medium. Zymomonas strains transformed with an operon for expression of 2-dehydropantoate reductase and aspartate 1-decarboxylase were able to grow in medium lacking pantothenic acid. These strains may be used for ethanol production without pantothenic acid supplementation in seed culture and fermentation media.

  3. Xylose utilization in recombinant zymomonas

    Science.gov (United States)

    Caimi, Perry G; McCole, Laura; Tao, Luan; Tomb, Jean-Francois; Viitanen, Paul V

    2014-03-25

    Xylose-utilizing Zymomonas strains studied were found to accumulate ribulose when grown in xylose-containing media. Engineering these strains to increase ribose-5-phosphate isomerase activity led to reduced ribulose accumulation, improved growth, improved xylose utilization, and increased ethanol production.

  4. Didemnin Biosynthetic Gene Cluster In Tistrella Mobilis

    KAUST Repository

    Qian, Pei-Yuan; Xu, Ying Sharon; Lai, Pok-Yui

    2014-01-01

    A novel Tistrella mobilis strain having Accession Deposit Number NRRL B-50531 is provided. A method of producing a didemnin precursor, didemnin or didemnin derivative by using the Tistrella mobilis strain, and the therapeutic composition comprising

  5. Didemnin Biosynthetic Gene Cluster In Tistrella Mobilis

    KAUST Repository

    Qian, Pei-Yuan

    2014-10-02

    A novel Tistrella mobilis strain having Accession Deposit Number NRRL B-50531 is provided. A method of producing a didemnin precursor, didemnin or didemnin derivative by using the Tistrella mobilis strain, and the therapeutic composition comprising at least one didemnin or didemnin derivative produced from the strain or modified strain thereof are also provided.

  6. Produção de levana e bioetanol utilizando cascas de banana por Zymomona mobilis

    OpenAIRE

    Ferreira, Juliana [UNESP

    2013-01-01

    Muitos países estão considerando razoável, e necessário, a curto e médio prazo, um constante investimento no estudo de formas, economicamente viáveis, de obtenção de fontes renováveis de energia, com grande destaque para a produção de etanol. O aproveitamento da matéria vegetal desperta grande interesse dos pesquisadores, cientistas e industriais, devido ao fato da mesma ser encontrada em grandes quantidades em vários tipos de resíduos. Por exemplo, só no Brasil, anualmente, tem-se uma geraçã...

  7. Investigation of potential of agro-industrial residues for ethanol production by using Candida tropicalis and Zymomonas mobilis

    Science.gov (United States)

    Patle, Sonali

    India is becoming more susceptible regarding energy security with increasing world prices of crude oil and increasing dependence on imports. Based on experiments by the Indian Institute of Petroleum, a 10% ethanol blend with gasoline is being considered for use in vehicles in at least one state and it will be mandatory for all oil companies to blend petrol with 10% ethanol from October 2008. In view of the above, the Government has already started supply of 5% ethanol blended petrol from 2003 in nine states and four contiguous Union Territories. Currently, fuel ethanol is produced mainly from molasses, corn, wheat and sugar beets. The production cost of ethanol from these agro-feedstocks is more than twice the price of gasoline. The high feedstock cost poses a major obstacle to large scale implementation of ethanol as a transportation fuel. Molasses could be in short supply due to the implementation of 10% blending norm. A reduction in import duty for industrial alcohol from7.5% to 5% has been suggested. The use of lignocellulosic energy crops, and particularly low cost biomass residues, offers excellent perspectives for application of ethanol in transportation fuels (Ridder, 2000). These materials will increase the ethanol production capacity and reduce the production cost to a competitive level. There is a huge demand (500 million litres) of ethanol to meet the 5% blending in India. With the present infrastructure, only 90 million litres of ethanol was produced till November 2006 and could reach up to 140 million litres (around) till October 2007. Bioethanol from these materials provides a highly cost effective option for CO2 emission reduction in the transportation sector. The aim of the present investigation was to evaluate the potential of biomass as feedstock for ethanol production. The dedicated energy crops would require thorough support as well as planning efforts such as assessing resources, availability and utilization. Furthermore, applied research is needed to develop environmentally and socially acceptable low-cost, high quality crops and cropping systems for producing sufficient quantities of value added biomass feedstock on substantially larger areas. This would require taking a look at environmental implications and economic assessments as over 70% of Indian population directly or indirectly depends on agricultural income sources. In other words, a long term strategy of intensive research would be required to get the desired level of acceptance both by the researchers and the farmers. This would mean long term field trials with the newly developed energy crops, awareness creation, and demonstration of visual benefits to farmers leading to change in mind-set towards greater flexibility for cropping patterns. This holds enormous promising research and development opportunities, but substantially longer period might be required to achieve these goals. The petroleum industry is now committed to the use of ethanol as fuel, as it is expected to benefit sugarcane farmers as well as the oil industry in the long run. Production of ethanol from agricultural and biodegradable wastes provides a viable solution to multiple environmental problems simultaneously creating a sink for waste and renewable energy production as well. Using ethanol-blended fuels for automobiles can significantly reduce petroleum use. Ethanol is one of the best tools to fight vehicular pollution, contains more oxygen that helps complete combustion of fuel and thus reduces harmful tailpipe emissions. It also reduces particulate emissions that pose a health hazard. Currently, fuel grade ethanol is produced from sugarcane, corn, wheat and sugar beets but the ethanol production cost from these substrates is very high as compared to gasoline. This high feedstock cost is the biggest hindrance in large scale implementation of ethanol as a transportation fuel. To counter the high feedstock costs, use of lignocellulosic materials, such as crop residues, grasses, sawdust, wood chips etc., can be promoted, which presents an inexpensive and abundant renewable source for ethanol production. Also there is an enormous production of fruits and vegetables in India and a very huge amount goes waste due to post-harvest losses and a large quantity of unused portion is also generated from processing industries. These substrates can be used as a potential source for ethanol production. These substrates are complex and are required to be broken down into simple sugars by acid, alkaline or enzymatic treatment. Two common methods for converting complex substrates to fermentable sugars are dilute acid hydrolysis and concentrated acid hydrolysis, both of which use either HCl or H2 So4. Since, acid hydrolysis has few disadvantages enzymatic hydrolysis was explored and found to be a better and more economic option. After substrate selection and its hydrolysis, it is very important to optimize the fermentation parameters and scale up the process. Different agro-industrial substrates were explored for this process. (Abstract shortened by UMI.)

  8. Pnp gene modification for improved xylose utilization in Zymomonas

    Science.gov (United States)

    Caimi, Perry G G; Qi, Min; Tao, Luan; Viitanen, Paul V; Yang, Jianjun

    2014-12-16

    The endogenous pnp gene encoding polynucleotide phosphorylase in the Zymomonas genome was identified as a target for modification to provide improved xylose utilizing cells for ethanol production. The cells are in addition genetically modified to have increased expression of ribose-5-phosphate isomerase (RPI) activity, as compared to cells without this genetic modification, and are not limited in xylose isomerase activity in the absence of the pnp modification.

  9. Les structures et le mobilier du site d’habitat Hallstatt final-La Tène ancienne d'Allaines Mervilliers (Eure-et-Loir Buildings and effects from the hallstatt D-Early La Tène site of Allaines Mervilliers (Eure-et-Loir

    Directory of Open Access Journals (Sweden)

    Diane Casadei

    2006-12-01

    Full Text Available Découverte de structures d’habitat sur poteaux et d’une fosse Hallstatt final-La Tène ancienne dans le cadre d’une opération d’archéologie préventive en 1998, à Allaines Mervilliers (Eure-et-Loir. Il s’agit de deux bâtiments rectangulaires à six trous de poteau, d’un bâtiment rectangulaire à trois nefs et d’un bâtiment circulaire. Ces deux derniers sont inédits pour cette époque en région Centre. Le bâtiment rectangulaire à trois nefs est composé de deux rangées centrales de trois trous de poteau et de deux rangées latérales de quatre trous de poteau. Les trous de poteau centraux présentent un remplissage stratifié dont la couche supérieure a livré l’essentiel de l’abondant mobilier découvert. On décompte par exemple dans les vestiges en céramique 56 individus-vases différents. Le bâtiment circulaire est composé d’une couronne de neuf trous de poteau présentant également un remplissage stratifié. On a découvert moins de mobilier dans cette structure que dans le bâtiment précédent, mais il se singularise aussi par la présence d’ossements humains.The discovery of settlement structureson posts and of a pit Hallstatt D-early La Tène during a rescue archaeology operation in 1998, in Allaines Mervilliers (Eure-et-Loir. It concerned two rectangular buildings of six post holes, a rectangular building in three naves and a circular building. The latter two are new for this period in the Centre region.The rectangular building in three naves consisted of two central rows of three post holes and two lateral rows of four post holes. The central holes of post introduce a stratified fill, the upper layer of which produced the majority of the abundant finds. From the ceramic remains it was estimated that there were fifty-six individuals in different vases. The circular building consisted of a ring of nine post holes also producing a stratified fill. Fewer articles were discovered in this structure than

  10. Le tecnologie mobili dell’apprendimento permanente, il progetto MOTILL

    Directory of Open Access Journals (Sweden)

    Marco Arrigo

    2013-03-01

    Full Text Available In questo articolo vengono presentati alcuni dei risultati del progetto MOTILL. MOTILL, ovvero «Le Tecnologie Mobili nell’apprendimento permanente: buone pratiche», è un progetto finanziato dalla Comunità Europea, nell’ambito del National Lifelong Learning Strategies (NLLS. Il progetto, durato un anno e terminato a Marzo 2010, si è focalizzato sull’uso delle tecnologie mobili in contesti di lifelong learning (LLL. L’articolo sarà dedicato a una breve introduzione del progetto, dei suoi obiettivi e delle azioni portate avanti, e a un rapido riassunto dei principali risultati ottenuti, i quali sono stati resi disponibili online alla comunità scientifica e diffusi ai policy makers impegnati nei programmi di apprendimento permanente.

  11. ORF Alignment: NC_006526 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ltransferase [Zymomonas mobilis subsp. mobilis ... ZM4] ... Length = 162 ... Query: 11 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE 70 ... IALYPGTFDPVTLGHLDIIRRGARIFD...HLIIAVAENPGKSPLFSSEERASMIRHEISRLE Sbjct: 1 ... IALYPGTFDPVTLGHLDIIRRGARIFDHLIIAVAENPGKSPLFSSEERASM

  12. A Comparison of Simple Rheological Parameters and Simulation Data for Zymomonas mobilis Fermentation Broths with High Substrate Loading in a 3-L Bioreactor

    Science.gov (United States)

    Um, Byung-Hwan; Hanley, Thomas R.

    Traditionally, as much as 80% or more of an ethanol fermentation broth is water that must be removed. This mixture is not only costly to separate but also produces a large aqueous stream that must then be disposed of or recycled. Integrative approaches to water reduction include increasing the biomass concentration during fermentation. In this paper, experimental results are presented for the rheological behavior of high-solids enzymatic cellulose hydrolysis and ethanol fermentation for biomass conversion using Solka Floc as the model feedstock. The experimental determination of the viscosity, shear stress, and shear rate relationships of the 10 to 20% slurry concentrations with constant enzyme concentrations are performed with a variable speed rotational viscometer (2.0 to 200 rpm) at 40 °C. The viscosities of enzymatic suspension observed were in range of 0.0418 to 0.0144, 0.233 to 0.0348, and 0.292 to 0.0447 Pa s for shear rates up to 100 reciprocal seconds at 10, 15, and 20% initial solids (w/v), respectively. Computational fluid dynamics analysis of bioreactor mixing demonstrates the change in bioreactor mixing with increasing biomass concentration. The portion-loading method is shown to be effective for processing highsolids slurries.

  13. Xylitol synthesis mutant of xylose-utilizing zymomonas for ethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Viitanen, Paul V.; Chou, Yat-Chen; McCutchen, Carol M.; Zhang, Min

    2010-06-22

    A strain of xylose-utilizing Zymomonas was engineered with a genetic modification to the glucose-fructose oxidoreductase gene resulting in reduced expression of GFOR enzyme activity. The engineered strain exhibits reduced production of xylitol, a detrimental by-product of xylose metabolism. It also consumes more xylose and produces more ethanol during mixed sugar fermentation under process-relevant conditions.

  14. Ethanol production using xylitol synthesis mutant of xylose-utilizing zymomonas

    Science.gov (United States)

    Viitanen, Paul V.; McCutchen, Carol M.; Emptage, Mark; Caimi, Perry G.; Zhang, Min; Chou, Yat-Chen

    2010-06-22

    Production of ethanol using a strain of xylose-utilizing Zymomonas with a genetic modification of the glucose-fructose oxidoreductase gene was found to be improved due to greatly reduced production of xylitol, a detrimental by-product of xylose metabolism synthesized during fermentation.

  15. Global occurrence and heterogeneity of the Roseobacter-clade species Ruegeria mobilis

    DEFF Research Database (Denmark)

    Sonnenschein, Eva; Nielsen, Kristian Fog; D'Alvise, Paul

    2017-01-01

    in the free-living fraction occurring in 40% and 6% of the samples, respectively. Our data and the TARA data, although lacking sufficient data from the polar regions, demonstrate that R. mobilis is a globally distributed marine bacterial species found primarily in the upper open oceans. It has preserved key....... Major genomic differences within the sub-clusters include prophages and toxin-antitoxin systems. In general, the genome of R. mobilis revealed adaptation to a particle-associated life style and querying TARA ocean data confirmed that R. mobilis is more abundant in the particle-associated fraction than...

  16. Environmental Factors Modulating the Stability and Enzymatic Activity of the Petrotoga mobilis Esterase (PmEst.

    Directory of Open Access Journals (Sweden)

    Jose L S Lopes

    Full Text Available Enzymes isolated from thermophilic organisms found in oil reservoirs can find applications in many fields, including the oleochemical, pharmaceutical, bioenergy, and food/dairy industries. In this study, in silico identification and recombinant production of an esterase from the extremophile bacteria Petrotoga mobilis (designated PmEst were performed. Then biochemical, bioinformatics and structural characterizations were undertaken using a combination of synchrotron radiation circular dichroism (SRCD and fluorescence spectroscopies to correlate PmEst stability and hydrolytic activity on different substrates. The enzyme presented a high Michaelis-Menten constant (KM 0.16 mM and optimum activity at ~55°C for p-nitrophenyl butyrate. The secondary structure of PmEst was preserved at acid pH, but not under alkaline conditions. PmEst was unfolded at high concentrations of urea or guanidine through apparently different mechanisms. The esterase activity of PmEst was preserved in the presence of ethanol or propanol and its melting temperature increased ~8°C in the presence of these organic solvents. PmEst is a mesophilic esterase with substrate preference towards short-to medium-length acyl chains. The SRCD data of PmEst is in agreement with the prediction of an α/β protein, which leads us to assume that it displays a typical fold of esterases from this family. The increased enzyme stability in organic solvents may enable novel applications for its use in synthetic biology. Taken together, our results demonstrate features of the PmEst enzyme that indicate it may be suitable for applications in industrial processes, particularly, when the use of polar organic solvents is required.

  17. Manual de boas práticas ambientais para a indústria do mobiliário de madeira

    OpenAIRE

    Ribeiro, Ricardo Cristiano Peixoto

    2015-01-01

    Este trabalho tem como finalidade a elaboração de um projeto na área ambiental denominado Manual de Boas Práticas Ambientais para a Indústria do Mobiliário de Madeira. Para conseguir atingir o objetivo proposto, inicialmente foi efetuado um breve enquadramento ao subsetor do mobiliário de madeira a nível nacional, recorrendo à bibliografia disponível apoiada em dados estatísticos de suporte. Foram caracterizados os dois concelhos alvo de estudo, Paços de Ferreira e Paredes por ...

  18. From lin-Benzoguanines to lin-Benzohypoxanthines as Ligands for Zymomonas mobilis tRNA-Guanine Transglycosylase: Replacement of Protein-Ligand Hydrogen Bonding by Importing Water Clusters.

    NARCIS (Netherlands)

    Barandun, L.J.; Immekus, F.; Kohler, P.C.; Tonazzi, S.; Wagner, B.; Wendelspiess, S.; Ritschel, T.; Heine, A.; Kansy, M.; Klebe, G.; Diederich, F.

    2012-01-01

    The foodborne illness shigellosis is caused by Shigella bacteria that secrete the highly cytotoxic Shiga toxin, which is also formed by the closely related enterohemorrhagic Escherichia coli (EHEC). It has been shown that tRNA-guanine transglycosylase (TGT) is essential for the pathogenicity of

  19. Host and symbiont intraspecific variability: The case of Paramecium calkinsi and "Candidatus Trichorickettsia mobilis".

    Science.gov (United States)

    Sabaneyeva, E; Castelli, M; Szokoli, F; Benken, K; Lebedeva, N; Salvetti, A; Schweikert, M; Fokin, S; Petroni, G

    2018-02-01

    Newly isolated strains of the ciliate Paramecium calkinsi and their cytoplasmic bacterial endosymbionts were characterized by a multidisciplinary approach, including live observation, ultrastructural investigation, and molecular analysis. Despite morphological resemblance, the characterized P. calkinsi strains showed a significant molecular divergence compared to conspecifics, possibly hinting for a cryptic speciation. The endosymbionts were clearly found to be affiliated to the species "Candidatus Trichorickettsia mobilis" (Rickettsiales, Rickettsiaceae), currently encompassing only bacteria retrieved in an obligate intracellular association with other ciliates. However, a relatively high degree of intraspecific divergence was observed as well, thus it was possible to split "Candidatus Trichorickettsia" into three subspecies, one of which represented so far only by the newly characterized endosymbionts of P. calkinsi. Other features distinguished the members of each different subspecies. In particular, the endosymbionts of P. calkinsi resided in the cytoplasm and possessed numerous peritrichous flagella, although no motility was evidenced, whereas their conspecifics in other hosts were either cytoplasmic and devoid of flagella, or macronuclear, displaying flagellar-driven motility. Moreover, contrarily to previously analyzed "Candidatus Trichorickettsia" hosts, infected P. calkinsi cells frequently became amicronucleate and demonstrated abnormal cell division, eventually leading to decline of the laboratory culture. Copyright © 2017 Elsevier GmbH. All rights reserved.

  20. Les objets mobiliers des XIXe et XXe siècles : les sources

    Directory of Open Access Journals (Sweden)

    Laurence de Finance

    2009-11-01

    Full Text Available L’étude scientifique de tout objet ne peut se concevoir sans une recherche dans les sources documentaires. Qu’il s’agisse d’archives publiques ou privées, de legs faits à des musées ou autres institutions patrimoniales, la quête de renseignements est une nécessité pour suivre l’objet étudié depuis sa création jusqu’à son étude faite in Situ. De nos jours, de nombreuses ressources sont mises en ligne, notamment sur le site du ministère de la culture et de la communication ; accessibles à tous, elles rendent plus aisées la localisation des sources et la consultation de leur contenu. A titre d’exemple, afin de faciliter l’étude du mobilier religieux du XIXe siècle, dont la production est alors en pleine expansion, des pages illustrées de plusieurs catalogues de fabricants sont aujourd’hui consultables en ligne.The scientific study of any object requires research in documentary sources. Whether these are private or public archives, legacies left to museums or other heritage institutions, the search for information is a necessity for understanding the life of the object, from its creation to its study in situ. Today, many types of documentary source are available on line, in particular on the website of the French Ministry of Culture. These sources are available to all and easy to consult. The example presented here, concerning the study of religious furnishings of the 19th and 20th centuries, the production of which increased considerably during these centuries, are the pages taken from the catalogues of several manufacturers of these church furnishings, today accessible on line.

  1. Biofilm formation and antibiotic production in Ruegeria mobilis are influenced by intracellular concentrations of cyclic dimeric guanosinmonophosphate

    DEFF Research Database (Denmark)

    D'Alvise, Paul; Magdenoska, Olivera; Melchiorsen, Jette

    2014-01-01

    species Ruegeria mobilis are associated with intracellular concentrations of the signal compound cyclic dimeric guanosinmonophosphate (c-di-GMP), which in bacteria regulates transitions between motile and sessile life stages. Genes for diguanylate cyclases and phosphodiesterases, which are involved in c-di-GMP...... signalling, were found in the genome of R. mobilis strain F1926. Ion pair chromatography-tandem mass spectrometry revealed 20-fold higher c-di-GMP concentrations per cell in biofilm-containing cultures than in planktonic cells. An introduced diguanylate cyclase gene increased c-di-GMP and enhanced biofilm...... formation and production of the potent antibiotic tropodithietic acid (TDA). An introduced phosphodiesterase gene decreased c-di-GMP and reduced biofilm formation and TDA production. tdaC, a key gene for TDA biosynthesis, was expressed only in attached or biofilm-forming cells, and expression was induced...

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 4751 - 4800 of 11090 ... Vol 10, No 62 (2011), Evaluation of drought tolerance in different ... Vol 15, No 30 (2016), Evaluation of ethanol production from pito mash using Zymomonas mobilis and Saccharomyces cerevisiae, Abstract PDF.

  3. Respective effects of sodium and chloride ion on physiological ...

    African Journals Online (AJOL)

    Respective effects of sodium and chloride ion on growth, cell morphological changes, membrane disorganization, ion homeostasis, exoenzyme activities and fermentation performance in Zymomonas mobilis232B cultures were presented. In batch cultures containing 0.15 M NaCl, Z. mobilis232B developed filaments, and ...

  4. Calcium chloride improve ethanol production in recombinant ...

    African Journals Online (AJOL)

    The T7-expression system has been very useful for protein expression in Escherichia coli. Here, a T7- expression transposon was constructed, which allowed simple construction of T7-expression Zymomonas mobilis. This transposon contained the T7 RNA polymerase being driven by the gap promoter from Z. mobilis.

  5. Les patrimoines mobiliers scientifique et technique : spécificités de leur restauration, de leur conservation et de leur valorisation

    Directory of Open Access Journals (Sweden)

    Philippe Tomsin

    2007-10-01

    Full Text Available Le patrimoine mobilier scientifique et technique, de par ses matériaux et les pathologies particulières qu'il connaît, pose des problèmes spécifiques en matière de conservation et de restauration. L'auteur inventorie les aspects de cette problématique, y compris la question cruciale des lieux de conservation et de valorisation de ce patrimoine particulier. Il propose à la réflexion quelques règles déontologiques.The scientific and technical movable heritage, because of its materials and special pathologies, gives some specific problems of conservation and restoration. The author inventories the aspects of these problems, including the crucial question of the places of conservation and valorisation of this particular heritage. He proposes a thought about some deontological rules.

  6. Etudes sur le mobilier Boulle, l'ébéniste de Louis XIV : quelques problèmes d'interfaces

    OpenAIRE

    Darque-Ceretti , Evelyne; Felder , Eric; Morini , Romain; Aucouturier , Marc; Paulin , Marc-André; Mathieu-Daudé , Agnès

    2010-01-01

    National audience; Dans le cadre d'un programme mis en place par le musée du Louvre, département des objets d'art, et le C2RMF, autour de l'étude et de la restauration des mobiliers attribués à l'atelier d'André-Charles Boulle ou à ses successeurs, il a été dégagé plusieurs problèmes concernant les marqueteries métalliques et les ornements en bronze doré. Cette communication traite en premier lieu de la compréhension de la mauvaise tenue au vieillissement des collages des pièces de marqueteri...

  7. Associação entre sensação de dor e desconforto pelos segmentos corporais, postura sentada do aluno em sala de aula e o mobiliário escolar (cadeira/mesa

    Directory of Open Access Journals (Sweden)

    Valdemir Galvão de Carvalho

    2008-09-01

    Full Text Available Na sala de aula é comum os alunos adotarem posturas inadequadas por tempo prolongado que conduzem ao desconforto muscular. O objetivo proposto é investigar associações entre dores no corpo e o mobiliário da sala de aula. Foi desenvolvida pesquisa aplicada, descritiva e quanti-qualitativa, amostra probabilística aleatória simples e questionário com 290 alunos, de 05 cursos de uma IES; as técnicas estatísticas foram análise descritiva, clusters e qui-quadrado com p ≤ 0,05. 64,2% dos alunos consideraram o mobiliário desconfortável; para 62%, a localização dos recursos didáticos não permite boa acomodação postural; para 84,5%, a altura e o assento das carteiras são desconfortáveis. Os resultados sugerem associação entre dores na região lombar, ombro, quadril, nuca, costas, pernas e joelhos em relação à ausência de regulagens antropométricas no mobiliário e a localização dos equipamentos didáticos.

  8. Food Grade Ehanol Production With Fermentation And Distillation Process Using Stem Sorghum

    Directory of Open Access Journals (Sweden)

    Yuliana Setyowati

    2015-03-01

    Full Text Available 10% -12% of sugar in its stem which is the optimum sugar concentration in fermentation process for bioethanol production. Sorghum has a high potential to be developed as a raw material for food-grade ethanol production which can be used to support food-grade ethanol demand in Indonesia through a fermentation process. This research focused on the effect of microorganism varieties in the fermentation process which are mutant Zymomonas mobilis (A3, Saccharomyces cerevisiae and Pichia stipitis mixture. The Research for purification process are separated into two parts, distillation with steel wool structured packing and dehydration process using molecular sieve and eliminating impurities using activated carbon. The research can be concluded that the best productivity shown in continuous fermentation in the amount of 84.049 (g / L.hr using the mixture of Saccharomyces cerevisiae and Pichia stipitis. The highest percentage of ethanol yield produced in batch fermentation using the mixture of Saccharomyces cerevisiae and Pichia stipitis that is equal to 51.269%. And for the adsorption, the best result shown in continuous fermentation by using Zymomonas Mobilis of 88.374%..

  9. AutoCAD 3D pour l'architecture et le design : conception d'une maison et de son mobilier

    CERN Document Server

    Riccio, Michel

    2010-01-01

    Module 3D d'AutoCAD, logiciel leader de dessin assisté par ordinateur, AutoCAD 3D est l'outil indispensable des architectes qui souhaitent présenter leurs travaux en trois dimensions. Voici donc un livre très pédagogique qui leur fera découvrir ses principales fonctionnalités (versions 2006 à 2010) à travers un projet de conception de maison contemporaine. Riche de 700 plans, schémas et dessins, il explique quels outils employer pour modéliser les façades d'une villa, sa piscine et sa terrasse, ainsi que son architecture intérieure et son mobilier. Dès les premières pages, le lecteur se retrouve ainsi plongé dans la pratique, voyant se construire au fil des 17 ateliers un édifice tridimensionnel complexe, qu'il aura la satisfaction d'avoir créé lui-même. A qui s'adresse ce livre ? Aux bureaux d'architectes qui souhaitent présenter leurs projets en 3D ; À tous les étudiants en écoles d'architecture ; Aux utilisateurs 2D d'AutoCAD qui désirent connaître les fonctions 3D de ce logiciel.

  10. Le comportement symbolique dans la Préhistoire de la Roumanie: art mobilier au Paléolithique supérieur en Moldavie

    Directory of Open Access Journals (Sweden)

    Corneliu BELDIMAN

    2009-12-01

    Full Text Available RÉSUMÉ: Les approches récentes des collections anciennes aussi bien que les découvertes des derniers décennies ont permis des discussions détaillés (concernant le répertoire, la typologie, la technologie, les dates radiométriques, etc. sur les rares documents d’art mobilier (parure, objets décorés et dites “non utilitaires” appartenant au Paléolithique supérieur (Gravettien oriental, autour 23-13 kya BP et provenant de la Moldavie roumaine –région Est du pays, comprise entre les Carpates et la rivière Prut–. Les 29 artefacts signalés ont été découvertes en 6 sites de plein aire et dans un site en grotte. Les types identifiés sont: bâtons percés sur métatarse de cheval et sur bois de renne; pendeloques lithiques et en os; rondelle en bois de renne; dents percées; objets lithiques en quartzite et graphite; objets gravés et encochés lithiques et en os; harpon décoré; fragment de défense de mammouth ayant des traces de débitage et façonnage; coquilles fossiles appartenant à l’espèce Congeria?; coquilles percées appartenant à l’espèce Succinea oblonga? ou Lithoglyphus naticoides? La plupart des artéfacts ont une signification spéciale pour le phénomène de l’art et de la technologie préhistorique de la région envisagée: il s’agit des pendeloques de Mitoc, dép. de Botosani et de fragment d’os gravé d’une représentation de patte d’animal? de Piatra Neamt, dép. de Neamt. Une autre pièce exceptionnelle c’est le fragment de défense de mammouth de Lespezi, dép. de Bacau portant sur l’extrémité proximale des traces de débitage par entaillage et probablement par sciage à la ficelle; cela peut être le plus ancienne situation de cette sorte signalée dans cette partie de l’Europe. Tenant compte du fait que les objets en ivoire de mammouth sont apparitions extrêmement rares dans le Paléolithique supérieur de la Roumanie et les analogies on peut envisager la provenance de cet

  11. Comparative study of bioethanol production from sugarcane ...

    African Journals Online (AJOL)

    The study was designed to compare the bioethanol production from Zymomonas mobilis and Saccharomyces cerevisiae using molasses as production medium. The focus was on the retention time at lab scale. Bioethanol and petroleum blend can be used in existing gasoline engines. Present study showed a more ...

  12. High production of fructooligosaccharides by levansucrase from ...

    African Journals Online (AJOL)

    SAM

    2014-07-02

    Jul 2, 2014 ... production activity of Zymomonas mobilis extracellular levansucrase. Process. Biochem. 38:701-706. http://dx.doi.org/10.1016/S0032-. 9592(02)00189-9. Belghith KM, Dahech I, Belghith H, Mejoud H (2012). Microbial production of levansucrase for synthesis of fructo-oligosaccharide. Int. J. Biol. Macromol.

  13. Reproductive performance of female goats fed life-enzyme ...

    African Journals Online (AJOL)

    Direct-fed-microbes (DFM) (life-enzyme) was prepared in a traditional setting using Zymomonas mobilis (bacteria from palm sap) to ferment sawdust. The result revealed an improvement in the nutrient content of the sawdust and its feed values (protein, fibre etc.), and the feed usage efficiency. The reproductive ...

  14. Biological conversion system

    Science.gov (United States)

    Scott, C.D.

    A system for bioconversion of organic material comprises a primary bioreactor column wherein a biological active agent (zymomonas mobilis) converts the organic material (sugar) to a product (alcohol), a rejuvenator column wherein the biological activity of said biological active agent is enhanced, and means for circulating said biological active agent between said primary bioreactor column and said rejuvenator column.

  15. Nancy Dowe | NREL

    Science.gov (United States)

    Bench scale integration and scale up of biological processes to produce fuels and chemicals from Zymomonas mobilis strain 8b through continuous adaptation on dilute acid pretreated corn stover hydrolysate development and integration. Please do NOT contact me directly for jobs-see instead information on NREL's

  16. Problemas posturais X mobiliário: uma investigação ergonômica junto aos usuários de microcomputadores de uma escola de enfermagem Posture problems X furniture: an ergonomic investigation with the personal computer users from a nursing school

    Directory of Open Access Journals (Sweden)

    Maria Helena Versiani Maciel

    1997-12-01

    Full Text Available A utilização de microcomputadores tem se tornado imprescindível atualmente e o pessoal de enfermagem, de encontro a esse avanço tecnológico vem incorporando o em sua prática, a qual é iniciada no curso de graduação. Como usuários da seção de informática de uma escola de enfermagem passamos a observar queixas de alunos em relação a adequação dos mobiliários utilizados. Interessou-nos então, desenvolver este estudo que teve por objetivo analisar os mobiliários da, sala de informática com vistas às recomendações ergonômicas e identificar as posturas corporais adotadas pelos alunos na realização da atividade de digitação. Os procedimentos utilizados foram executados em 3 fases, observação livre do ambiente físico e mensuração dos mobiliários, observação das posturas corporais e entrevistas. Os resultados apontaram que o mobiliário utilizado é inadequado no que se refere a: bancada fixa, sem apoio para os pés, sem porta documentos; as cadeiras não são reguláveis, tem largura, do encosto fora dos padrões recomendados, não possuem braços e rodas, só tem quatro pés e tem, revestimento escorregadio e duro. Apenas em 18,6% do período observado foi adotada a postura considerada ideal para atividade de digitação, ou seja, coluna vertebral ereta,, cotovelos na altura do nível da bancada, pernas fletidas e pés apoiados. Sugere-se o planejamento de postos de trabalho para digitação a partir de dados relativos as medidas antropométricas dos usuários e da utilização de mobiliários adequados, a fim de que se possa oh ter um conjunto harmonioso entre mobiliário, ambiente e usuário proporcionando conforto e evitando problemas de saúde.The computer usage has become essential nowadays and the Nursing staff meeting this technological improvement has been assimilating it in practice, which is started in Graduation course. As users of the computer division from a Nursing School we have observed students

  17. Identification of yeast and bacteria involved in the mezcal fermentation of Agave salmiana.

    Science.gov (United States)

    Escalante-Minakata, P; Blaschek, H P; Barba de la Rosa, A P; Santos, L; De León-Rodríguez, A

    2008-06-01

    To identify the yeast and bacteria present in the mezcal fermentation from Agave salmiana. The restriction and sequence analysis of the amplified region, between 18S and 28S rDNA and 16S rDNA genes, were used for the identification of yeast and bacteria, respectively. Eleven different micro-organisms were identified in the mezcal fermentation. Three of them were the following yeast: Clavispora lusitaniae, Pichia fermentans and Kluyveromyces marxianus. The bacteria found were Zymomonas mobilis subsp. mobilis and Zymomonas mobilis subsp. pomaceae, Weissella cibaria, Weissella paramesenteroides, Lactobacillus pontis, Lactobacillus kefiri, Lactobacillus plantarum and Lactobacillus farraginis. The phylogenetic analysis of 16S rDNA and ITS sequences showed that microbial diversity present in mezcal is dominated by bacteria, mainly lactic acid bacteria species and Zymomonas mobilis. Pichia fermentans and K. marxianus could be micro-organisms with high potential for the production of some volatile compounds in mezcal. We identified the community of bacteria and yeast present in mezcal fermentation from Agave salmiana.

  18. Alcohol production from pineapple waste

    Energy Technology Data Exchange (ETDEWEB)

    Ban-Koffi, L. (Ministry of Scientific Research, Abidjan (CI). Ivorian Center of Technological Research); Han, Y.W. (USDA, Southern Regional Research Center, New Orleans, LA (US))

    1990-09-01

    Saccharomyces cerevisiae and Zymomonas mobilis were grown on pineapple waste and their alcohol production characteristics compared. The pineapple waste consisted of 19% cellulose, 22% hemi-cellulose, 5% lignin and 53% cell soluble matters but concentration of soluble sugars, which included 5.2% sucrose, 3.1% glucose and 3.4% fructose, was relatively low and pretreatment of the substrate was needed. Pretreatment of pineapple waste with cellulase and hemi-cellulase and then fermentation with S. cerevisiae or Z. mobilis produced about 8% ethanol from pineapple waste in 48 h. (author).

  19. Structuralism.

    Science.gov (United States)

    Piaget, Jean

    Provided is an overview of the analytical method known as structuralism. The first chapter discusses the three key components of the concept of a structure: the view of a system as a whole instead of so many parts; the study of the transformations in the system; and the fact that these transformations never lead beyond the system but always…

  20. ORF Alignment: NC_003384 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Zymomonas mobilis] gb|AAQ67239.1| ... Bla [Transposon delivery vector pUT-miniTn5-gfp-tet] ... ... ... 3.5.2.6) precursor - Escherichia coli plasmids ... gb|AAC79082.1| beta lactamase [Transposon delivery...AG47772.1| beta-lactamase ... TEM-1 [Klebsiella pneumoniae] gb|AAG37887.1| ampicillin ... resistance [Tn10 delivery... vector pHV1249] gb|AAG37882.1| ... ampicillin resistance [Tn10 delivery

  1. Summerhouse dialogues between mobilier and immobilier

    DEFF Research Database (Denmark)

    Reeh, Henrik

    2017-01-01

    Addressing processes of cultural memory and mental appropriation in leisure architecture, this study relies on the fact that, in Denmark, summerhouses are often sold with furniture and objects representing the former owners and their ways of life. The theoretical starting point is formed by a dis......Addressing processes of cultural memory and mental appropriation in leisure architecture, this study relies on the fact that, in Denmark, summerhouses are often sold with furniture and objects representing the former owners and their ways of life. The theoretical starting point is formed...

  2. Bacterial community structure of a full-scale biofilter treating pig house exhaust air

    DEFF Research Database (Denmark)

    Kristiansen, Anja; Pedersen, Kristina Hadulla; Nielsen, Per Halkjær

    2011-01-01

    Biological air filters represent a promising tool for treating emissions of ammonia and odor from pig facilities. Quantitative fluorescence in situ hybridization (FISH) and 16S rRNA gene sequencing were used to investigate the bacterial community structure and diversity in a full-scale biofilter ...... consisting of two consecutive compartments (front and back filter). The analysis revealed a highly specialized bacterial community of limited diversity, dominated by a few groups of Betaproteobacteria (especially Comamonas) and diverse Bacteroidetes. Actinobacteria, Gammaproteobacteria......, and betaproteobacterial ammoniaoxidizers (Nitrosomonas eutropha/Nitrosococcus mobilis-lineage) were also quantitatively important. Only a few quantitative differences existed between the two filter compartments at the group level, with a lower relative abundance of Actinobacteria and a higher relative abundance...

  3. Contabilização de títulos e valores mobiliários: uma comparação entre as normas brasileiras, do FASB e do IASB Accounting treatment of debt and equity securities: a comparison among brazilian, FASB and IASB standards

    Directory of Open Access Journals (Sweden)

    Alceu Haruo Fuji

    2008-08-01

    Full Text Available Em 2001, o Banco Central do Brasil emitiu a Circular 3.068, determinando a utilização do valor de mercado para avaliar os títulos e valores mobiliários. A Circular 3.068/01 determina que os títulos e valores mobiliários devem ser classificados numa das seguintes categorias: negociação, disponíveis para venda e mantidos até o vencimento. Os títulos para negociação e os disponíveis para venda devem ser avaliados e registrados pelo seu valor de mercado e os mantidos até o vencimento devem ser registrados pelo seu custo histórico. O objetivo deste trabalho é estudar a forma de contabilização de títulos adotada no Brasil, especialmente as normas definidas para as instituições financeiras, em comparação com as normas do FASB e IASB. A comparação da forma de contabilização de títulos adotada no Brasil (Circular 3.068/01 com os pronunciamentos do FASB (SFAS 115 e IASB (IAS 39 mostrou que, nos aspectos relevantes, as regras estão em harmonia, embora algumas diferenças pequenas tenham sido identificadas.In 2001, the Brazilian Central Bank issued Circular letter 3.068, determining the use of market value to evaluate debt and equity securities. This letter states that debt and equity securities must be classified in one of the following categories: trading, available for sale and held to maturity. The securities for trading and available for sale have to be evaluated and reported by their market value and those held to maturity must be reported by historical cost. The purpose of this work is to study the accounting methods of securities adopted in Brazil, especially those rules stated to financial institutions, in comparison with the statement of FASB and IASB. The comparison of the accounting methods of securities adopted in Brazil (Circular 3.068/01 with the statements of FASB (SFAS 115 and IASB (IAS 39 showed that, in the main aspects, the rules are in harmony, although some minor differences have been identified.

  4. Technique of ethanol food grade production with batch distillation and dehydration using starch-based adsorbent

    Science.gov (United States)

    Widjaja, Tri; Altway, Ali; Ni'mah, Hikmatun; Tedji, Namira; Rofiqah, Umi

    2015-12-01

    Development and innovation of ethanol food grade production are becoming the reasearch priority to increase economy growth. Moreover, the government of Indonesia has established regulation for increasing the renewable energy as primary energy. Sorghum is cerealia plant that contains 11-16% sugar that is optimum for fermentation process, it is potential to be cultivated, especially at barren area in Indonesia. The purpose of this experiment is to learn about the effect of microorganisms in fermentation process. Fermentation process was carried out batchwise in bioreactor and used 150g/L initial sugar concentration. Microorganisms used in this experiment are Zymomonas mobilis mutation (A3), Saccharomyces cerevisiae and mixed of Pichia stipitis. The yield of ethanol can be obtained from this experiment. For ethanol purification result, distillation process from fermentation process has been done to search the best operation condition for efficiency energy consumption. The experiment for purification was divided into two parts, which are distillation with structured packing steel wool and adsorption (dehydration) sequencely. In distillation part, parameters evaluation (HETP and pressure drop) of distillation column that can be used for scale up are needed. The experiment was operated at pressure of 1 atm. The distillation stage was carried out at 85 °C and reflux ratio of 0.92 with variety porosities of 20%, 40%, and 60%. Then the adsorption process was done at 120°C and two types of adsorbent, which are starch - based adsorbent with ingredient of cassava and molecular sieve 3A, were used. The adsorption process was then continued to purify the ethanol from impurities by using activated carbon. This research shows that the batch fermentation process with Zymomonas mobilis A3 obtain higher % yield of ethanol of 40,92%. In addition to that, for purification process, the best operation condition is by using 40% of porosity of stuctured packing steel wool in distillation

  5. Caçambas coletoras de resíduos da construção e demolição no contexto do mobiliário urbano: uma questão de saúde pública e ambiental Containers for construction and demolition waste as urban furnishing: an environmental and public health issue

    Directory of Open Access Journals (Sweden)

    Joyce Maria de Araujo

    2007-04-01

    Full Text Available A utilização de caçambas metálicas em áreas públicas para acondicionar resíduos da construção e demolição-RCD tem sido incrementada, em cidades brasileiras, a partir da década de 1990, contribuindo para o adensamento do mobiliário urbano e modificando a paisagem urbana. Este equipamento é utilizado para confinar os resíduos de modo a impedir sua dispersão no ambiente, facilitar sua coleta e transporte e evitar a exposição de moradores e transeuntes. A despeito dessas vantagens, as caçambas representam um perigo ao ambiente e à saúde pública. Com objetivo de verificar a interferência das caçambas nas ruas e calçadas e identificar situações de risco, foi realizado um estudo de campo envolvendo 58 caçambas estacionadas em 5 diferentes bairros da cidade de São Paulo. Aspectos como localização e disposição, identificação e uso de pintura reflexiva para prevenção de acidentes com veículos automotivos e conteúdo da caçamba foram observados. Os resultados indicaram a presença de não-conformidades, na maioria dos casos observados, como: localização inadequada, pintura reflexiva não existente ou apagada, quantidade excessiva de resíduos, presença de matéria orgânica ou resíduos perigosos, objetos cortantes ou pontiagudos extrapolando os limites da caçamba, dentre outros. Conclui-se que é necessário desenvolver uma abordagem integrada e ecossistêmica para estes elementos do mobiliário urbano, de modo a contemplar, além da questão de gerenciamento dos RCD, aspectos de saúde pública e ambiental e, ao mesmo tempo, preservar os valores estéticos e a paisagem urbana. Dessa forma, o emprego de caçambas coletoras de RCD pode trazer benefícios que contribuam para a qualidade de vida nas cidades brasileiras.The use of metallic waste containers in public areas for storage of construction and demolition wastes-C&D debris was introduced in Brazilian cities in the 1990's, becoming a piece of urban

  6. Economic and process optimization of ethanol production by extractive fermentation

    Energy Technology Data Exchange (ETDEWEB)

    1992-01-01

    This report demonstrates by computer simulation the economic advantages of extractive fermentation on an industrial scale compared to the best alternative technology currently available. The simulations were based on a plant capacity of 100 x 10 6 L/y of azeotropic ethanol. The simulation results were verified with a fully integrated, computer controlled extractive fermentation process demonstration unit based around a 7 L fermentor operated with a synthetic glucose medium and using Saccharomyces cerevisiae. The system was also operated with natural substrates (blackstrap molasses and grain hydrolyzate). Preliminary tests with the organism Zymomonas mobilis were also carried out under extractive fermentation conditions.

  7. Rewiring Lactococcus lactis for Ethanol Production

    DEFF Research Database (Denmark)

    Solem, Christian; Dehli, Tore Ibsen; Jensen, Peter Ruhdal

    2013-01-01

    to redirect the metabolism of LAB model organism Lactococcus lactis toward ethanol production. Codon-optimized Zymomonas mobilis pyruvate decarboxylase (PDC) was introduced and expressed from synthetic promoters in different strain backgrounds. In the wild-type L. lactis strain MG1363 growing on glucose, only...... small amounts of ethanol were obtained after introducing PDC, probably due to a low native alcohol dehydrogenase activity. When the same strains were grown on maltose, ethanol was the major product and lesser amounts of lactate, formate, and acetate were formed. Inactivating the lactate dehydrogenase...... genes ldhX, ldhB, and ldh and introducing codon-optimized Z. mobilis alcohol dehydrogenase (ADHB) in addition to PDC resulted in high-yield ethanol formation when strains were grown on glucose, with only minor amounts of by-products formed. Finally, a strain with ethanol as the sole observed...

  8. Exometabolomics Assisted Design and Validation of Synthetic Obligate Mutualism.

    Science.gov (United States)

    Kosina, Suzanne M; Danielewicz, Megan A; Mohammed, Mujahid; Ray, Jayashree; Suh, Yumi; Yilmaz, Suzan; Singh, Anup K; Arkin, Adam P; Deutschbauer, Adam M; Northen, Trent R

    2016-07-15

    Synthetic microbial ecology has the potential to enhance the productivity and resiliency of biotechnology processes compared to approaches using single isolates. Engineering microbial consortia is challenging; however, one approach that has attracted significant attention is the creation of synthetic obligate mutualism using auxotrophic mutants that depend on each other for exchange or cross-feeding of metabolites. Here, we describe the integration of mutant library fitness profiling with mass spectrometry based exometabolomics as a method for constructing synthetic mutualism based on cross-feeding. Two industrially important species lacking known ecological interactions, Zymomonas mobilis and Escherichia coli, were selected as the test species. Amino acid exometabolites identified in the spent medium of Z. mobilis were used to select three corresponding E. coli auxotrophs (proA, pheA and IlvA), as potential E. coli counterparts for the coculture. A pooled mutant fitness assay with a Z. mobilis transposon mutant library was used to identify mutants with improved growth in the presence of E. coli. An auxotroph mutant in a gene (ZMO0748) with sequence similarity to cysteine synthase A (cysK), was selected as the Z. mobilis counterpart for the coculture. Exometabolomic analysis of spent E. coli medium identified glutathione related metabolites as potentially available for rescue of the Z. mobilis cysteine synthase mutant. Three sets of cocultures between the Z. mobilis auxotroph and each of the three E. coli auxotrophs were monitored by optical density for growth and analyzed by flow cytometry to confirm high cell counts for each species. Taken together, our methods provide a technological framework for creating synthetic mutualisms combining existing screening based methods and exometabolomics for both the selection of obligate mutualism partners and elucidation of metabolites involved in auxotroph rescue.

  9. Evaluation of ethanol production from pito mash using Zymomonas ...

    African Journals Online (AJOL)

    Joseph Asankomah Bentil

    technology for the conversion of lignocelluloses to bioethanol should be decided on the basis of overall economics (lowest cost), environmental (pollutants), and energy (higher efficiencies). Many investigations have been performed on the appropriate technology for the conversion of the lignocellulosic to ethanol as well as.

  10. Link2U: un social network aumentato su dispositivi mobili

    Directory of Open Access Journals (Sweden)

    Monica Sebillo

    2012-04-01

    Full Text Available Negli ultimi anni il connubio mobile entertainment e social network ha attirato un notevole interesse da parte dispecifici settori che, nonostante le criticità del momento, hanno deciso di investire nella realizzazione di ambienti esoluzioni di intrattenimento/divertimento, un fattore chiave alla base del miglioramento della tecnologia.Link2U: augmenting social networks on mobile devicesNowadays, modern mobile devices have become real person-al  computers  that  increase  the  ability  of  building/extending existing applications by combining several technologies such as camera, GPS, 3D graphics and permanent Internet connec-tion. The  resulting  integration  of  such  technologies  allows  to  run complex  applications,  such  as  augmented  reality  and  Social Networks. The goal of our current research is to support mobile users’ daily activities, by developing advanced solutions which take into account principles of human-computer interac-tion and usability. In this paper we propose to exploit the potential of the aug-mented reality and the ability to communicate of social net-works to create a mobile social network, where each commu-nity user may exploit advanced location based services, such as navigation through a two dimensional map, exploration of an area through a camera mode, and identification of points of interest embedded in an augmented reality environment.

  11. Link2U: un social network aumentato su dispositivi mobili

    Directory of Open Access Journals (Sweden)

    Monica Sebillo

    2012-04-01

    Full Text Available Negli ultimi anni il connubio mobile entertainment e social network ha attirato un notevole interesse da parte dispecifici settori che, nonostante le criticità del momento, hanno deciso di investire nella realizzazione di ambienti esoluzioni di intrattenimento/divertimento, un fattore chiave alla base del miglioramento della tecnologia. Link2U: augmenting social networks on mobile devices Nowadays, modern mobile devices have become real person-al  computers  that  increase  the  ability  of  building/extending existing applications by combining several technologies such as camera, GPS, 3D graphics and permanent Internet connec-tion. The  resulting  integration  of  such  technologies  allows  to  run complex  applications,  such  as  augmented  reality  and  Social Networks. The goal of our current research is to support mobile users’ daily activities, by developing advanced solutions which take into account principles of human-computer interac-tion and usability. In this paper we propose to exploit the potential of the aug-mented reality and the ability to communicate of social net-works to create a mobile social network, where each commu-nity user may exploit advanced location based services, such as navigation through a two dimensional map, exploration of an area through a camera mode, and identification of points of interest embedded in an augmented reality environment.

  12. Strumenti Urbani. Tecnologie mobili come dispositivi di improvvisazione corporea

    Directory of Open Access Journals (Sweden)

    Elena Biserna

    2013-06-01

    Full Text Available Dal Walkman ai lettori MP3, negli ultimi decenni le tecnologie audio portatili sono prepotentemente entrate in abitudini e rituali quotidiani, assumendo un ruolo sostanziale nella cultura uditiva e urbana ma anche, e soprattutto, nelle nostre modalità di attraversare gli spazi. L’uso di questi objets nomades (Attali 1977 interviene non solo sulle forme di consumo musicale, ma anche sul rapporto con lo spazio, con il contesto attraversato

  13. The mobilies of chiral molecular cluster ions in He gas

    International Nuclear Information System (INIS)

    Saito, Kazuyuki; Matoba, Shiro; Koizumi, Tetsuo; Kojima, Takao M; Tanuma, Hajime; Shiromaru, Haruo

    2012-01-01

    We measured the mobilities of Li + -(2-butanol) and Li + -(limonene) ions in He gas at room temperature using a drift tube mass spectrometer. The zero field mobilities of Li + -(2-Butanol) and Li + -(Limonene) were much lower than the polarization limit, indicating that the geometric collision cross-sections between the cluster ions and He atom were larger than the cross-sections predicted by the presence of a polarization force alone.

  14. Ethanol production of banana shell and cassava starch

    International Nuclear Information System (INIS)

    Monsalve G, John F; Medina de Perez, Victoria Isabel; Ruiz colorado, Angela Adriana

    2006-01-01

    In this work the acid hydrolysis of the starch was evaluated in cassava and the cellulose shell banana and its later fermentation to ethanol, the means of fermentation were adjusted for the microorganisms saccharomyces cerevisiae nrrl y-2034 and zymomonas mobilis cp4. The banana shell has been characterized, which possesses a content of starch, cellulose and hemicelluloses that represent more than 80% of the shell deserve the study of this as source of carbon. The acid hydrolysis of the banana shell yield 20g/l reducing sugar was obtained as maximum concentration. For the cassava with 170 g/l of starch to ph 0.8 in 5 hours complete conversion is achieved to you reducing sugars and any inhibitory effect is not noticed on the part of the cultivations carried out with banana shell and cassava by the cyanide presence in the cassava and for the formation of toxic compounds in the acid hydrolysis the cellulose in banana shell. For the fermentation carried out with saccharomyces cerevisiae a concentration of ethanol of 7.92± 0.31% it is achieved and a considerable production of ethanol is not appreciated (smaller than 0.1 g/l) for none of the means fermented with zymomonas mobilis

  15. Monitoring microbial growth and activity using spectral induced polarization and low-field nuclear magnetic resonance

    Science.gov (United States)

    Zhang, Chi; Keating, Kristina; Revil, Andre

    2015-04-01

    Microbes and microbial activities in the Earth's subsurface play a significant role in shaping subsurface environments and are involved in environmental applications such as remediation of contaminants in groundwater and oil fields biodegradation. Stimulated microbial growth in such applications could cause wide variety of changes of physical/chemical properties in the subsurface. It is critical to monitor and determine the fate and transportation of microorganisms in the subsurface during such applications. Recent geophysical studies demonstrate the potential of two innovative techniques, spectral induced polarization (SIP) and low-field nuclear magnetic resonance (NMR), for monitoring microbial growth and activities in porous media. The SIP measures complex dielectric properties of porous media at low frequencies of exciting electric field, and NMR studies the porous structure of geologic media and characterizes fluids subsurface. In this laboratory study, we examined both SIP and NMR responses from bacterial growth suspension as well as suspension mixed with silica sands. We focus on the direct contribution of microbes to the SIP and NMR signals in the absence of biofilm formation or biomineralization. We used Zymomonas mobilis and Shewanella oneidensis (MR-1) for SIP and NMR measurements, respectively. The SIP measurements were collected over the frequency range of 0.1 - 1 kHz on Z. mobilis growth suspension and suspension saturated sands at different cell densities. SIP data show two distinct peaks in imaginary conductivity spectra, and both imaginary and real conductivities increased as microbial density increased. NMR data were collected using both CPMG pulse sequence and D-T2 mapping to determine the T2-distribution and diffusion properties on S. oneidensis suspension, pellets (live and dead), and suspension mixed with silica sands. NMR data show a decrease in the T2-distribution in S. oneidensis suspension saturated sands as microbial density increase. A

  16. Bioethanol production from leafy biomass of mango (Mangifera indica) involving naturally isolated and recombinant enzymes.

    Science.gov (United States)

    Das, Saprativ P; Ravindran, Rajeev; Deka, Deepmoni; Jawed, Mohammad; Das, Debasish; Goyal, Arun

    2013-01-01

    The present study describes the usage of dried leafy biomass of mango (Mangifera indica) containing 26.3% (w/w) cellulose, 54.4% (w/w) hemicellulose, and 16.9% (w/w) lignin, as a substrate for bioethanol production from Zymomonas mobilis and Candida shehatae. The substrate was subjected to two different pretreatment strategies, namely, wet oxidation and an organosolv process. An ethanol concentration (1.21 g/L) was obtained with Z. mobilis in a shake-flask simultaneous saccharification and fermentation (SSF) trial using 1% (w/v) wet oxidation pretreated mango leaves along with mixed enzymatic consortium of Bacillus subtilis cellulase and recombinant hemicellulase (GH43), whereas C. shehatae gave a slightly higher (8%) ethanol titer of 1.31 g/L. Employing 1% (w/v) organosolv pretreated mango leaves and using Z. mobilis and C. shehatae separately in the SSF, the ethanol titers of 1.33 g/L and 1.52 g/L, respectively, were obtained. The SSF experiments performed with 5% (w/v) organosolv-pretreated substrate along with C. shehatae as fermentative organism gave a significantly enhanced ethanol titer value of 8.11 g/L using the shake flask and 12.33 g/L at the bioreactor level. From the bioreactor, 94.4% (v/v) ethanol was recovered by rotary evaporator with 21% purification efficiency.

  17. Structural cladding /clad structures:

    DEFF Research Database (Denmark)

    Beim, Anne

    2013-01-01

    tendencies, which can be traced in the use of materials, the structural features and the construction details of building systems in selected architectural works. With a particular focus at heavy constructions made of solid wood and masonry, and light weight constructions made of wooden frame structures...... and steel profiles, it is the intention to analyze, compare, and discuss how these various construction solutions point out strategies for development based on fundamentally different mindsets. The research questions address the following issues: How to learn from traditional construction principles: When...

  18. CONTROL BASED ON NUMERICAL METHODS AND RECURSIVE BAYESIAN ESTIMATION IN A CONTINUOUS ALCOHOLIC FERMENTATION PROCESS

    Directory of Open Access Journals (Sweden)

    Olga L. Quintero

    Full Text Available Biotechnological processes represent a challenge in the control field, due to their high nonlinearity. In particular, continuous alcoholic fermentation from Zymomonas mobilis (Z.m presents a significant challenge. This bioprocess has high ethanol performance, but it exhibits an oscillatory behavior in process variables due to the influence of inhibition dynamics (rate of ethanol concentration over biomass, substrate, and product concentrations. In this work a new solution for control of biotechnological variables in the fermentation process is proposed, based on numerical methods and linear algebra. In addition, an improvement to a previously reported state estimator, based on particle filtering techniques, is used in the control loop. The feasibility estimator and its performance are demonstrated in the proposed control loop. This methodology makes it possible to develop a controller design through the use of dynamic analysis with a tested biomass estimator in Z.m and without the use of complex calculations.

  19. [Optimization of fuel ethanol production from kitchen waste by Plackett-Burman design].

    Science.gov (United States)

    Ma, Hong-Zhi; Gong, Li-Juan; Wang, Qun-Hui; Zhang, Wen-Yu; Xu, Wen-Long

    2008-05-01

    Kitchen garbage was chosen to produce ethanol through simultaneous saccharification and fermentation (SSF) by Zymomonas mobilis. Plackett-Burman design was employed to screen affecting parameters during SSF process. The parameters were divided into two parts, enzymes and nutritions. None of the nutritions added showed significant effect during the experiment, which demonstrated that the kitchen garbage could meet the requirement of the microorganism without extra supplementation. Protease and glucoamylase were determined to be affecting factors for ethanol production. Single factor experiment showed that the optimum usage of these two enzymes were both 100 U/g and the corresponding maximum ethanol was determined to be 53 g/L. The ethanol yield could be as high as 44%. The utilization of kitchen garbage to produce ethanol could reduce threaten of waste as well as improve the protein content of the spent. This method could save the ethanol production cost and benefit for the recycle of kitchen garbage.

  20. Microbial stress tolerance for biofuels. Systems biology

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Zonglin Lewis (ed.) [National Center for Agricultural Utilization Research, USDA-ARS, Peoria, IL (United States)

    2012-07-01

    The development of sustainable and renewable biofuels is attracting growing interest. It is vital to develop robust microbial strains for biocatalysts that are able to function under multiple stress conditions. This Microbiology Monograph provides an overview of methods for studying microbial stress tolerance for biofuels applications using a systems biology approach. Topics covered range from mechanisms to methodology for yeast and bacteria, including the genomics of yeast tolerance and detoxification; genetics and regulation of glycogen and trehalose metabolism; programmed cell death; high gravity fermentations; ethanol tolerance; improving biomass sugar utilization by engineered Saccharomyces; the genomics on tolerance of Zymomonas mobilis; microbial solvent tolerance; control of stress tolerance in bacterial host organisms; metabolomics for ethanologenic yeast; automated proteomics work cell systems for strain improvement; and unification of gene expression data for comparable analyses under stress conditions. (orig.)

  1. Conceptual design of cost-effective and environmentally-friendly configurations for fuel ethanol production from sugarcane by knowledge-based process synthesis.

    Science.gov (United States)

    Sánchez, Óscar J; Cardona, Carlos A

    2012-01-01

    In this work, the hierarchical decomposition methodology was used to conceptually design the production of fuel ethanol from sugarcane. The decomposition of the process into six levels of analysis was carried out. Several options of technological configurations were assessed in each level considering economic and environmental criteria. The most promising alternatives were chosen rejecting the ones with a least favorable performance. Aspen Plus was employed for simulation of each one of the technological configurations studied. Aspen Icarus was used for economic evaluation of each configuration, and WAR algorithm was utilized for calculation of the environmental criterion. The results obtained showed that the most suitable synthesized flowsheet involves the continuous cultivation of Zymomonas mobilis with cane juice as substrate and including cell recycling and the ethanol dehydration by molecular sieves. The proposed strategy demonstrated to be a powerful tool for conceptual design of biotechnological processes considering both techno-economic and environmental indicators. Copyright © 2011 Elsevier Ltd. All rights reserved.

  2. Mathematical modeling of ethanol production in solid-state fermentation based on solid medium' dry weight variation.

    Science.gov (United States)

    Mazaheri, Davood; Shojaosadati, Seyed Abbas; Zamir, Seyed Morteza; Mousavi, Seyyed Mohammad

    2018-04-21

    In this work, mathematical modeling of ethanol production in solid-state fermentation (SSF) has been done based on the variation in the dry weight of solid medium. This method was previously used for mathematical modeling of enzyme production; however, the model should be modified to predict the production of a volatile compound like ethanol. The experimental results of bioethanol production from the mixture of carob pods and wheat bran by Zymomonas mobilis in SSF were used for the model validation. Exponential and logistic kinetic models were used for modeling the growth of microorganism. In both cases, the model predictions matched well with the experimental results during the exponential growth phase, indicating the good ability of solid medium weight variation method for modeling a volatile product formation in solid-state fermentation. In addition, using logistic model, better predictions were obtained.

  3. Continuous Ethanol Production Using Immobilized-Cell/Enzyme Biocatalysts in Fluidized-Bed Bioreactor (FBR)

    Energy Technology Data Exchange (ETDEWEB)

    Nghiem, NP

    2003-11-16

    The immobilized-cell fluidized-bed bioreactor (FBR) was developed at Oak Ridge National Laboratory (ORNL). Previous studies at ORNL using immobilized Zymomonas mobilis in FBR at both laboratory and demonstration scale (4-in-ID by 20-ft-tall) have shown that the system was more than 50 times as productive as industrial benchmarks (batch and fed-batch free cell fermentations for ethanol production from glucose). Economic analysis showed that a continuous process employing the FBR technology to produce ethanol from corn-derived glucose would offer savings of three to six cents per gallon of ethanol compared to a typical batch process. The application of the FBR technology for ethanol production was extended to investigate more complex feedstocks, which included starch and lignocellulosic-derived mixed sugars. Economic analysis and mathematical modeling of the reactor were included in the investigation. This report summarizes the results of these extensive studies.

  4. Simultaneous saccharification of inulin and starch using commercial glucoamylase and the subsequent bioconversion to high titer sorbitol and gluconic acid.

    Science.gov (United States)

    An, Kehong; Hu, Fengxian; Bao, Jie

    2013-12-01

    A new bioprocess for production of sorbitol and gluconic acid from two low-cost feedstocks, inulin and cassava starch, using a commercially available enzyme was proposed in this study. The commercial glucoamylase GA-L NEW from Genencor was found to demonstrate a high inulinase activity for hydrolysis of inulin into fructose and glucose. The glucoamylase was used to replace the expensive and not commercially available inulinase enzyme for simultaneous saccharification of inulin and starch into high titer glucose and fructose hydrolysate. The glucose and fructose in the hydrolysate were converted into sorbitol and gluconic acid using immobilized whole cells of the recombinant Zymomonas mobilis strain. The high gluconic acid concentration of 193 g/L and sorbitol concentration of 180 g/L with the overall yield of 97.3 % were obtained in the batch operations. The present study provided a practical production method of sorbitol and gluconic acid from low cost feedstocks and enzymes.

  5. Fermentative performance of bacteria and yeasts in lignocellulose hydrolysates

    Energy Technology Data Exchange (ETDEWEB)

    Olsson, Lisbeth; Hahn-Haegerdal, B. (Lund Univ. (Sweden). Dept. of Applied Microbiology)

    1993-01-01

    The sugar consumption rates and the product formation of yeasts (Saccharomyces cidri NCYC 775, S. cerevisiae NCYC 1047, S.cerevisiae ATCC 4132) and bacteria (Lactobacillus brevis DSM 20054, Lactococcus lactis ssp. lactis ATCC 19435, Escherichia coli ATCC 11303, Zymomonas mobilis ATCC 31821) were investigated in spent sulphite liquor and an enzymatic hydrolysate of steam-pretreated Salix caprea at different pH values in order to elucidate the suitability of the organisms with respect to future genetic engineering approaches. The possible inhibitory action of the two substrates on the investigated microorganisms was also considered. S.cerevisiae emerged as one of the better candidates, owing to its fast sugar consumption rate and efficient ethanol production. (author)

  6. Structural cladding /clad structures

    DEFF Research Database (Denmark)

    Beim, Anne

    2012-01-01

    Structural Cladding /Clad Structures: Studies in Tectonic Building Practice A. Beim CINARK – Centre for Industrialized Architecture, Institute of Architectural Technology, The Royal Danish Academy of Fine Arts School of Architecture, Copenhagen, Denmark ABSTRACT: With point of departure in the pr......Structural Cladding /Clad Structures: Studies in Tectonic Building Practice A. Beim CINARK – Centre for Industrialized Architecture, Institute of Architectural Technology, The Royal Danish Academy of Fine Arts School of Architecture, Copenhagen, Denmark ABSTRACT: With point of departure...... to analyze, compare, and discuss how these various construction solutions point out strategies for development based on fundamentally different mindsets. The research questions address the following issues: How to learn from traditional construction principles: When do we see limitations of tectonic maneuver......, to ask for more restrictive building codes. As an example, in Denmark there are series of increasing demands in the current building legislations that are focused at enhancing the energy performance of buildings, which consequently foster rigid insulation standards and ask for improvement of air...

  7. Bioethanol Production From Banana Stem By Using Simultaneous Saccharification and Fermentation (SSF)

    Science.gov (United States)

    Kusmiyati; Mustofa, A.; Jumarmi

    2018-05-01

    The rapid growth and development of industries in the world result in a greater energy needs. Some studies show that ethanol can be used as an alternative energy. However, bioethanol production from food raw materials such as sugar and starch has drawback that cause the food crisis. This aim of this study was to convert banana stem into bioethanol. Banana stem contained of 44.6% cellulose, 36.0% hemicellulose and 19.4% lignin. After banana stems were pretreated with acid (H2SO4) and alkaline (NaOH) at a concentration of 2% w/v at 121 °C for 30 minutes, then subsequently the simultaneous saccharification and fermentation (SSF) were carried out by using mixed cultures of Aspergillus niger, Trichoderma reesei and Zymomonas mobilis at various enzymes ratios of (1:1:1), (1:2:1), (1:2:2), (1:1:2) and various pH (4, 5 and 6) with SSF time for 144 hours and temperature of 30°C. The results show that acid pretreatment showed better results than the alkali pretreatment. After acid pretreatment and alkali pretreatment, lignin content of pretreted banana stem reduced to 15.92% and 16.34%, respectively, cellulose increased to 52.11% and 50.6% respectively, hemicellulose reduced to 28.45% and 28.83%, respectively The SSF showed that pH 5 gave the highest bioethanol. The highest concentration of bioethanol (8.51 g/L) was achieved at the SSF process at pH 5 with a ratio Aspergillus niger, Trichoderma reesei and Zymomonas mobilis enzymes of (1:1:2).

  8. Cells on corrugations for pollution control

    International Nuclear Information System (INIS)

    Clyde, R.

    1993-01-01

    Old cardboard boxes constitute 12% of landfills. White rot fungus can be grown on the boxes and buried in contaminated soil. The fungus needs air which is entrapped in the corrugations. The fungus is sensitive to large amounts of TNT but it is protected when inside the corrugations. Fast food containers are filling landfills. Lactic acid production needs air and the polymers are biodegradable. When corrugations are put in a half full rotary unit, holes in the valleys make drops, and mass transfer to drops is much higher than to a flat surface. A lab corrugator has been made from an old washing machine wringer, so other fibers can be corrugated. When the bacterium, Zymomonas mobilis is grown on Tyvek fiber, lead and six valent chromium are removed from wastewater in a few seconds. Zymomonas on rotating fibers converts sugar to alcohol in 10--15 minutes and when a light is shown into flat rotating discs, it hits a thin moving film to destroy dioxin. Salt on roads causes millions of dollars damage to bridges and cars but calcium magnesium acetate is not corrosive and can be made with cells on rotating fibers

  9. Heterologous Expression of Plant Cell Wall Degrading Enzymes for Effective Production of Cellulosic Biofuels

    Science.gov (United States)

    Jung, Sang-Kyu; Parisutham, Vinuselvi; Jeong, Seong Hun; Lee, Sung Kuk

    2012-01-01

    A major technical challenge in the cost-effective production of cellulosic biofuel is the need to lower the cost of plant cell wall degrading enzymes (PCDE), which is required for the production of sugars from biomass. Several competitive, low-cost technologies have been developed to produce PCDE in different host organisms such as Escherichia coli, Zymomonas mobilis, and plant. Selection of an ideal host organism is very important, because each host organism has its own unique features. Synthetic biology-aided tools enable heterologous expression of PCDE in recombinant E. coli or Z. mobilis and allow successful consolidated bioprocessing (CBP) in these microorganisms. In-planta expression provides an opportunity to simplify the process of enzyme production and plant biomass processing and leads to self-deconstruction of plant cell walls. Although the future of currently available technologies is difficult to predict, a complete and viable platform will most likely be available through the integration of the existing approaches with the development of breakthrough technologies. PMID:22911272

  10. The Enzymatic Conversion of Major Algal and Cyanobacterial Carbohydrates to Bioethanol

    Energy Technology Data Exchange (ETDEWEB)

    Al Abdallah, Qusai, E-mail: qalabdal@uthsc.edu [Department of Clinical Pharmacy, University of Tennessee Health Science Center, Memphis, TN (United States); Nixon, B. Tracy [Department of Biochemistry and Molecular Biology, The Pennsylvania State University, University Park, PA (United States); Fortwendel, Jarrod R. [Department of Clinical Pharmacy, University of Tennessee Health Science Center, Memphis, TN (United States)

    2016-11-04

    The production of fuels from biomass is categorized as first-, second-, or third-generation depending upon the source of raw materials, either food crops, lignocellulosic material, or algal biomass, respectively. Thus far, the emphasis has been on using food crops creating several environmental problems. To overcome these problems, there is a shift toward bioenergy production from non-food sources. Algae, which store high amounts of carbohydrates, are a potential producer of raw materials for sustainable production of bioethanol. Algae store their carbohydrates in the form of food storage sugars and structural material. In general, algal food storage polysaccharides are composed of glucose subunits; however, they vary in the glycosidic bond that links the glucose molecules. In starch-type polysaccharides (starch, floridean starch, and glycogen), the glucose subunits are linked together by α-(1→4) and α-(1→6) glycosidic bonds. Laminarin-type polysaccharides (laminarin, chrysolaminarin, and paramylon) are made of glucose subunits that are linked together by β-(1→3) and β-(1→6) glycosidic bonds. In contrast to food storage polysaccharides, structural polysaccharides vary in composition and glycosidic bond. The industrial production of bioethanol from algae requires efficient hydrolysis and fermentation of different algal sugars. However, the hydrolysis of algal polysaccharides employs more enzymatic mixes in comparison to terrestrial plants. Similarly, algal fermentable sugars display more diversity than plants, and therefore more metabolic pathways are required to produce ethanol from these sugars. In general, the fermentation of glucose, galactose, and glucose isomers is carried out by wild-type strains of Saccharomyces cerevisiae and Zymomonas mobilis. In these strains, glucose enters glycolysis, where is it converted to pyruvate through either Embden–Meyerhof–Parnas pathway or Entner–Doudoroff pathway. Other monosaccharides must be converted to

  11. The Enzymatic Conversion of Major Algal and Cyanobacterial Carbohydrates to Bioethanol

    International Nuclear Information System (INIS)

    Al Abdallah, Qusai; Nixon, B. Tracy; Fortwendel, Jarrod R.

    2016-01-01

    The production of fuels from biomass is categorized as first-, second-, or third-generation depending upon the source of raw materials, either food crops, lignocellulosic material, or algal biomass, respectively. Thus far, the emphasis has been on using food crops creating several environmental problems. To overcome these problems, there is a shift toward bioenergy production from non-food sources. Algae, which store high amounts of carbohydrates, are a potential producer of raw materials for sustainable production of bioethanol. Algae store their carbohydrates in the form of food storage sugars and structural material. In general, algal food storage polysaccharides are composed of glucose subunits; however, they vary in the glycosidic bond that links the glucose molecules. In starch-type polysaccharides (starch, floridean starch, and glycogen), the glucose subunits are linked together by α-(1→4) and α-(1→6) glycosidic bonds. Laminarin-type polysaccharides (laminarin, chrysolaminarin, and paramylon) are made of glucose subunits that are linked together by β-(1→3) and β-(1→6) glycosidic bonds. In contrast to food storage polysaccharides, structural polysaccharides vary in composition and glycosidic bond. The industrial production of bioethanol from algae requires efficient hydrolysis and fermentation of different algal sugars. However, the hydrolysis of algal polysaccharides employs more enzymatic mixes in comparison to terrestrial plants. Similarly, algal fermentable sugars display more diversity than plants, and therefore more metabolic pathways are required to produce ethanol from these sugars. In general, the fermentation of glucose, galactose, and glucose isomers is carried out by wild-type strains of Saccharomyces cerevisiae and Zymomonas mobilis. In these strains, glucose enters glycolysis, where is it converted to pyruvate through either Embden–Meyerhof–Parnas pathway or Entner–Doudoroff pathway. Other monosaccharides must be converted to

  12. The enzymatic conversion of major algal and cyanobacterial carbohydrates to bioethanol

    Directory of Open Access Journals (Sweden)

    Qusai Al Abdallah

    2016-11-01

    Full Text Available The production of fuels from biomass is categorized as first-, second- or third-generation depending upon the source of raw materials, either food crops, lignocellulosic material, or algal biomass, respectively. Thus far, the emphasis has been on using food crops creating several environmental problems. To overcome these problems, there is a shift toward bioenergy production from non-food sources. Algae, which store high amounts of carbohydrates, are a potential producer of raw materials for sustainable production of bioethanol. Algae store their carbohydrates in the form of food storage sugars and structural material. In general, algal food storage polysaccharides are composed of glucose subunits, however they vary in the glycosidic bond that links the glucose molecules. In starch-type polysaccharides (starch, floridean starch, and glycogen, the glucose subunits are linked together by α-(1→4 and α-(1→6 glycosidic bonds. Laminarin-type polysaccharides (laminarin, chrysolaminarin, and paramylon are made of glucose subunits that are linked together by β-(1→3 and β-(1→6 glycosidic bonds. In contrast to food storage polysaccharides, structural polysaccharides vary in composition and glycosidic bond. The industrial production of bioethanol from algae requires efficient hydrolysis and fermentation of different algal sugars. However, the hydrolysis of algal polysaccharides employs more enzymatic mixes in comparison to terrestrial plants. Similarly, algal fermentable sugars display more diversity than plants, and therefore more metabolic pathways are required to produce ethanol from these sugars. In general, the fermentation of glucose, galactose, and glucose isomers is carried out by wild type strains of Saccharomyces cerevisiae and Zymomonas mobilis. In these strains, glucose enters glycolysis, where is it converted to pyruvate through either Embden-Meyerhof-Parnas pathway or Entner-Doudoroff pathway. Other monosaccharides must be

  13. Scintillator structures

    International Nuclear Information System (INIS)

    Cusano, D.A.; Prener, J.S.

    1978-01-01

    Distributed phosphor scintillator structures providing superior optical coupling to photoelectrically responsive devices together with methods for fabricating said scintillator structures are disclosed. In accordance with one embodiment of the invention relating to scintillator structures, the phosphor is distributed in a 'layered' fashion with certain layers being optically transparent so that the visible wavelength output of the scintillator is better directed to detecting devices. In accordance with another embodiment of the invention relating to scintillator structures, the phosphor is distributed throughout a transparent matrix in a continuous fashion whereby emitted light is more readily transmitted to a photodetector. Methods for fabricating said distributed phosphor scintillator structures are also disclosed. (Auth.)

  14. Aplicação da teoria processual administrativa no procedimento de consulta no âmbito da Comissão de Valores Mobiliários (CVM: análise da decisão sobre a natureza jurídica da incorporação de ações pela CVM / Implementation of Administrative Process Theory in the Consultation Process within the Brazilian Securities and Exchange Commission (CVM: Analysis of the CVM’s Decision on the Juridical Nature of the Merger of Shares

    Directory of Open Access Journals (Sweden)

    Rodrigo Moreira Lopes

    2018-05-01

    Full Text Available Purpose – The purpose of this article is to investigate whether the Brazilian Securities and Exchange Commission (CVM, in ruling on the legal nature of the merger of shares, observed the elements of the administrative procedure, described in the administrative process theory of regulation developed by Steven Croley. More precisely, it was analyzed the decision-making process that culminated in the publication of Relatório RA / CVM / SEP / GEA-3 / Nº 21/14 and Parecer No 2014 / GJU-2 / PFE-CVM / PGF / AG – which addressed the legal nature of the merger of shares –, in order to identify which elements of the administrative procedure are present in the decision of the CVM. Methodology – First, the bases of the administrative process theory will be described, notably the elements of the administrative procedure indicated by Steven Croley as essential for a socially satisfactory regulation. After that, it will be analyzed how happened the decision process that culminated in the publication of Relatório RA / CVM / SEP / GEA-3 / Nº 21/14 and Parecer No 2014 / GJU-2 / PFE-CVM / PGF / AG. Next, a critical analysis of the CVM decision will be presented, from the perspective of the administrative process theory. Findings – At the end of the analysis it was shown that some of the assumptions of the administrative process theory were not duly respected by the CVM when issuing Relatório RA / CVM / SEP / GEA-3 / Nº 21/14 and Parecer No 2014 / GJU-2 / PFE-CVM / PGF / AG, which may raise questions about the reliability and legal acceptance of the decision issued by the regulatory authority. Resumo Propósito – O presente artigo tem como objetivo averiguar se a Comissão de Valores Mobiliários (CVM, ao se pronunciar sobre a natureza jurídica da incorporação de ações, observou os elementos do procedimento administrativo, descritos na teoria processual administrativa da regulação desenvolvida por Steven Croley. Mais precisamente, foi

  15. Organisational Structure

    Science.gov (United States)

    National Centre for Vocational Education Research (NCVER), 2006

    2006-01-01

    An understanding of organisational structure can provide guidance for organisations that want to change and innovate. Many writers agree that this understanding allows organisations to shape how their work is done to ultimately achieve their business goals--and that too often structure is given little consideration in business strategy and…

  16. Scintillator structure

    International Nuclear Information System (INIS)

    Cusano, D.A.; Prener, J.S.

    1979-01-01

    A scintillator structure comprises at least one layer of transparent fused quartz with a phosphor coating on one or both sides adjacent to at least one transparent layer of epoxy resin which directs light from the phosphor to a detector. The phosphor layer may be formed from a powder optionally with a binder, a single crystal or a melt, or by evaporation or sintering. A plurality of multiple layers may be used or the structure tilted for greater absorption. The structure may be surrounded by another such structure optionally operating in cascade with the first. Many phosphors are specified. A scintillator structure comprises phosphor particles dispersed in epoxy resin or copoly imide-silicone and cast in a multi-compartment box with long sides transparent to X-rays and dividers opaque to X-rays. (UK)

  17. Building structures

    CERN Document Server

    Ambrose, James

    2011-01-01

    James Ambrose is Editor of the Parker/Ambrose Series of Simplified Design Guides. He practiced as an architect in California and Illinois and as a structural engineer in Illinois. He was a professor of architecture at the University of Southern California. Patrick Tripeny is an Associate Professor, former director of the School of Architecture, and the current Director of the Center for Teaching and Learning Excellence at the University of Utah. He is a licensed architect in California. He has been the recipient of a number of teaching awards at the local and national level for his work in teaching structures and design. With James Ambrose, he is the coauthor of Simplified Engineering for Architects and Builders, Eleventh Edition; Simplified Design of Steel Structures, Eighth Edition; Simplified Design of Concrete Structures, Eighth Edition; and Simplified Design of Wood Structures, Sixth Edition, all published by Wiley.

  18. Vers une agroécologie biodiverse : enjeux et principaux concepts mobilisés

    OpenAIRE

    Reboud , Xavier; MALEZIEUX , Eric

    2015-01-01

    SPEPôle ECOLDUR; This text relates to the introduction of the workshop “Using biodiversity” given on October, 18th at the 2013 symposium on Agroecology. It is inspired by the discussions of the working group "Agroecology and soil" of the alliance between institutes on environmental research AllEnvi. Some major issues are exposed and the principles on how the use of biodiversity could improve agroecosystem management are presented.; Ce texte constitue l’introduction à l’atelier « utiliser la B...

  19. Les Horologia romana en Hispanie, mobilier, histoire et realités archéologiques

    Directory of Open Access Journals (Sweden)

    Bonnin, Jerome

    2010-12-01

    Full Text Available There has been no previous global study of the Horologia in Hispania. The purpose of the present study is to collect together current knowledge with archaeological discoveries as well as iconographical or epigraphical one. The archaeological remains, most often under-exploited, reveal a clear predominance of objects discovered in private contexts and a local production in most cases. Nevertheless, the existence of sundials in public centres is also attested not only by the epigraphy, well known, but also by the archaeological discoveries. Finally the opportunity is taken to review the available information about the so-called ‘sundial’ from Yecla with its unusual design. Although not discussed recently its use as a sundial is still open to question.El estudio de los Horologia romana en Hispania no ha sido hecho hasta ahora. Este es el propósito del presente artículo que constituye al mismo tiempo una síntesis de los conocimientos existentes sobre este aspecto de la civilización romana en Hispania y un catálogo y estudio de toda la evidencia arqueológica, iconográfica y epigráfica. Los restos arqueológicos, en ocasiones poco estudiados por los descubridores, revelan un claro predominio de objetos descubiertos en ámbitos privados y una producción local en muchos casos. No obstante, la existencia de relojes en centros públicos está atestiguada no sólo por la epigrafía, bien conocida, sino también por los descubrimientos arqueológicos. Finalmente, el artículo brinda la oportunidad de redescubrir el llamado reloj de Yecla, de una iconografía totalmente inusual, prácticamente olvidado por los investigadores, pero que todavía hoy está sometido a discusión.

  20. Les objets mobiliers des XIXe et XXe siècles : les sources

    OpenAIRE

    Finance, Laurence de

    2012-01-01

    L’étude scientifique de tout objet ne peut se concevoir sans une recherche dans les sources documentaires. Qu’il s’agisse d’archives publiques ou privées, de legs faits à des musées ou autres institutions patrimoniales, la quête de renseignements est une nécessité pour suivre l’objet étudié depuis sa création jusqu’à son étude faite in Situ. De nos jours, de nombreuses ressources sont mises en ligne, notamment sur le site du ministère de la culture et de la communication ; accessibles à tous,...

  1. ENEA`s mobile treatment units for specific waters; Impianti mobili ENEA di trattamento / smaltimento rifiuti

    Energy Technology Data Exchange (ETDEWEB)

    Beone, G.; Barni, E.; Coronidi, M. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente; Bortone, G.; Gambaro, L.; Zanetti, P. [ENEA, Centro Ricerche `Ezio Clementel, Bologna (Italy). Dipt. Ambiente; Liccione, G. [ENEA, Centro Ricerche Trisaia, Matera (Italy). Dipt. Ambiente; Zanin, E.

    1997-11-01

    Solid waste production in turistic places is characterized by a large increase, up to 80 % for few months during the year. Generally a waste treatment plant is designed for a mean production and can support increases that non exceed 10 %. Treatment plants with higher capacity are not economically convenient and the excedent production is landfilled. An answer to this problem are mobile treatment units that could be used to support resident plants when higher treatment capacity is requested. Mobile units are very useful for other uses like as treatment of specific wastes (agricultural plastic bags and sheets contaminated by antiparasitics and herbicides) infective wastes from hospital and laboratories and leaches from landfills. Mobile units flexibility is also important for environmental protection actions, either scheduled on in an emergency, like as reclamation of contaminated soils, asbestos contaminated site and every time when waste transport is characterized by high cost or safety and sanitary problems.

  2. Mobiliųjų telefonų vartotojų elgsena

    OpenAIRE

    Adomavičienė, Dinara; Kungytė, Viktorija

    2010-01-01

    Mobile phone manufacturers supply the market with a large range of mobile phones with their evolving functions, offering consumers a range of discounts and convenient ways to purchase. The article aims to explore what manufacturers of mobile phone choose today's consumers. What are the most used functions of the mobile phones? Do the financial potential of the consumers have the impact on the price of the mobile phone? The objective of the study is to reveal the behaviour of the consumers whe...

  3. Structural Behaviour of Reciprocal Structures

    DEFF Research Database (Denmark)

    Parigi, Dario; Kirkegaard, Poul Henning

    2013-01-01

    The present paper focuses on the comparison of several two-dimensional and three-dimensional reciprocal configurations. The goal of such comparison is to analyse the structural behaviour when changing the geometric parameters used to describe the geometry of reciprocal structures....

  4. Organizational structure

    NARCIS (Netherlands)

    Hendriks, P.H.J.; Schwartz, D.; Te'eni, D.

    2011-01-01

    For many decades, organization scientists have paid considerable attention to the link between knowledge and organization structure. An early contributor to these discussions was Max Weber (1922), who elaborated his concepts of professional bureaucracy. History shows a multitude of other

  5. Organizational Structures

    OpenAIRE

    2006-01-01

    drag Drag-and-Drop Exercise Interactive Media Element This interactive exercise gets the learner to identify various strengths and weaknesses of the functional, divisional, matrix, horizontal, modular, and hybrid organizational structures

  6. Hydraulic Structures

    Data.gov (United States)

    Department of Homeland Security — This table is required whenever hydraulic structures are shown in the flood profile. It is also required if levees are shown on the FIRM, channels containing the...

  7. Hydraulic structures

    CERN Document Server

    Chen, Sheng-Hong

    2015-01-01

    This book discusses in detail the planning, design, construction and management of hydraulic structures, covering dams, spillways, tunnels, cut slopes, sluices, water intake and measuring works, ship locks and lifts, as well as fish ways. Particular attention is paid to considerations concerning the environment, hydrology, geology and materials etc. in the planning and design of hydraulic projects. It also considers the type selection, profile configuration, stress/stability calibration and engineering countermeasures, flood releasing arrangements and scouring protection, operation and maintenance etc. for a variety of specific hydraulic structures. The book is primarily intended for engineers, undergraduate and graduate students in the field of civil and hydraulic engineering who are faced with the challenges of extending our understanding of hydraulic structures ranging from traditional to groundbreaking, as well as designing, constructing and managing safe, durable hydraulic structures that are economical ...

  8. Structural Origami

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 5. Structural Origami - A Geodesic Dome from Five Postcards. Subramania Ranganathan. General Article ... Author Affiliations. Subramania Ranganathan1. Discovery Laboratory Indian Institute of Chemical Technology Hyderabad 500 007, India.

  9. Structural Dynamics

    DEFF Research Database (Denmark)

    Nielsen, Søren R.K.

    The present textbook has been written for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M.Sc. students in structural engineering.......The present textbook has been written for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M.Sc. students in structural engineering....

  10. Nuclear structure

    International Nuclear Information System (INIS)

    Eastham, D.A.; Joy, T.

    1986-01-01

    The paper on 'nuclear structure' is the Appendix to the Daresbury (United Kingdom) Annual Report 1985/86, and contains the research work carried out at the Nuclear Structure Facility, Daresbury, within that period. During the year a total of 74 experiments were scheduled covering the main areas of activity including: nuclear collective motion, nuclei far from stability, and nuclear collisions. The Appendix contains brief reports on these experiments and associated theory. (U.K.)

  11. Unemployment - Structural

    OpenAIRE

    Lindbeck, Assar

    1999-01-01

    Structural unemployment differs from cyclical unemployment by not disappearing in cyclical booms. In economic theory, structural unemployment is usually analysed in terms of the concept of equilibrium unemployment (the "natural unemployment rate" in Friedman’s terminology). Two elaborate concepts of equilibrium unemployment – the non-accelerating inflation rate of unemployment (the NAIRU) and the unemployment rate that induces firms and workers to accept the same real wage (the PS-WS-model) a...

  12. Structural Dynamics

    International Nuclear Information System (INIS)

    Kim, Du Gi

    2005-08-01

    This book introduces summary of structural dynamics, the reason of learning of structural dynamics, single-degree of freedom system, simple harmonic vibration and application, numerical analysis method, such as time domain and frequency domain and nonlinear system, multi-degree of freedom system random vibration over discrete distribution, continuous distribution and extreme value distribution, circumstance vibration, earth quake vibration, including input earthquake, and earthquake-resistant design and capacity spectrum method, wind oscillation wave vibration, vibration control and maintenance control.

  13. Diverter structure

    Energy Technology Data Exchange (ETDEWEB)

    Nayama, Risuke; Toyota, Masahiko; Tsujimura, Seiichi

    1995-11-21

    The present invention concerns a vacuum vessel for a tokamak-type nuclear fusion plasma experimental device, and provides a divertor structure capable of reducing a distance of a plasma facing surface of a divertor structure and an inner wall of the vacuum vessel while maintaining cooling and heat removing performance. Namely, in the divertor structure of the present invention, a compulsory cooling channel on the side receiving high temperature load is made of a highly heat conductive material such as copper. The compulsory cooling channel on the side secured to a substrate is made of a material having high mechanical strength, for example, stainless steel. With such a constitution, the compulsory cooling channel on the side receiving high temperature load transfers the heat received by an armour material from plasmas efficiently to coolants. The opposite side can be secured to the inner wall of the vacuum vessel with satisfactory mechanical strength without interposing other additional materials. As a result, the structure of the present invention can reduce the distance of the plasma facing surface of the divertor structure and the inner wall of the vacuum vessel while maintaining the cooling and heat removing performance. (I.S.).

  14. Diverter structure

    International Nuclear Information System (INIS)

    Nayama, Risuke; Toyota, Masahiko; Tsujimura, Seiichi.

    1995-01-01

    The present invention concerns a vacuum vessel for a tokamak-type nuclear fusion plasma experimental device, and provides a divertor structure capable of reducing a distance of a plasma facing surface of a divertor structure and an inner wall of the vacuum vessel while maintaining cooling and heat removing performance. Namely, in the divertor structure of the present invention, a compulsory cooling channel on the side receiving high temperature load is made of a highly heat conductive material such as copper. The compulsory cooling channel on the side secured to a substrate is made of a material having high mechanical strength, for example, stainless steel. With such a constitution, the compulsory cooling channel on the side receiving high temperature load transfers the heat received by an armour material from plasmas efficiently to coolants. The opposite side can be secured to the inner wall of the vacuum vessel with satisfactory mechanical strength without interposing other additional materials. As a result, the structure of the present invention can reduce the distance of the plasma facing surface of the divertor structure and the inner wall of the vacuum vessel while maintaining the cooling and heat removing performance. (I.S.)

  15. Microcavity structures

    International Nuclear Information System (INIS)

    Kustom, R.L.; Grudzien, D.; Feinerman, A.D.

    1994-01-01

    The feasibility of building mm-wave cavities using deep x-ray lithography techniques is being investigated. These cavities could be considered for linac accelerating structures, undulators, free electron lasers, or mm-wave amplifiers. The construction process includes making precision x-ray masks, x-ray exposure of poly-methyl-methacrylate (PMMA), removal of PMMA, and electroplating a metal. Highly precise two-dimensional features can be machined onto wafers by this technique. The challenge is to fabricate the wafers onto three-dimensional rf structures. Rectangular cavity geometry is best suited to this fabrication technique. Status of wafer manufacture, fabrication and alignment techniques using capillaries bonded in precision grooves, 2π/3 120-GHz linac structures, heat extraction analysis, and beam dynamics in a 5-meter-long 50-MeV linac will be discussed. Measurements made on 10X larger scale models that were built with conventional techniques will also be discussed

  16. Structural biophysics

    International Nuclear Information System (INIS)

    Anon.

    1979-01-01

    Summaries of research projects conducted during 1978 and 1979 are presented. The structural biophysics group explores the high-resolution structure of biological macromolecules and cell organelles. Specific subject areas include: the basic characteristics of photosynthesis in plants; the chemical composition of individual fly ash particles at the site of their damaging action in tissues; direct analysis of frozen-hydrated biological samples by scanning electron microscopy; yeast genetics; the optical activity of DNA aggregates; measurement and characterization of lipoproteins; function of lipoproteins; and the effect of radiation and pollutants on mammalian cells

  17. Foundation Structure

    DEFF Research Database (Denmark)

    2009-01-01

    Method of installing a bucket foundation structure comprising one, two, three or more skirts, into soils in a controlled manner. The method comprises two stages: a first stage being a design phase and the second stage being an installation phase. In the first stage, design parameters are determined...... relating to the loads on the finished foundation structure; soil profile on the location; allowable installation tolerances, which parameters are used to estimate the minimum diameter and length of the skirts of the bucket. The bucket size is used to simulate load situations and penetration into foundation...

  18. Structures manual

    Science.gov (United States)

    2001-01-01

    This manual was written as a guide for use by design personnel in the Vermont Agency of Transportation Structures Section. This manual covers the design responsibilities of the Section. It does not cover other functions that are a part of the Structu...

  19. Coastal Structures

    DEFF Research Database (Denmark)

    Oumeraci, H.; Burcharth, H. F.; Rouck, J. De

    1995-01-01

    The paper attempts to present an overview of five research projects supported by the Commission of the European Communities, Directorate General XII, under the MAST 2- Programme (Marine Sciences and Technology), with the overall objective of contributing to the development of improved rational me...... methods for the design of coastal structures....

  20. Structural optimization

    CERN Document Server

    MacBain, Keith M

    2009-01-01

    Intends to supplement the engineer's box of analysis and design tools making optimization as commonplace as the finite element method in the engineering workplace. This title introduces structural optimization and the methods of nonlinear programming such as Lagrange multipliers, Kuhn-Tucker conditions, and calculus of variations.

  1. Structural region

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Structural region. The two groups had 4 substitutions similar to Yawat strain. The Yawat strain had 5 unique mutations. 3 in the E2 region and 2 in the E1 region. The mutation, I702V (E2), though different from all the recent Indian and Reunion sequences was similar ...

  2. Data Structures

    DEFF Research Database (Denmark)

    Davoodi, Pooya

    We study data structures for variants of range query problems. In particular, we consider (1) the range minimum problem: given a multidimensional array, find the position of the minimum element in a query rectangle; (2) the path minima problem: given a weighted tree, find the edge with minimum...... weight in a query path; (3) the range diameter problem: given a point set in the plane, find two points that are farthest away in a query rectangle. These and similar problems arise in various applications including document retrieval, genome sequence analysis, OLAP data cubes, network flows, shape......-fitting, and clustering. The three mentioned problems are considered for either static inputs or dynamic inputs. In the static setting, we investigate the space-efficiency of data structures, which is an important aspect in massive data algorithmics. We provide lower bounds on the trade-off between the query time...

  3. Terminal structure

    Science.gov (United States)

    Schmidt, Frank [Langenhagen, DE; Allais, Arnaud [Hannover, DE; Mirebeau, Pierre [Villebon sur Yvette, FR; Ganhungu, Francois [Vieux-Reng, FR; Lallouet, Nicolas [Saint Martin Boulogne, FR

    2009-10-20

    A terminal structure (2) for a superconducting cable (1) is described. It consists of a conductor (2a) and an insulator (2b) that surrounds the conductor (2a), wherein the superconducting cable (1) has a core with a superconducting conductor (5) and a layer of insulation that surrounds the conductor (5), and wherein the core is arranged in such a way that it can move longitudinally in a cryostat. The conductor (2a) of the terminal structure (2) is electrically connected with the superconducting conductor (5) or with a normal conductor (6) that is connected with the superconducting conductor (5) by means of a tubular part (7) made of an electrically conductive material, wherein the superconducting conductor (5) or the normal conductor (6) can slide in the part (7) in the direction of the superconductor.

  4. Concrete structures

    CERN Document Server

    Setareh, Mehdi

    2017-01-01

    This revised, fully updated second edition covers the analysis, design, and construction of reinforced concrete structures from a real-world perspective. It examines different reinforced concrete elements such as slabs, beams, columns, foundations, basement and retaining walls and pre-stressed concrete incorporating the most up-to-date edition of the American Concrete Institute Code (ACI 318-14) requirements for the design of concrete structures. It includes a chapter on metric system in reinforced concrete design and construction. A new chapter on the design of formworks has been added which is of great value to students in the construction engineering programs along with practicing engineers and architects. This second edition also includes a new appendix with color images illustrating various concrete construction practices, and well-designed buildings. The ACI 318-14 constitutes the most extensive reorganization of the code in the past 40 years. References to the various sections of the ACI 318-14 are pro...

  5. Galactic structure

    International Nuclear Information System (INIS)

    1989-01-01

    The occurrence of hot, apparently normal, massive stars far from the galactic plane has been a major puzzle in an understanding of galactic structure and evolution. Such stars have been discovered and studied at the South African Astronomical Observatory (SAAO) over a number of years. During 1989 further evidence has been obtained indicating that these stars are normal, massive objects. Other studies of galactic structure conducted by the SAAO have included research on: the central bulge region of our galaxy; populations of M giants in the galaxy; a faint blue object survey; a survey of the galactic plane for distant Cepheid variables; interstellar reddening, and K-type dwarfs as tracers for the gravitational force perpendicular to the galactic plane. 1 fig

  6. Nuclear structure

    International Nuclear Information System (INIS)

    Joy, T.; Price, H.G.

    1984-01-01

    The appendix to the Daresbury Annual report contains detailed summaries of experiments carried out, or in progress, for the period 1983/84, using the Nuclear Structure Facility tandem accelerator. The experimental work is carried out by University groups from the UK and abroad, and Daresbury Staff. Developments in instrumentation, and a report on the first year of scheduled operation of the Facility, are also given. (U.K.)

  7. Structural dynamics

    CERN Document Server

    Strømmen, Einar N

    2014-01-01

    This book introduces to the theory of structural dynamics, with focus on civil engineering structures that may be described by line-like beam or beam-column type of systems, or by a system of rectangular plates. Throughout this book the mathematical presentation contains a classical analytical description as well as a description in a discrete finite element format, covering the mathematical development from basic assumptions to the final equations ready for practical dynamic response predictions. Solutions are presented in time domain as well as in frequency domain. Structural Dynamics starts off at a basic level and step by step brings the reader up to a level where the necessary safety considerations to wind or horizontal ground motion induced dynamic design problems can be performed. The special theory of the tuned mass damper has been given a comprehensive treatment, as this is a theory not fully covered elsewhere. For the same reason a chapter on the problem of moving loads on beams has been included.

  8. Structural damage

    International Nuclear Information System (INIS)

    Gray, R.E.; Bruhn, R.W.

    1992-01-01

    Virtually all structures show some signs of distress due to deterioration of the building components, to changed loads, or to changed support conditions. Changed support conditions result from ground movements. In mining regions many cases of structural distress are attributed to mining without considering alternative causes. This is particularly true of coal mining since it occurs under extensive areas. Coal mining is estimated to have already undermined more than eight million acres and may eventually undermine 40 million acres in the United States. Other nonmetal and metal underground mines impact much smaller areas. Although it is sometimes difficult, even with careful study, to identify the actual cause of damage, persons responsible for underground coal mining should at least be aware of possible causes of building stress other than mine subsidence. This paper presents information on distress to structures and briefly reviews a number of causes of ground movements other than subsidence: Mass movements, dissolution, erosion, frost action, shrinking and swelling, yield into excavations and compressibility

  9. Airfoil structure

    Science.gov (United States)

    Frey, G.A.; Twardochleb, C.Z.

    1998-01-13

    Past airfoil configurations have been used to improve aerodynamic performance and engine efficiencies. The present airfoil configuration further increases component life and reduces maintenance by reducing internal stress within the airfoil itself. The airfoil includes a chord and a span. Each of the chord and the span has a bow being summed to form a generally ``C`` configuration of the airfoil. The generally ``C`` configuration includes a compound bow in which internal stresses resulting from a thermal temperature gradient are reduced. The structural configuration reduces internal stresses resulting from thermal expansion. 6 figs.

  10. Vcsel structure

    DEFF Research Database (Denmark)

    2015-01-01

    .5, and wherein an index of refraction of low-index sections of the grating structure is less than 2. The core grating region defines a projection in a direction normal to the grating layer. The grating reflector further comprises a cap layer abutting the grating layer, and an index of refraction of the cap layer...... within the projection of the core grating region onto the cap layer is at least 2.5, and within the projection of the core grating region, the cap layer is abutted by a first solid dielectric low-index layer, an index of refraction of the first low-index layer or air being less than 2; and within...... the projection of the core grating region, the grating layer is also abutted by a second low-index layer and/or by air, an index of refraction of the second low-index layer or air being less than 2. The VCSEL structure furthermore comprises a first reflector and an active region for providing a cavity...

  11. Baryon structure

    International Nuclear Information System (INIS)

    Morsch, H.P.; Forschungszentrum Juelich GmbH

    1993-01-01

    A brief review on the theoretical and experimental situation of baryon spectroscopy is first given. Then, the radial structure of baryons, related to the ground state form factors and the baryonic compressibility, is discussed. An experiment has been performed at Saturne laboratory (France) in which for the first time a compression of the nucleon is observed, exciting the P 11 (1440 MeV) resonance (Roper resonance) by α-particles. The analysis of the data indicates that this excitation covers a large fraction of the available monopole strength in the nucleon. The derived compressibility is discussed as well as the consequence for other fields, as nuclear medium effects on baryon properties, high density phenomena in nuclear collisions as well as colour transparency. In the last point the spin-flip structure of the P 11 (1440 MeV) resonance is discussed. The possibility to determine isoscalar spin-flip strength by polarized deuteron scattering is contrasted with first preliminary results from photon-induced reactions studied at Mainz which indicate a non-negligible M1 excitation of the Roper resonance. (author) 10 figs., 31 refs

  12. Scintillator structure

    International Nuclear Information System (INIS)

    Cusano, D.A.; Swank, R.K.; White, P.J.

    1978-01-01

    Scintillator structures are described in which the phosphor is embedded or suspended in an optically transparent matrix which is selected or adjusted to have an index of refraction which is approximately equal to that of the phosphor at the wavelength of the light emitted by the phosphor. The matrix may be glass, copoly 2-vinyl naphthalene/vinyl toluene or a liquid e.g. Br-naphthalene and optionally CH 3 I, the ratio of components being adjusted to give the desired refractive index. The polymer may be made in situ or a mixture of phosphor and polymer formed e.g. by freeze drying a solution and pulverizing, and then heating. Specified dyes may be used for converting the emitted light to other wavelengths. (author)

  13. Enhanced Sorbitol Production under Submerged Fermentation using Lactobacillus plantarum

    Directory of Open Access Journals (Sweden)

    Khan Nadiya Jan

    2017-04-01

    Full Text Available Background and Objective: Sorbitol is a non-toxic and slightly hygroscopic compound with different applications. Zymomonas mobiles produces sorbitol from sucrose or mixtures of glucose and fructose (formation is coupled with the dehydrogenation of glucose to glucono-δ- lactone. Recombinant Zymomonas mobilis may produce sorbitol and gluconic acid from glucose and fructose using different divalent metal ions with reduced the ethanol yield andsignificantly increased yield of sorbitol. Current study envisaged to alter the media components, physical process parameters and supplementation of amino acids for enhanced sorbitol production.Material and Methods: Several process variables were evaluated on sorbitol production including carbon sources (glucose, fructose, maltose, sucrose, carbon concentrations (5, 10, 20 and 25 g l-1, nitrogen sources (peptone, tryptone, yeast extract, beef extract and organic nitrogen mix, temperatures (25, 29, 33, 37, 41°C, pH (6, 6.5, 7 , 7.5 ,8, agitation rate (50, 100, 150, 200 rpm and amino acids (cysteine, cystine, tryptophanin batch cultivation ofLactobacillus plantarum NCIM 2912. Shake flask cultivation performed under optimum conditions like temperature 37°C, pH 7.0 and agitation rate of 150 rpm, resulted in enhanced sorbitol production. Comparative study of sorbitol production in solid state fermentation and submerged fermentation was also evaluated.Results and Conclusion: Batch cultivation under submerged conditions further performed in 7.5-l lab scale bioreactor (working volume 3.0-l under optimized conditions resulted in maximum cell biomass of 8.95±0.03 g g-1 and a sorbitol content of 9.78±0.04 g l-1 after 42.0 h of fermentation. Scale up study on bioreactor resulted in maximum sorbitol yield (Yp/x and productivity of 1.11 g g-1 and 0.50 g l-1 h under submerged fermentation, respectively.Conflict of interest: The authors declare no conflict of interest.

  14. Increase in furfural tolerance in ethanologenic Escherichia coli LY180 by plasmid-based expression of thyA.

    Science.gov (United States)

    Zheng, Huabao; Wang, Xuan; Yomano, Lorraine P; Shanmugam, Keelnatham T; Ingram, Lonnie O

    2012-06-01

    Furfural is an inhibitory side product formed during the depolymerization of hemicellulose by mineral acids. Genomic libraries from three different bacteria (Bacillus subtilis YB886, Escherichia coli NC3, and Zymomonas mobilis CP4) were screened for genes that conferred furfural resistance on plates. Beneficial plasmids containing the thyA gene (coding for thymidylate synthase) were recovered from all three organisms. Expression of this key gene in the de novo pathway for dTMP biosynthesis improved furfural resistance on plates and during fermentation. A similar benefit was observed by supplementation with thymine, thymidine, or the combination of tetrahydrofolate and serine (precursors for 5,10-methylenetetrahydrofolate, the methyl donor for ThyA). Supplementation with deoxyuridine provided a small benefit, and deoxyribose was of no benefit for furfural tolerance. A combination of thymidine and plasmid expression of thyA was no more effective than either alone. Together, these results demonstrate that furfural tolerance is increased by approaches that increase the supply of pyrimidine deoxyribonucleotides. However, ThyA activity was not directly affected by the addition of furfural. Furfural has been previously shown to damage DNA in E. coli and to activate a cellular response to oxidative damage in yeast. The added burden of repairing furfural-damaged DNA in E. coli would be expected to increase the cellular requirement for dTMP. Increased expression of thyA (E. coli, B. subtilis, or Z. mobilis), supplementation of cultures with thymidine, and supplementation with precursors for 5,10-methylenetetrahydrofolate (methyl donor) are each proposed to increase furfural tolerance by increasing the availability of dTMP for DNA repair.

  15. Investigation of specificity determinants in bacterial tRNA-guanine transglycosylase reveals queuine, the substrate of its eucaryotic counterpart, as inhibitor.

    Directory of Open Access Journals (Sweden)

    Inna Biela

    Full Text Available Bacterial tRNA-guanine transglycosylase (Tgt catalyses the exchange of the genetically encoded guanine at the wobble position of tRNAs(His,Tyr,Asp,Asn by the premodified base preQ1, which is further converted to queuine at the tRNA level. As eucaryotes are not able to synthesise queuine de novo but acquire it through their diet, eucaryotic Tgt directly inserts the hypermodified base into the wobble position of the tRNAs mentioned above. Bacterial Tgt is required for the efficient pathogenicity of Shigella sp, the causative agent of bacillary dysentery and, hence, it constitutes a putative target for the rational design of anti-Shigellosis compounds. Since mammalian Tgt is known to be indirectly essential to the conversion of phenylalanine to tyrosine, it is necessary to create substances which only inhibit bacterial but not eucaryotic Tgt. Therefore, it seems of utmost importance to study selectivity-determining features within both types of proteins. Homology models of Caenorhabditis elegans Tgt and human Tgt suggest that the replacement of Cys158 and Val233 in bacterial Tgt (Zymomonas mobilis Tgt numbering by valine and accordingly glycine in eucaryotic Tgt largely accounts for the different substrate specificities. In the present study we have created mutated variants of Z. mobilis Tgt in order to investigate the impact of a Cys158Val and a Val233Gly exchange on catalytic activity and substrate specificity. Using enzyme kinetics and X-ray crystallography, we gained evidence that the Cys158Val mutation reduces the affinity to preQ1 while leaving the affinity to guanine unaffected. The Val233Gly exchange leads to an enlarged substrate binding pocket, that is necessary to accommodate queuine in a conformation compatible with the intermediately covalently bound tRNA molecule. Contrary to our expectations, we found that a priori queuine is recognised by the binding pocket of bacterial Tgt without, however, being used as a substrate.

  16. Study on structural integrity in box structures

    International Nuclear Information System (INIS)

    Asano, Masayuki; Ueta, Masahiro; Kanaoka, Tadashi; Ikeuchi, Toshiaki; Kodama, Tetsuhiro.

    1991-01-01

    This study was carried out to give an experimental foundation to the structural integrity of a box structure. Crack growth tests were performed on the reduced scale models, simulating typical portions of the box structure, in air at room temperature. The results show that the amount of crack growth is too small to injure the structural integrity of the models for the postulated loading cycle, and make clear the effective structure against crack growth. (author)

  17. Structural Biology Fact Sheet

    Science.gov (United States)

    ... NIGMS NIGMS Home > Science Education > Structural Biology Structural Biology Tagline (Optional) Middle/Main Content Area PDF Version (688 KB) Other Fact Sheets What is structural biology? Structural biology is the study of how biological ...

  18. Magnetic multilayer structure

    Science.gov (United States)

    Herget, Philipp; O'Sullivan, Eugene J.; Romankiw, Lubomyr T.; Wang, Naigang; Webb, Bucknell C.

    2016-07-05

    A mechanism is provided for an integrated laminated magnetic device. A substrate and a multilayer stack structure form the device. The multilayer stack structure includes alternating magnetic layers and diode structures formed on the substrate. Each magnetic layer in the multilayer stack structure is separated from another magnetic layer in the multilayer stack structure by a diode structure.

  19. Differential antibiotic sensitivity determined by the large ribosomal subunit in thermophilic archaea.

    OpenAIRE

    Ruggero, D; Londei, P

    1996-01-01

    Hybrid ribosomes obtained by mixing the ribosomal subunits of the extremely thermophilic archaea Sulfolobus solfataricus and Desulfurococcus mobilis were tested for their sensitivity to selected antibiotics. It is shown that structural differences in the large ribosomal subunits determine qualitatively and quantitatively the patterns of response to alpha-sarcin and paromomycin in these species.

  20. Fluid-structure interaction of submerged structures

    International Nuclear Information System (INIS)

    Tang, H.T.; Becker, E.B.; Taylor, L.M.

    1979-01-01

    The purpose of the paper is to investigate fluid-structure interaction (FSI) of submerged structures in a confined fluid-structure system. Our particular interest is the load experienced by a rigid submerged structure subject to a pressure excitation in a fluid domain bounded by a structure which is either flexible or rigid. The objective is to see whether the load experienced by the submerged structure will be influenced by its confinement conditions. This investigation is intended to provide insight into the characteristics of FSI and answer the question as to whether one can obtain FSI independent data by constructing a small scale rigid submerged structure inside a flexible fluid-structure system. (orig.)

  1. Computational structural mechanics for engine structures

    Science.gov (United States)

    Chamis, C. C.

    1989-01-01

    The computational structural mechanics (CSM) program at Lewis encompasses: (1) fundamental aspects for formulating and solving structural mechanics problems, and (2) development of integrated software systems to computationally simulate the performance/durability/life of engine structures. It is structured to mainly supplement, complement, and whenever possible replace, costly experimental efforts which are unavoidable during engineering research and development programs. Specific objectives include: investigate unique advantages of parallel and multiprocesses for: reformulating/solving structural mechanics and formulating/solving multidisciplinary mechanics and develop integrated structural system computational simulators for: predicting structural performances, evaluating newly developed methods, and for identifying and prioritizing improved/missing methods needed. Herein the CSM program is summarized with emphasis on the Engine Structures Computational Simulator (ESCS). Typical results obtained using ESCS are described to illustrate its versatility.

  2. Lightweight Materials and Structures (LMS): Inflatable Structures

    Data.gov (United States)

    National Aeronautics and Space Administration —  Current inflatable structures are designed on the restraint layer’s short term properties with a Factor of Safety of 4 due to lack of long-term data on structural...

  3. Organisational StructureStructures for Growth

    OpenAIRE

    Ramskill, Jason

    2011-01-01

    Summary Rexam Plc has articulated that part of the company’s strategy is to make a carefully managed expansion into the emerging markets. In this report I suggest an alternative structure for Rexam to enable implementation of such a strategy and propose a business process for designing effective organisational structures. The work of Chandler (1962) charts the evolution of company organisational structures from the early centralised structures of the 1920s to the multidivisional str...

  4. Utilization of steam- and explosion-decompressed aspen wood by some anaerobes. [Acetivibrio cellulolyticus, Clostridium saccharolyticum, Zymomonas anaerobia

    Energy Technology Data Exchange (ETDEWEB)

    Khan, A W; Asther, M; Giuliano, C

    1984-01-01

    Tests made to study the suitability of using steam- and explosion-decompressed aspen wood as substrate in anaerobic fermentations indicated that after washing with dilute NaOH it becomes over 80% accessible to both mesophilic and thermophilic cellulolytic anaerobes and cellulases, compared with delignified, ball-milled pulp. After washing, this material was also found to be suitable for the single-step conversion of cellulose to ethanol using cocultures consisting of cellylolytic and ethanol-producing saccharolytic anaerobes; and without and after washing by the use of cellulolytic enzymes and ethanologenic anaerobes. 16 references, 3 tables.

  5. Distributed Structure Searchable Toxicity

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Distributed Structure Searchable Toxicity (DSSTox) online resource provides high quality chemical structures and annotations in association with toxicity data....

  6. Composite Structures Manufacturing Facility

    Data.gov (United States)

    Federal Laboratory Consortium — The Composite Structures Manufacturing Facility specializes in the design, analysis, fabrication and testing of advanced composite structures and materials for both...

  7. Motivy narození Páně na lidovém mobiliáři

    Czech Academy of Sciences Publication Activity Database

    Kafka, Luboš

    2016-01-01

    Roč. 11, č. 55 (2016), s. 8-11 ISSN 2336-8667 Institutional support: RVO:68378076 Keywords : visual folk art * Nativity * Jesus Christus * folk furniture * museum collections Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Impact of recycling stillage on conversion of dilute sulfuric acid pretreated corn stover to ethanol.

    Science.gov (United States)

    Mohagheghi, Ali; Schell, Daniel J

    2010-04-01

    Both the current corn starch to ethanol industry and the emerging lignocellulosic biofuels industry view recycling of spent fermentation broth or stillage as a method to reduce fresh water use. The objective of this study was to understand the impact of recycling stillage on conversion of corn stover to ethanol. Sugars in a dilute-acid pretreated corn stover hydrolysate were fermented to ethanol by the glucose-xylose fermenting bacteria Zymomonas mobilis 8b. Three serial fermentations were performed at two different initial sugar concentrations using either 10% or 25% of the stillage as makeup water for the next fermentation in the series. Serial fermentations were performed to achieve near steady state concentration of inhibitors and other compounds in the corn stover hydrolysate. Little impact on ethanol yields was seen at sugar concentrations equivalent to pretreated corn stover slurry at 15% (w/w) with 10% recycle of the stillage. However, ethanol yields became progressively poorer as the sugar concentration increased and fraction of the stillage recycled increased. At an equivalent corn stover slurry concentration of 20% with 25% recycled stillage the ethanol yield was only 5%. For this microorganism with dilute-acid pretreated corn stover, recycling a large fraction of the stillage had a significant negative impact on fermentation performance. Although this finding is of concern for biochemical-based lignocellulose conversion processes, other microorganism/pretreatment technology combinations will likely perform differently. (c) 2009 Wiley Periodicals, Inc.

  9. Ethanol fermentation of HTST extruded rye grain by bacteria and yeasts

    Energy Technology Data Exchange (ETDEWEB)

    Czarnecki, Z [Univ. of Agriculture, Poznan (Poland). Inst. of Food Technology; Nowak, J [Univ. of Agriculture, Poznan (Poland). Inst. of Food Technology

    1997-09-01

    High temperature extrusion cooking of rye was used as a pretreatment for ethanol fermentation, and yeasts and bacteria were compared for their fermentation rates. Extrusion cooking caused, on average, a 7.5% increase in ethanol yield in comparison to autoclaved samples. The best results were achieved for grain with a moisture of 21-23% which was extruded at temperatures of 160-180 C. Extrusion decreased the relative viscosity of rye grain water extracts, so it was possible to mash it without {alpha}-amylase. The efficiency of fermentation of extruded rye without Termamyl was equal to that of autoclaved and traditionally mashed rye (using {alpha}-amylase). The rate of fermentation of extruded rye grain by Zymomonas was higher during the first stage, but the final ethanol yield was similar for the bacterium and the yeast. Through both microorganisms gave good quality distillates, the concentration of compounds other than ethanol achieved from extruded rye mashes, which were fermented by Z. mobilis, was five times lower than for yeasts. (orig.)

  10. Pengaruh Variasi Mikroorganisme dan Pelarut Dalam Produksi Etanol Dari Nira Tebu (Sachharum officinarum Dengan Proses Fermentasi Ekstraktif

    Directory of Open Access Journals (Sweden)

    Yusfa Anugrah Baihaki

    2014-09-01

    Full Text Available Kebutuhan energi dari bahan bakar minyak bumi (BBM didunia semakin tahun mengalami peningkatan tajam. Salah satu energi alternatif yang didorong pemerintah Indonesia adalah dengan memproduksi bioetanol. Salah satu bahan yang sangat berpotensial sebagai bahan baku utama dalam pembuatan bioetanol adalah nira batang tebu. Upaya peningkatan produktivitas etanol dilakukan secara kontinyu dikarenakan pada fermentasi konvensional terdapat kendala pada produktivitas dan konsentrasi etanol yang rendah. Untuk itu perlu dilakukan penelitian untuk produksi etanol dengan keunggulan keterpaduan proses dan rendah energi yang selanjutnya dapat dijadikan sebagai dasar desain untuk rancang bangun skala industri kecil. Tujuan dari penelitian ini adalah untuk mengetahui performa terbaik dari variasi mikroorganisme dan pelarut yang digunakan dalam memproduksi etanol dengan proses fermentasi ekstraktif dan untuk mengetahui karakteristik kinerja sistem fermentasi kontinyu dalam bioreaktor packed bed dengan variasi mikroorganisme. Dalam penelitian ini digunakan macam variasi mikroorganisme Zymomonasmobilis A3 termutasi dan campuran Saccharomyces cerevisiae dan Pichiastipitis dengan sistem tanpa recycle dan pelarut n-Amyl Alcohol. Dari penelitian yang telah dilakukan diperoleh kesimpulan bahwa proses fermentasi kontinyu dan ekstraksi tanpa recycle menggunakan Zymomonas mobilis A3 dan pelarut n-Amyl Alkohol memberikan hasil produktivitas dan yield yang terbaik, yaitu sebesar 133,417 g/l.jam dan 35,049%.

  11. Spatial separation of photosynthesis and ethanol production by cell type-specific metabolic engineering of filamentous cyanobacteria.

    Science.gov (United States)

    Ehira, Shigeki; Takeuchi, Takuto; Higo, Akiyoshi

    2018-02-01

    Cyanobacteria, which perform oxygenic photosynthesis, have drawn attention as hosts for the direct production of biofuels and commodity chemicals from CO 2 and H 2 O using light energy. Although cyanobacteria capable of producing diverse chemicals have been generated by metabolic engineering, anaerobic non-photosynthetic culture conditions are often necessary for their production. In this study, we conducted cell type-specific metabolic engineering of the filamentous cyanobacterium Anabaena sp. PCC 7120, which forms a terminally differentiated cell called a heterocyst with a semi-regular spacing of 10-15 cells. Because heterocysts are specialized cells for nitrogen fixation, the intracellular oxygen level of heterocysts is maintained very low even when adjacent cells perform oxygenic photosynthesis. Pyruvate decarboxylase of Zymomonas mobilis and alcohol dehydrogenase of Synechocystis sp. PCC 6803 were exclusively expressed in heterocysts. Ethanol production was concomitant with nitrogen fixation in genetically engineered Anabaena sp. PCC 7120. Engineering of carbon metabolism in heterocysts improved ethanol production, and strain ET14, with an extra copy of the invB gene expressed from a heterocyst-specific promoter, produced 130.9 mg L -1 of ethanol after 9 days. ET14 produced 1681.9 mg L -1 of ethanol by increasing the CO 2 supply. Ethanol production per heterocyst cell was approximately threefold higher than that per cell of unicellular cyanobacterium. This study demonstrates the potential of heterocysts for anaerobic production of biofuels and commodity chemicals under oxygenic photosynthetic conditions.

  12. A highly active endo-levanase BT1760 of a dominant mammalian gut commensal Bacteroides thetaiotaomicron cleaves not only various bacterial levans, but also levan of timothy grass

    DEFF Research Database (Denmark)

    Mardo, Karin; Visnapuu, Triinu; Vija, Heiki

    2017-01-01

    of Pseudomonas syringae pv. tomato, its mutant Asp300Asn, levansucrases of Zymomonas mobilis, Erwinia herbicola, Halomonas smyrnensis as well as on levan isolated from timothy grass. For the first time a plant levan is shown as a perfect substrate for an endo-fructanase of a human gut bacterium. BT1760 degraded...... levans to FOS with degree of polymerization from 2 to 13. At optimal reaction conditions up to 1 g of FOS were produced per 1 mg of BT1760 protein. Low molecular weight (grass levan and levan synthesized from sucrose by the Lsc3Asp300Asn, were degraded most rapidly...... whilst levan produced by Lsc3 from raffinose least rapidly. BT1760 catalyzed finely at human body temperature (37°C) and in moderately acidic environment (pH 5-6) that is typical for the gut lumen. According to differential scanning fluorimetry, the Tm of the endo-levanase was 51.5°C. All tested levans...

  13. Conditioning of dilute-acid pretreated corn stover hydrolysate liquors by treatment with lime or ammonium hydroxide to improve conversion of sugars to ethanol.

    Science.gov (United States)

    Jennings, Edward W; Schell, Daniel J

    2011-01-01

    Dilute-acid pretreatment of lignocellulosic biomass enhances the ability of enzymes to hydrolyze cellulose to glucose, but produces many toxic compounds that inhibit fermentation of sugars to ethanol. The objective of this study was to compare the effectiveness of treating hydrolysate liquor with Ca(OH)2 and NH4OH for improving ethanol yields. Corn stover was pretreated in a pilot-scale reactor and then the liquor fraction (hydrolysate) was extracted and treated with various amounts of Ca(OH)2 or NH4OH at several temperatures. Glucose and xylose in the treated liquor were fermented to ethanol using a glucose-xylose fermenting bacteria, Zymomonas mobilis 8b. Sugar losses up to 10% occurred during treatment with Ca(OH)2, but these losses were two to fourfold lower with NH4OH treatment. Ethanol yields for NH4OH-treated hydrolysate were 33% greater than those achieved in Ca(OH)2-treated hydrolysate and pH adjustment to either 6.0 or 8.5 with NH4OH prior to fermentation produced equivalent ethanol yields. Copyright © 2010 Elsevier Ltd. All rights reserved.

  14. Accounting for all sugars produced during integrated production of ethanol from lignocellulosic biomass.

    Science.gov (United States)

    Schell, Daniel J; Dowe, Nancy; Chapeaux, Alexandre; Nelson, Robert S; Jennings, Edward W

    2016-04-01

    Accurate mass balance and conversion data from integrated operation is needed to fully elucidate the economics of biofuel production processes. This study explored integrated conversion of corn stover to ethanol and highlights techniques for accurate yield calculations. Acid pretreated corn stover (PCS) produced in a pilot-scale reactor was enzymatically hydrolyzed and the resulting sugars were fermented to ethanol by the glucose-xylose fermenting bacteria, Zymomonas mobilis 8b. The calculations presented here account for high solids operation and oligomeric sugars produced during pretreatment, enzymatic hydrolysis, and fermentation, which, if not accounted for, leads to overestimating ethanol yields. The calculations are illustrated for enzymatic hydrolysis and fermentation of PCS at 17.5% and 20.0% total solids achieving 80.1% and 77.9% conversion of cellulose and xylan to ethanol and ethanol titers of 63g/L and 69g/L, respectively. These procedures will be employed in the future and the resulting information used for techno-economic analysis. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Systematic simulation of a tubular recycle reactor on the basis of pilot plant experiments

    Energy Technology Data Exchange (ETDEWEB)

    Paar, H; Narodoslawsky, M; Moser, A [Technische Univ., Graz (Austria). Inst. fuer Biotechnologie, Mikrobiologie und Abfalltechnologie

    1990-10-10

    Systematic simulatiom may decisively help in development and optimization of bioprocesses. By applying simulation techniques, optimal use can be made of experimental data, decreasing development costs and increasing the accuracy in predicting the behavior of an industrial scale plant. The procedure of the dialogue between simulation and experimental efforts will be exemplified in a case study. Alcoholic fermentation of glucose by zymomonas mobilis bacteria in a gasified turbular recycle reactor was studied first by systematic simulation, using a computer model based solely on literature data. On the base of the results of this simulation, a 0.013 m{sup 3} pilot plant reactor was constructed. The pilot plant experiments, too, were based on the results of the systematic simulation. Simulated and experimental data were well in agreement. The pilot plant experiments reiterated the trends and limits of the process as shown by the simulation results. Data from the pilot plant runs were then used to improve the simulation model. This improved model was subsequently used to simulate the performances of an industrial scale plant. The results of this simulation are presented. They show that the alcohol fermentation in a tubular recycle reactor is potentially advantageous to other reactor configurations, especially to continuous stirred tanks. (orig.).

  16. Classification of Rhizomonas suberifaciens, an unnamed Rhizomonas species, and Sphingomonas spp. in rRNA superfamily IV.

    Science.gov (United States)

    van Bruggen, A H; Jochimsen, K N; Steinberger, E M; Segers, P; Gillis, M

    1993-01-01

    Thermal melting profiles of hybrids between 3H-labeled rRNA of Rhizomonas suberifaciens, the causal agent of corky root of lettuce, and chromosomal DNAs from 27 species of gram-negative bacteria indicated that the genus Rhizomonas belongs to superfamily IV of De Ley. On the basis of the melting temperatures of DNA hybrids with rRNAs from the type strains of R. suberifaciens, Sphingomonas paucimobilis, and Sphingomonas capsulata, Rhizomonas strains constitute a separate branch in superfamily IV, which is closely related to but separate from branches containing Zymomonas mobilis, Sphingomonas spp., and S. capsulata. Sphingomonas yanoikuyae and Rhizomonas sp. strain WI4 are located toward the base of the Rhizomonas rRNA branch. DNA-DNA hybridization indicated that S. yanoikuyae is equidistant from Rhizomonas sp. strain WI4 and S. paucimobilis. Sequences of 270 bp of 16S ribosomal DNAs from eight strains of Rhizomonas spp., eight strains of Sphingomonas spp., and Agrobacterium tumefaciens indicated that S. yanoikuyae and Rhizomonas sp. strains WI4 and CA16 are genetically more closely related to R. suberifaciens than to Sphingomonas spp. Thus, S. yanoikuyae may need to be transferred to the genus Rhizomonas on the basis of the results of further study.

  17. Simultaneous saccharification and co-fermentation of peracetic acid pretreated sugar cane bagasse

    Energy Technology Data Exchange (ETDEWEB)

    Teixeira, L.C. [Fundacao Centro Tecnologico de Minas Gerais, Belo Horizonte (Brazil); Linden, J.C.; Schroeder, H.A. [Colorado State University, Fort Collins, CO (United States)

    1999-07-01

    Previous work in our laboratory has demonstrated that peracetic acid improves the enzymatic digestibility of lignocellulosic materials. From the same studies, use of dilute alkali solutions as a pre-pretreatment prior to peracetic acid lignin oxidation increases sugar conversion yields in a synergistic, not additive, manner. Deacetylation of xylan is conducted easily by use of dilute alkali solutions at mild conditions. In this paper, the effectiveness of peracetic acid pretreatment of sugar cane bagasse combined with an alkaline pre-pretreatment, is evaluated through simultaneous saccharification and co-fermentation (SSCF) procedures. A practical 92% of theoretical ethanol yield using recombinant Zymomonas mobilis CP4/pZB5 is achieved using 6% NaOH/I5% peracetic acid pretreated substrate. No sugar accumulation is observed during SSCF; the recombinant microorganism exhibits greater glucose utilization rates than those of xylose. Acetate levels at the end of the co-fermentations are less than 0.2% (w/v). Based on demonstrated reduction of acetyl groups of the biomass, alkaline pre-pretreatments help to reduce peracetic acid requirements. The influence of deacetylation is more pronounced in combined pretreatments using lower peracetic acid loadings. Stereochemical impediments of the acetyl groups in hemicellulase on the activity of specific enzymes may be involved. (author)

  18. Clostridium thermocellum ATCC27405 transcriptomic, metabolomic and proteomic profiles after ethanol stress

    Directory of Open Access Journals (Sweden)

    Yang Shihui

    2012-07-01

    Full Text Available Abstract Background Clostridium thermocellum is a candidate consolidated bioprocessing biocatalyst, which is a microorganism that expresses enzymes for both cellulose hydrolysis and its fermentation to produce fuels such as lignocellulosic ethanol. However, C. thermocellum is relatively sensitive to ethanol compared to ethanologenic microorganisms such as yeast and Zymomonas mobilis that are used in industrial fermentations but do not possess native enzymes for industrial cellulose hydrolysis. Results In this study, C. thermocellum was grown to mid-exponential phase and then treated with ethanol to a final concentration of 3.9 g/L to investigate its physiological and regulatory responses to ethanol stress. Samples were taken pre-shock and 2, 12, 30, 60, 120, and 240 min post-shock, and from untreated control fermentations for systems biology analyses. Cell growth was arrested by ethanol supplementation with intracellular accumulation of carbon sources such as cellobiose, and sugar phosphates, including fructose-6-phosphate and glucose-6-phosphate. The largest response of C. thermocellum to ethanol shock treatment was in genes and proteins related to nitrogen uptake and metabolism, which is likely important for redirecting the cells physiology to overcome inhibition and allow growth to resume. Conclusion This study suggests possible avenues for metabolic engineering and provides comprehensive, integrated systems biology datasets that will be useful for future metabolic modeling and strain development endeavors.

  19. De novo biosynthesis of biodiesel by Escherichia coli in optimized fed-batch cultivation.

    Directory of Open Access Journals (Sweden)

    Yangkai Duan

    Full Text Available Biodiesel is a renewable alternative to petroleum diesel fuel that can contribute to carbon dioxide emission reduction and energy supply. Biodiesel is composed of fatty acid alkyl esters, including fatty acid methyl esters (FAMEs and fatty acid ethyl esters (FAEEs, and is currently produced through the transesterification reaction of methanol (or ethanol and triacylglycerols (TAGs. TAGs are mainly obtained from oilseed plants and microalgae. A sustainable supply of TAGs is a major bottleneck for current biodiesel production. Here we report the de novo biosynthesis of FAEEs from glucose, which can be derived from lignocellulosic biomass, in genetically engineered Escherichia coli by introduction of the ethanol-producing pathway from Zymomonas mobilis, genetic manipulation to increase the pool of fatty acyl-CoA, and heterologous expression of acyl-coenzyme A: diacylglycerol acyltransferase from Acinetobacter baylyi. An optimized fed-batch microbial fermentation of the modified E. coli strain yielded a titer of 922 mg L(-1 FAEEs that consisted primarily of ethyl palmitate, -oleate, -myristate and -palmitoleate.

  20. Pulque production from fermented agave sap as a dietary supplement in Prehispanic Mesoamerica.

    Science.gov (United States)

    Correa-Ascencio, Marisol; Robertson, Ian G; Cabrera-Cortés, Oralia; Cabrera-Castro, Rubén; Evershed, Richard P

    2014-09-30

    Although in modern societies fermented beverages are associated with socializing, celebration, and ritual, in ancient times they were also importa`nt sources of essential nutrients and potable water. In Mesoamerica, pulque, an alcoholic beverage produced from the fermented sap of several species of maguey plants (Agavaceae; Fig. 1) is hypothesized to have been used as a dietary supplement and risk-buffering food in ancient Teotihuacan (150 B.C. to A.D. 650). Although direct archaeological evidence of pulque production is lacking, organic residue analysis of pottery vessels offers a new avenue of investigation. However, the chemical components of alcoholic beverages are water-soluble, greatly limiting their survival over archaeological timescales compared with hydrophobic lipids widely preserved in food residues. Hence, we apply a novel lipid biomarker approach that considers detection of bacteriohopanoids derived from the ethanol-producing bacterium Zymomonas mobilis for identifying pulque production/consumption in pottery vessels. Gas chromatography-mass spectrometry selected ion monitoring (m/z 191) of lipid extracts of >300 potsherds revealed characteristic bacteriohopanoid distributions in a subset of 14 potsherds. This hopanoid biomarker approach offers a new means of identifying commonly occurring bacterially fermented alcoholic beverages worldwide, including palm wine, beer, cider, perry, and other plant sap- or fruit-derived beverages [Swings J, De Ley J (1977) Bacteriol Rev 41(1):1-46].

  1. Structural patterns in nature

    DEFF Research Database (Denmark)

    Wester, Ture

    2003-01-01

    be an inspiration to structural morphologists and other dealing with the shaping of structures for buildings and other objects. Often the patterns appear in "dual" materializations, which indicate two radically different structural types of action. Randomness as a generator for optimal and basic structural action...

  2. Structural patterns in nature

    DEFF Research Database (Denmark)

    Wester, Ture

    2004-01-01

    be an inspiration to structural morphologists and other dealing with the shaping of structures for buildings and other objects. Often the patterns appear in "dual" materializations, which indicate two radically different structural types of action. Randomness as a generator for optimal and basic structural action...

  3. Structure-soil-structure interaction of nuclear structures

    International Nuclear Information System (INIS)

    Snyder, M.D.; Shaw, D.E.; Hall, J.R. Jr.

    1975-01-01

    Structure-to-structure interaction resulting from coupling of the foundations through the soil has traditionally been neglected in the seismic analysis of nuclear power plants. This paper examines the phenomenon and available methods of analytical treatment, including finite element and lumped parameter methods. Finite element techniques have lead to the treatment of through soil coupling of structural foundations using two dimensional plane strain models owing to the difficulty of considering three dimensional finite element models. The coupling problem is treated by means of a lumped parameter model derived from elastic half-space considerations. Consequently, the method is applicable to the interaction of any number of foundations and allows the simultaneous application of tri-directional excitation. The method entails the idealization of interacting structures as lumped mass/shear beams with lumped soil springs and dampers beneath each foundation plus a coupling matrix between the interacting foundations. Utilizing classical elastic half-space methods, the individual foundation soil springs and dampers may be derived, accounting for the effects of embedment and soil layering, analogous to the methods used for single soil-structure, interaction problems. The coupling matrix is derived by generating influence coefficients based on the geometric relationship of the structures using classical half-space solutions. The influence coefficients form the coupling flexibility matrix which is inverted to yield the coupling matrix for the lumped parameter model

  4. Strategy implemented through structuring and new structures

    DEFF Research Database (Denmark)

    Nielsen, Renate

    Research objective: With the purpose of generating a new understanding of how development in organisations take place, an interpretive perspective at continuous processes in organisations will be applied: more specifically at how organisational interpretation forms an organisation's strategy...... and how the strategy is implemented through structuring, new structures and routines....

  5. Task structure, need for structure, and creativity

    NARCIS (Netherlands)

    Rietzschel, Eric; Slijkhuis, Marjette; Van Yperen, Nico W.

    2014-01-01

    Although creativity is often seen as requiring spontaneity and flexibility, recent work suggests that there is creative potential in a structured and systematic approach as well. In a series of four experiments, we show that when Personal Need for Structure (PNS) is high, either chronic (Study 1) or

  6. Category I structures program

    International Nuclear Information System (INIS)

    Endebrock, E.G.; Dove, R.C.

    1981-01-01

    The objective of the Category I Structure Program is to supply experimental and analytical information needed to assess the structural capacity of Category I structures (excluding the reactor cntainment building). Because the shear wall is a principal element of a Category I structure, and because relatively little experimental information is available on the shear walls, it was selected as the test element for the experimental program. The large load capacities of shear walls in Category I structures dictates that the experimental tests be conducted on small size shear wall structures that incorporates the general construction details and characteristics of as-built shear walls

  7. The Structural Integrity Centre

    International Nuclear Information System (INIS)

    Tomkins, B.

    1987-01-01

    The paper concerns the development and work of the Structural Integrity Centre (SIC) at Risley Nuclear Laboratories, United Kingdom. The centre was set up to provide authoritative advice to plant designers and operators on the integrity and life assessment of structures and components across the reactor projects in the United Kingdom. A description is given of the structure and role of the SIC, as well as the Structural Integrity Assessment work. The assessment methods are described for thermally loaded structures and welded structures. Finally, defect significance assessment and environmental effects are outlined. (U.K.)

  8. Band structure of semiconductors

    CERN Document Server

    Tsidilkovski, I M

    2013-01-01

    Band Structure of Semiconductors provides a review of the theoretical and experimental methods of investigating band structure and an analysis of the results of the developments in this field. The book presents the problems, methods, and applications in the study of band structure. Topics on the computational methods of band structure; band structures of important semiconducting materials; behavior of an electron in a perturbed periodic field; effective masses and g-factors for the most commonly encountered band structures; and the treatment of cyclotron resonance, Shubnikov-de Haas oscillatio

  9. Structural behaviour of super-light structures

    DEFF Research Database (Denmark)

    Bagger, Anne; Hertz, Kristian Dahl

    2010-01-01

    structural functions: it leads load to the skeleton, it stabilizes the compression members of the skeleton, and it redistributes loads that are not optimal for the skeleton shape. In this paper, FE analysis is used to investigated the behaviour of a series of SLS beams of concrete, under varying stiffness......A new structural concept, called Super-light Structures (SLS), has recently been invented and patented at the Technical University of Denmark. The basic concept of SLS is to construct a skeleton of a stiff and strong material, such as ordinary or high strength concrete, and stabilize this skeleton...... with a lighter and softer material, such as lightweight concrete. The combined use of stiff and light material in SLS results in structures of high stiffness and low weight. The applied technology and the advantages of SLS are elaborated upon in [1] in these proceedings. The present paper focuses...

  10. Structural system identification: Structural dynamics model validation

    Energy Technology Data Exchange (ETDEWEB)

    Red-Horse, J.R.

    1997-04-01

    Structural system identification is concerned with the development of systematic procedures and tools for developing predictive analytical models based on a physical structure`s dynamic response characteristics. It is a multidisciplinary process that involves the ability (1) to define high fidelity physics-based analysis models, (2) to acquire accurate test-derived information for physical specimens using diagnostic experiments, (3) to validate the numerical simulation model by reconciling differences that inevitably exist between the analysis model and the experimental data, and (4) to quantify uncertainties in the final system models and subsequent numerical simulations. The goal of this project was to develop structural system identification techniques and software suitable for both research and production applications in code and model validation.

  11. Optimal Priority Structure, Capital Structure, and Investment

    OpenAIRE

    Dirk Hackbarth; David C. Mauer

    2012-01-01

    We study the interaction between financing and investment decisions in a dynamic model, where the firm has multiple debt issues and equityholders choose the timing of investment. Jointly optimal capital and priority structures can virtually eliminate investment distortions because debt priority serves as a dynamically optimal contract. Examining the relative efficiency of priority rules observed in practice, we develop several predictions about how firms adjust their priority structure in res...

  12. Structural health monitoring for ship structures

    Energy Technology Data Exchange (ETDEWEB)

    Farrar, Charles [Los Alamos National Laboratory; Park, Gyuhae [Los Alamos National Laboratory; Angel, Marian [Los Alamos National Laboratory; Bement, Matthew [Los Alamos National Laboratory; Salvino, Liming [NSWC, CADEROCK

    2009-01-01

    Currently the Office of Naval Research is supporting the development of structural health monitoring (SHM) technology for U.S. Navy ship structures. This application is particularly challenging because of the physical size of these structures, the widely varying and often extreme operational and environmental conditions associated with these ships missions, lack of data from known damage conditions, limited sensing that was not designed specifically for SHM, and the management of the vast amounts of data that can be collected during a mission. This paper will first define a statistical pattern recognition paradigm for SHM by describing the four steps of (1) Operational Evaluation, (2) Data Acquisition, (3) Feature Extraction, and (4) Statistical Classification of Features as they apply to ship structures. Note that inherent in the last three steps of this process are additional tasks of data cleansing, compression, normalization and fusion. The presentation will discuss ship structure SHM challenges in the context of applying various SHM approaches to sea trials data measured on an aluminum multi-hull high-speed ship, the HSV-2 Swift. To conclude, the paper will discuss several outstanding issues that need to be addressed before SHM can make the transition from a research topic to actual field applications on ship structures and suggest approaches for addressing these issues.

  13. Space Structure Development

    Science.gov (United States)

    Smith, Thomas

    2015-01-01

    The duration of my Summer 2015 Internship Tour at NASA's Johnson Space Center was spent working in the Structural Engineering Division's Structures Branch. One of the two main roles of the Structures Branch, ES2, is to ensure the structural integrity of spacecraft vehicles and the structural subsystems needed to support those vehicles. The other main objective of this branch is to develop the lightweight structures that are necessary to take humans beyond Low-Earth Orbit. Within ES2, my four projects involved inflatable space structure air bladder material testing; thermal and impact material testing for spacecraft windows; structural analysis on a joint used in the Boeing CST-100 airbag system; and an additive manufacturing design project.

  14. Structural Measures - Hospital

    Data.gov (United States)

    U.S. Department of Health & Human Services — A list of hospitals and the structural measures they report. A structural measure reflects the environment in which hospitals care for patients, for example, whether...

  15. Cell packing structures

    KAUST Repository

    Pottmann, Helmut; Jiang, Caigui; Hö binger, Mathias; Wang, Jun; Bompas, Philippe; Wallner, Johannes

    2015-01-01

    optimization schemes for the computation of quad-based support structures. Hex-dominant structures may be designed via Voronoi tessellations, power diagrams, sphere packings and various extensions of these concepts. Apart from the obvious application as load

  16. Nonlinear Structural Analysis

    Indian Academy of Sciences (India)

    The Structures Panel of the Aeronautics Research and Development Board of India ... A great variety of topics was covered, including themes such as nonlinear finite ... or shell structures, and three are on the composite form of construction, ...

  17. Structures composing protein domains.

    Science.gov (United States)

    Kubrycht, Jaroslav; Sigler, Karel; Souček, Pavel; Hudeček, Jiří

    2013-08-01

    This review summarizes available data concerning intradomain structures (IS) such as functionally important amino acid residues, short linear motifs, conserved or disordered regions, peptide repeats, broadly occurring secondary structures or folds, etc. IS form structural features (units or elements) necessary for interactions with proteins or non-peptidic ligands, enzyme reactions and some structural properties of proteins. These features have often been related to a single structural level (e.g. primary structure) mostly requiring certain structural context of other levels (e.g. secondary structures or supersecondary folds) as follows also from some examples reported or demonstrated here. In addition, we deal with some functionally important dynamic properties of IS (e.g. flexibility and different forms of accessibility), and more special dynamic changes of IS during enzyme reactions and allosteric regulation. Selected notes concern also some experimental methods, still more necessary tools of bioinformatic processing and clinically interesting relationships. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  18. Standing wave accelerating structures

    International Nuclear Information System (INIS)

    Zavadtsev, A.A.; Zverev, B.V.; Sobepin, N.P.

    1984-01-01

    Accelerating ELA structures are considered and chosen for applied purposes of special designation. Accelerating structures with the standing wave are considered most effective for small size ELA. Designs and results of experimental investigation of two new accelerating structures are described. These are structures of the ''ring'' type with a decreased number of excitinq oscillation types and strucuture with transverse rods with a twice smaller transverse size as compared with the biperiodical structure with internal connection resonators. The accelerating biperiodical structures of the conventional type by the fact that the whole structure is not a linear chain of connected resonators, but a ring one. Model tests have shown that the homogeneous structure with transverse rods (STR) at the frequency of 2.8 GHz in the regime of the standing wave has an effective shunt resistance equalling 23 MOhm/m. It is shown that the small transverse size of biperiodic STR makes its application in logging linear electron accelerators

  19. Photon structure function - theory

    International Nuclear Information System (INIS)

    Bardeen, W.A.

    1984-12-01

    The theoretical status of the photon structure function is reviewed. Particular attention is paid to the hadronic mixing problem and the ability of perturbative QCD to make definitive predictions for the photon structure function. 11 references

  20. Fundamentals of structural dynamics

    CERN Document Server

    Craig, Roy R

    2006-01-01

    From theory and fundamentals to the latest advances in computational and experimental modal analysis, this is the definitive, updated reference on structural dynamics.This edition updates Professor Craig's classic introduction to structural dynamics, which has been an invaluable resource for practicing engineers and a textbook for undergraduate and graduate courses in vibrations and/or structural dynamics. Along with comprehensive coverage of structural dynamics fundamentals, finite-element-based computational methods, and dynamic testing methods, this Second Edition includes new and e

  1. Extended icosahedral structures

    CERN Document Server

    Jaric, Marko V

    1989-01-01

    Extended Icosahedral Structures discusses the concepts about crystal structures with extended icosahedral symmetry. This book is organized into six chapters that focus on actual modeling of extended icosahedral crystal structures. This text first presents a tiling approach to the modeling of icosahedral quasiperiodic crystals. It then describes the models for icosahedral alloys based on random connections between icosahedral units, with particular emphasis on diffraction properties. Other chapters examine the glassy structures with only icosahedral orientational order and the extent of tra

  2. Structure sensitivity in adsorption

    DEFF Research Database (Denmark)

    Hammer, Bjørk; Nielsen, Ole Holm; Nørskov, Jens Kehlet

    1997-01-01

    The structure sensitivity of CO adsorption on different flat, stepped, kinked and reconstructed Pt surfaces is studied using large-scale density-functional calculations. We find an extremely strong structure sensitivity in the adsorption energy with variations up to 1 eV (or 100%) from one...... structure to the next. We propose a model to explain this behavior, and use it to discuss more generally the origin of structure sensitivity in heterogeneous catalysis....

  3. Neutrality in bipolar structures

    DEFF Research Database (Denmark)

    Montero, Javier; Rodríguez, J. Tinguaro; Franco, Camilo

    2014-01-01

    In this paper, we want to stress that bipolar knowledge representation naturally allows a family of middle states which define as a consequence different kinds of bipolar structures. These bipolar structures are deeply related to the three types of bipolarity introduced by Dubois and Prade, but our...... approach offers a systematic explanation of how such bipolar structures appear and can be identified....

  4. HIV Structural Database

    Science.gov (United States)

    SRD 102 HIV Structural Database (Web, free access)   The HIV Protease Structural Database is an archive of experimentally determined 3-D structures of Human Immunodeficiency Virus 1 (HIV-1), Human Immunodeficiency Virus 2 (HIV-2) and Simian Immunodeficiency Virus (SIV) Proteases and their complexes with inhibitors or products of substrate cleavage.

  5. Encounters with Structure

    Science.gov (United States)

    Connell, R. W.

    2004-01-01

    A discussion of poststructuralism may be helped by reflecting on the trajectory of ideas and practices that produced it. Structuralism as an intellectual movement has had a bad press and doubtless some of that is deserved. But structuralism was more diverse and creative, and structural analysis as a procedure in social science is more important,…

  6. Modern frame structure buildings

    Directory of Open Access Journals (Sweden)

    В. М. Першаков

    2013-07-01

    Full Text Available The article deals with the design, construction and implementation of reinforced concrete frame structures with span 18, 21 m for agricultural production buildings, hall-premises of public buildings and buildings of agricultural aviation. Structures are prefabricated frame buildings and have such advantages as large space inside the structure and lower cost compared with other facilities with same purpose

  7. Growing Timber Structures

    DEFF Research Database (Denmark)

    Tamke, Martin; Evers, Henrik Leander; Stasiuk, David

    2013-01-01

    The contemporary design of timber structures has to answer questions concerning structural stability, production impact and energy implications in ever earlier stages. The interrelation of these levels creates a complexity that is difficult to resolve through contemporary linear parametric...... to integrate the behaviour of networked systems into structures made from wooden material....

  8. Basic structural dynamics

    CERN Document Server

    Anderson, James C

    2012-01-01

    A concise introduction to structural dynamics and earthquake engineering Basic Structural Dynamics serves as a fundamental introduction to the topic of structural dynamics. Covering single and multiple-degree-of-freedom systems while providing an introduction to earthquake engineering, the book keeps the coverage succinct and on topic at a level that is appropriate for undergraduate and graduate students. Through dozens of worked examples based on actual structures, it also introduces readers to MATLAB, a powerful software for solving both simple and complex structural d

  9. Shell-like structures

    CERN Document Server

    Altenbach, Holm

    2011-01-01

    In this volume, scientists and researchers from industry discuss the new trends in simulation and computing shell-like structures. The focus is put on the following problems: new theories (based on two-dimensional field equations but describing non-classical effects), new constitutive equations (for materials like sandwiches, foams, etc. and which can be combined with the two-dimensional shell equations), complex structures (folded, branching and/or self intersecting shell structures, etc.) and shell-like structures on different scales (for example: nano-tubes) or very thin structures (similar

  10. High spin structure functions

    International Nuclear Information System (INIS)

    Khan, H.

    1990-01-01

    This thesis explores deep inelastic scattering of a lepton beam from a polarized nuclear target with spin J=1. After reviewing the formation for spin-1/2, the structure functions for a spin-1 target are defined in terms of the helicity amplitudes for forward compton scattering. A version of the convolution model, which incorporates relativistic and binding energy corrections is used to calculate the structure functions of a neutron target. A simple parameterization of these structure functions is given in terms of a few neutron wave function parameters and the free nucleon structure functions. This allows for an easy comparison of structure functions calculated using different neutron models. (author)

  11. PRODUCT STRUCTURE DIGITAL MODEL

    Directory of Open Access Journals (Sweden)

    V.M. Sineglazov

    2005-02-01

    Full Text Available  Research results of representation of product structure made by means of CADDS5 computer-aided design (CAD system, Product Data Management Optegra (PDM system and Product Life Cycle Management Wind-chill system (PLM, are examined in this work. Analysis of structure component development and its storage in various systems is carried out. Algorithms of structure transformation required for correct representation of the structure are considered. Management analysis of electronic mockup presentation of the product structure is carried out for Windchill system.

  12. Structures in sculptures

    DEFF Research Database (Denmark)

    Vanggaard, Ole

    Conceptual design of structures in architecture involves a dialog between a structural and an architectural concept. The architecture is very often changed in this process. The dialog between the parties are described and well known. It is often very difficult to bridge the gab between...... the different concepts and find a final synthesis, but the problem is known. Large sculptures represent structural challenges. The design of the supports inside the structures reveals often a very different world from the outside view of the sculpture. The piece of art and its structure may have two very...... different lives. A sculpture of today may be very dissimilar from what we have seen earlier. The structure becomes sometimes a visual part of the art. Ultimately, there may not be any distinction between structure and art. The technical demand, the durability and the safety are just as important for a large...

  13. Decoupling structure and metallogenesis

    International Nuclear Information System (INIS)

    Tong Hangshou

    1993-01-01

    The decoupling structure is, at present, a hot spot for the study in geoscience. A study on the decoupling structure is not only of great theoretical significance, but also of more economic importance. The author briefly discusses the study of the decoupling structure in terms of its present status, implication, characteristics, formation mechanism and theoretical significance, in addition, with emphasis on the expounding of the decoupling structure over endogenic metallic deposits such as oil and gas, coal, gold, silver, copper, lead, zinc and iron etc. At last reconsideration is made on the ore control theory of the decoupling structure to the ore control structure in the uranium ore field in South China. The author proposes a superficial idea in order to provide a basis of geological structures for expanding old mining areas, opening up new areas(bases), and prospecting for large and rich uranium deposits

  14. Robustness of Structures

    DEFF Research Database (Denmark)

    Faber, Michael Havbro; Vrouwenvelder, A.C.W.M.; Sørensen, John Dalsgaard

    2011-01-01

    In 2005, the Joint Committee on Structural Safety (JCSS) together with Working Commission (WC) 1 of the International Association of Bridge and Structural Engineering (IABSE) organized a workshop on robustness of structures. Two important decisions resulted from this workshop, namely...... ‘COST TU0601: Robustness of Structures’ was initiated in February 2007, aiming to provide a platform for exchanging and promoting research in the area of structural robustness and to provide a basic framework, together with methods, strategies and guidelines enhancing robustness of structures...... the development of a joint European project on structural robustness under the COST (European Cooperation in Science and Technology) programme and the decision to develop a more elaborate document on structural robustness in collaboration between experts from the JCSS and the IABSE. Accordingly, a project titled...

  15. Exotic cluster structures on

    CERN Document Server

    Gekhtman, M; Vainshtein, A

    2017-01-01

    This is the second paper in the series of papers dedicated to the study of natural cluster structures in the rings of regular functions on simple complex Lie groups and Poisson-Lie structures compatible with these cluster structures. According to our main conjecture, each class in the Belavin-Drinfeld classification of Poisson-Lie structures on \\mathcal{G} corresponds to a cluster structure in \\mathcal{O}(\\mathcal{G}). The authors have shown before that this conjecture holds for any \\mathcal{G} in the case of the standard Poisson-Lie structure and for all Belavin-Drinfeld classes in SL_n, n<5. In this paper the authors establish it for the Cremmer-Gervais Poisson-Lie structure on SL_n, which is the least similar to the standard one.

  16. Structural realism beyond physics.

    Science.gov (United States)

    Tulodziecki, Dana

    2016-10-01

    The main purpose of this paper is to test structural realism against (one example from) the historical record. I begin by laying out an existing challenge to structural realism - that of providing an example of a theory exhibiting successful structures that were abandoned - and show that this challenge can be met by the miasma theory of disease. However, rather than concluding that this is an outright counterexample to structural realism, I use this case to show why it is that structural realism, in its current form, has trouble dealing with theories outside physics. I end by making some concrete suggestions for structural realists to pursue if, indeed, they are serious about extending structural realism to other domains. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Structure - Riverine Flow Structure (Dike/Wingdam)

    Data.gov (United States)

    Army Corps of Engineers, Department of the Army, Department of Defense — A natural or man-made flow (or sediment) control structure in a water course or water body such as a dike or weir. This feature should not be used to model a levee....

  18. STRUCTURAL STABILITY AND ELECTRONIC STRUCTURE OF ...

    African Journals Online (AJOL)

    2012-12-31

    Dec 31, 2012 ... may be applications at high temperature strength and corrosion ... B2 structure, like that found in cesium-chloride (CsCl) and chemical formula RM, where R denotes a rare - earth element and M denotes a late transition metal ...

  19. Implications of social structure

    DEFF Research Database (Denmark)

    Brask, Josefine Bohr

    Social systems in nature are characterised by heterogeneous social structures. The pattern of social interactions or associations between individuals within populations (i.e. their social network) is typically non-random. Such structuring may have important implications for the expression...... and evolution of behaviour, and for individual fitness. In this thesis I investigated implications of social structure for fitness and behaviour, with focus on three main areas: social structure & fitness, social structure & communication, and social structure & cooperation. These areas were investigated......, we investigate empirically the role of the social environment of individuals for their communication patterns. Our study species is a song bird, the black-capped chickadee (Poecile atricapillus). The results suggest that individual communication in this species is influenced by features of the local...

  20. Reforming Organizational Structures

    OpenAIRE

    Van de Walle, Steven

    2016-01-01

    textabstractPublic sectors have undergone major transformations. Public sector reform touches upon the core building blocks of the public sector: organizational structures, people and finances. These are objects of reform. This chapter presents and discusses a set of major transformations with regard to organizational structures. It provides readers a fairly comprehensive overview of the key reforms that have taken place in Western public sectors. Structural reforms in the public sector show ...

  1. Hadron structure functions

    International Nuclear Information System (INIS)

    Martin, F.

    1981-03-01

    The x dependence of hadron structure functions is investigated. If quarks can exist in very low mass states (10 MeV for d and u quarks) the pion structure function is predicted to behave like (1-x) and not (1-x) 2 in a x-region around 1. Relativistic and non-relativistic quark bound state pictures of hadrons are considered together with their relation with the Q 2 evolution of structure functions. Good agreement with data is in general obtained

  2. New structures for physics

    Energy Technology Data Exchange (ETDEWEB)

    Coecke, Bob (ed.)

    2011-07-01

    This volume provides a series of tutorials on mathematical structures which recently have gained prominence in physics, ranging from quantum foundations, via quantum information, to quantum gravity. These include the theory of monoidal categories and corresponding graphical calculi, Girard's linear logic, Scott domains, lambda calculus and corresponding logics for typing, topos theory, and more general process structures. Most of these structures are very prominent in computer science; the chapters here are tailored towards an audience of physicists. (orig.)

  3. Structural elements design manual

    CERN Document Server

    Draycott, Trevor

    2012-01-01

    Gives clear explanations of the logical design sequence for structural elements. The Structural Engineer says: `The book explains, in simple terms, and with many examples, Code of Practice methods for sizing structural sections in timber, concrete,masonry and steel. It is the combination into one book of section sizing methods in each of these materials that makes this text so useful....Students will find this an essential support text to the Codes of Practice in their study of element sizing'.

  4. Historic timber roof structures

    OpenAIRE

    Magina, Miguel Jorge

    2013-01-01

    Dissertação para obtenção do Grau de Mestre em Engenharia Civil – Estruturas e Geotecnia This dissertation covers the study of historic timber roof structures in Transylvania area - Romania, the structures type, its elements and connection variety between them. Procedures to study a structure of this category are approached. It is also referred semi and non-destructive tests that can be done to better understand the present wood characteristics, and potential reparation or strengthening...

  5. Advance in structural bioinformatics

    CERN Document Server

    Wei, Dongqing; Zhao, Tangzhen; Dai, Hao

    2014-01-01

    This text examines in detail mathematical and physical modeling, computational methods and systems for obtaining and analyzing biological structures, using pioneering research cases as examples. As such, it emphasizes programming and problem-solving skills. It provides information on structure bioinformatics at various levels, with individual chapters covering introductory to advanced aspects, from fundamental methods and guidelines on acquiring and analyzing genomics and proteomics sequences, the structures of protein, DNA and RNA, to the basics of physical simulations and methods for conform

  6. [Hospital organizational structure].

    Science.gov (United States)

    Bittar, O J

    1994-01-01

    The basic point for an Institution to work is the existence of a definite organizational structure that puts together similar areas allowing decisions and the operationalization of different tasks. Knowledge and analysis of structures of private and public hospitals and a bibliography review about the issue is the purpose of this paper. Suggestions are given about the elaboration of small structures and the utilization of matrix management in order to accomplish the hospitals objectives.

  7. Catalytic distillation structure

    Science.gov (United States)

    Smith, L.A. Jr.

    1984-04-17

    Catalytic distillation structure is described for use in reaction distillation columns, and provides reaction sites and distillation structure consisting of a catalyst component and a resilient component intimately associated therewith. The resilient component has at least about 70 volume % open space and is present with the catalyst component in an amount such that the catalytic distillation structure consists of at least 10 volume % open space. 10 figs.

  8. BOMB STABILIZING STRUCTURE

    Science.gov (United States)

    Kelley, J.L.; Runyan, C.E.

    1963-12-10

    A stabilizinig structure capable of minimizing deviations of a falling body such as a bomb from desired trajectory is described. The structure comprises a fin or shroud arrangement of double-wedge configuration, the feeding portion being of narrow wedge shape and the after portion being of a wider wedge shape. The structure provides a force component for keeping the body on essentially desired trajectory throughout its fall. (AEC)

  9. Photon structure function

    International Nuclear Information System (INIS)

    Bardeen, W.A.

    1980-11-01

    Theoretical understanding of the photon structure function is reviewed. As an illustration of the pointlike component, the parton model is briefly discussed. However, the systematic study of the photon structure function is presented through the framework of the operator product expansion. Perturbative QCD is used as the theoretical basis for the calculation of leading contributions to the operator product expansion. The influence of higher order QCD effects on these results is discussed. Recent results for the polarized structure functions are discussed

  10. A study on soil structure

    NARCIS (Netherlands)

    Schuylenborgh, van J.

    1947-01-01

    As soils differ in capacity to form a structure, it is necessary to distinguish between intrinsic structure and actual structure. Intrinsic structure is the capacity of a soil to form a certain structure. Actual structure is the structure of the soil at a certain moment.

    Using experiments and

  11. Nuclear structure theory

    CERN Document Server

    Irvine, J M

    1972-01-01

    Nuclear Structure Theory provides a guide to nuclear structure theory. The book is comprised of 23 chapters that are organized into four parts; each part covers an aspect of nuclear structure theory. In the first part, the text discusses the experimentally observed phenomena, which nuclear structure theories need to look into and detail the information that supports those theories. The second part of the book deals with the phenomenological nucleon-nucleon potentials derived from phase shift analysis of nucleon-nucleon scattering. Part III talks about the phenomenological parameters used to de

  12. Component nuclear containment structure

    International Nuclear Information System (INIS)

    Harstead, G.A.

    1979-01-01

    The invention described is intended for use primarily as a nuclear containment structure. Such structures are required to surround the nuclear steam supply system and to contain the effects of breaks in the nuclear steam supply system, or i.e. loss of coolant accidents. Nuclear containment structures are required to withstand internal pressure and temperatures which result from loss of coolant accidents, and to provide for radiation shielding during operation and during the loss of coolant accident, as well as to resist all other applied loads, such as earthquakes. The nuclear containment structure described herein is a composite nuclear containment structure, and is one which structurally combines two previous systems; namely, a steel vessel, and a lined concrete structure. The steel vessel provides strength to resist internal pressure and accommodate temperature increases, the lined concrete structure provides resistance to internal pressure by having a liner which will prevent leakage, and which is in contact with the concrete structure which provides the strength to resist the pressure

  13. Linguistic Structure Prediction

    CERN Document Server

    Smith, Noah A

    2011-01-01

    A major part of natural language processing now depends on the use of text data to build linguistic analyzers. We consider statistical, computational approaches to modeling linguistic structure. We seek to unify across many approaches and many kinds of linguistic structures. Assuming a basic understanding of natural language processing and/or machine learning, we seek to bridge the gap between the two fields. Approaches to decoding (i.e., carrying out linguistic structure prediction) and supervised and unsupervised learning of models that predict discrete structures as outputs are the focus. W

  14. Mitotic chromosome structure

    International Nuclear Information System (INIS)

    Heermann, Dieter W.

    2012-01-01

    Mounting evidence is compiling linking the physical organizational structure of chromosomes and the nuclear structure to biological function. At the base of the physical organizational structure of both is the concept of loop formation. This implies that physical proximity within chromosomes is provided for otherwise distal genomic regions and thus hierarchically organizing the chromosomes. Together with entropy many experimental observations can be explained with these two concepts. Among the observations that can be explained are the measured physical extent of the chromosomes, their shape, mechanical behavior, the segregation into territories (chromosomal and territories within chromosomes), the results from chromosome conformation capture experiments, as well as linking gene expression to structural organization.

  15. Structural building response review

    International Nuclear Information System (INIS)

    1980-01-01

    The integrity of a nuclear power plant during a postulated seismic event is required to protect the public against radiation. Therefore, a detailed set of seismic analyses of various structures and equipment is performed while designing a nuclear power plant. This report describes the structural response analysis method, including the structural model, soil-structure interaction as it relates to structural models, methods for seismic structural analysis, numerical integration methods, methods for non-seismic response analysis approaches for various response combinations, structural damping values, nonlinear response, uncertainties in structural properties, and structural response analysis using random properties. The report describes the state-of-the-art in these areas for nuclear power plants. It also details the past studies made at Sargent and Lundy to evaluate different alternatives and the conclusions reached for the specific purposes that those studies were intended. These results were incorporated here because they fall into the general scope of this report. The scope of the present task does not include performing new calculations

  16. Structure of hadrons. Proceedings

    International Nuclear Information System (INIS)

    Feldmeier, H.; Knoll, J.; Noerenberg, W.; Wambach, J.

    2001-01-01

    The following topics were dealt with: Hadronic reactions and resonances, structure of mesons, baryons, glueballs, and hybrids, physics with strange and charmed quarks, future projects and facilities. (HSI)

  17. Structure guided GANs

    Science.gov (United States)

    Cao, Feidao; Zhao, Huaici; Liu, Pengfei

    2017-11-01

    Generative adversarial networks (GANs) has achieved success in many fields. However, there are some samples generated by many GAN-based works, whose structure is ambiguous. In this work, we propose Structure Guided GANs that introduce structural similar into GANs to overcome the problem. In order to achieve our goal, we introduce an encoder and a decoder into a generator to design a new generator and take real samples as part of the input of a generator. And we modify the loss function of the generator accordingly. By comparison with WGAN, experimental results show that our proposed method overcomes largely sample structure ambiguous and can generate higher quality samples.

  18. Probabilistic conditional independence structures

    CERN Document Server

    Studeny, Milan

    2005-01-01

    Probabilistic Conditional Independence Structures provides the mathematical description of probabilistic conditional independence structures; the author uses non-graphical methods of their description, and takes an algebraic approach.The monograph presents the methods of structural imsets and supermodular functions, and deals with independence implication and equivalence of structural imsets.Motivation, mathematical foundations and areas of application are included, and a rough overview of graphical methods is also given.In particular, the author has been careful to use suitable terminology, and presents the work so that it will be understood by both statisticians, and by researchers in artificial intelligence.The necessary elementary mathematical notions are recalled in an appendix.

  19. Laboratory for Structural Acoustics

    Data.gov (United States)

    Federal Laboratory Consortium — FUNCTION: Supports experimental research where acoustic radiation, scattering, and surface vibration measurements of fluid-loaded and non-fluid-loaded structures are...

  20. Unpolarized Structure Functions

    International Nuclear Information System (INIS)

    Christy, M.E.; Melnitchouk, W.

    2011-01-01

    Over the past decade measurements of unpolarized structure functions with unprecedented precision have significantly advanced our knowledge of nucleon structure. These have for the first time allowed quantitative tests of the phenomenon of quark-hadron duality, and provided a deeper understanding of the transition from hadron to quark degrees of freedom in inclusive scattering. Dedicated Rosenbluth-separation experiments have yielded high-precision transverse and longitudinal structure functions in regions previously unexplored, and new techniques have enabled the first glimpses of the structure of the free neutron, without contamination from nuclear effects.

  1. Structure and stoichiometry

    International Nuclear Information System (INIS)

    Gai, P.L.

    1992-01-01

    Structural and stoichiometric variations and their role in superconducting properties of bulk cuprate ceramics are elucidated. Atomic structure and chemistry of defect microstructures, including vacancy and interstitial defects, weak-link problems, structural modulations and coherent intergrowths leading to new structures are studies and quantitatively interpreted. They are shown to play a critical role in controlling hole concentration, critical currents and flux pinning. These phenomena underpin the solid state chemistry which determines the physical properties of the nonstoichiometric oxide superconductors. In this paper technological implications, synthesis of related novel materials and recent developments are discussed

  2. Structural Materials: 95. Concrete

    International Nuclear Information System (INIS)

    Naus, Dan J.

    2012-01-01

    Nuclear power plant concrete structures and their materials of construction are described, and their operating experience noted. Aging and environmental factors that can affect the durability of the concrete structures are identified. Basic components of a program to manage aging of these structures are identified and described. Application of structural reliability theory to devise uniform risk-based criteria by which existing facilities can be evaluated to achieve a desired performance level when subjected to uncertain demands and to quantify the effects of degradation is outlined. Finally, several areas are identified where additional research is desired.

  3. Valency and molecular structure

    CERN Document Server

    Cartmell, E

    1977-01-01

    Valency and Molecular Structure, Fourth Edition provides a comprehensive historical background and experimental foundations of theories and methods relating to valency and molecular structures. In this edition, the chapter on Bohr theory has been removed while some sections, such as structures of crystalline solids, have been expanded. Details of structures have also been revised and extended using the best available values for bond lengths and bond angles. Recent developments are mostly noted in the chapter on complex compounds, while a new chapter has been added to serve as an introduction t

  4. Structural Dynamics Laboratory (SDL)

    Data.gov (United States)

    Federal Laboratory Consortium — Structural dynamic testing is performed to verify the survivability of a component or assembly when exposed to vibration stress screening, or a controlled simulation...

  5. Machine tool structures

    CERN Document Server

    Koenigsberger, F

    1970-01-01

    Machine Tool Structures, Volume 1 deals with fundamental theories and calculation methods for machine tool structures. Experimental investigations into stiffness are discussed, along with the application of the results to the design of machine tool structures. Topics covered range from static and dynamic stiffness to chatter in metal cutting, stability in machine tools, and deformations of machine tool structures. This volume is divided into three sections and opens with a discussion on stiffness specifications and the effect of stiffness on the behavior of the machine under forced vibration c

  6. Mitotic chromosome structure

    Energy Technology Data Exchange (ETDEWEB)

    Heermann, Dieter W., E-mail: heermann@tphys.uni-heidelberg.de

    2012-07-15

    Mounting evidence is compiling linking the physical organizational structure of chromosomes and the nuclear structure to biological function. At the base of the physical organizational structure of both is the concept of loop formation. This implies that physical proximity within chromosomes is provided for otherwise distal genomic regions and thus hierarchically organizing the chromosomes. Together with entropy many experimental observations can be explained with these two concepts. Among the observations that can be explained are the measured physical extent of the chromosomes, their shape, mechanical behavior, the segregation into territories (chromosomal and territories within chromosomes), the results from chromosome conformation capture experiments, as well as linking gene expression to structural organization.

  7. Structures and infrastructures series

    National Research Council Canada - National Science Library

    2008-01-01

    "Research, developments, and applications...on the most advanced techonologies for analyzing, predicting, and optimizing the performance of structures and infrastructures such as buildings, bridges, dams...

  8. Radiation shielding structure for concrete structure

    International Nuclear Information System (INIS)

    Oya, Hiroshi

    1998-01-01

    Crack inducing members for inducing cracks in a predetermined manner are buried in a concrete structure. Namely, a crack-inducing member comprises integrally a shielding plate and extended plates situated at the center of a wall and inducing plates vertically disposed to the boundary portion between them with the inducing plates being disposed each in a direction perforating the wall. There are disposed integrally a pair of the inducing plate spaced at a predetermined horizontal distance on both sides of the shielding plate so as to form a substantially crank-shaped cross section and extended plates formed in the extending direction of the shielding plate, and the inducing plates are disposed each in a direction perforating the wall. Then, cracks generated when stresses are exerted can be controlled, and generation of cracks passing through the concrete structure can be prevented reliably. The reliability of a radiation shielding effect can be enhanced remarkably. (N.H.)

  9. Structural analysis of NPP components and structures

    International Nuclear Information System (INIS)

    Saarenheimo, A.; Keinaenen, H.; Talja, H.

    1998-01-01

    Capabilities for effective structural integrity assessment have been created and extended in several important cases. In the paper presented applications deal with pressurised thermal shock loading, PTS, and severe dynamic loading cases of containment, reinforced concrete structures and piping components. Hydrogen combustion within the containment is considered in some severe accident scenarios. Can a steel containment withstand the postulated hydrogen detonation loads and still maintain its integrity? This is the topic of Chapter 2. The following Chapter 3 deals with a reinforced concrete floor subjected to jet impingement caused by a postulated rupture of a near-by high-energy pipe and Chapter 4 deals with dynamic loading resistance of the pipe lines under postulated pressure transients due to water hammer. The reliability of the structural integrity analysing methods and capabilities which have been developed for application in NPP component assessment, shall be evaluated and verified. The resources available within the RATU2 programme alone cannot allow performing of the large scale experiments needed for that purpose. Thus, the verification of the PTS analysis capabilities has been conducted by participation in international co-operative programmes. Participation to the European Network for Evaluating Steel Components (NESC) is the topic of a parallel paper in this symposium. The results obtained in two other international programmes are summarised in Chapters 5 and 6 of this paper, where PTS tests with a model vessel and benchmark assessment of a RPV nozzle integrity are described. (author)

  10. Wave scour around structures

    DEFF Research Database (Denmark)

    Sumer, B. Mutlu; Fredsøe, Jørgen

    1999-01-01

    This review (of scour around marine structures) is organized in seven main sections: Basic concepts; Tunnel erosion; Two- and three-dimensional scour around pipelines; Scour around piles (slender bodies), including pile groups; Scour around complex structures; Scour around large, vertical cylinders...

  11. Structural Precast Concrete Handbook

    DEFF Research Database (Denmark)

    Kjærbye, Per Oluf H

    Structural concept for precast concrete systems. Design og precast reinforced concrete components. Design of precast concrete connections. Illustrations on design of precast concrete buildings. Precast concrete assembly.......Structural concept for precast concrete systems. Design og precast reinforced concrete components. Design of precast concrete connections. Illustrations on design of precast concrete buildings. Precast concrete assembly....

  12. Structural Dynamics, Vol. 9

    DEFF Research Database (Denmark)

    Nielsen, Søren R.K.

    This book has been prepared for the course on Computational Dynamics given at the 8th semester at the structural program in civil engineering at Aalborg University.......This book has been prepared for the course on Computational Dynamics given at the 8th semester at the structural program in civil engineering at Aalborg University....

  13. Understanding the structure

    Science.gov (United States)

    David J. Nowak

    1994-01-01

    Urban forests are complex ecosystems created by the interaction of anthropogenic and natural processes. One key to better management of these systems is to understand urban forest structure and its relationship to forest functions. Through sampling and inventories, urban foresters often obtain structural information (e.g., numbers, location, size, and condition) on...

  14. Glued structural members

    Science.gov (United States)

    Russell C. Moody; Jen Y. Liu

    1999-01-01

    Glued structural members are manufactured in a variety of configurations. Structural composite lumber (SCL) products consist of small pieces of wood glued together into sizes common for solid-sawn lumber. Glued-laminated timber (glulam) is an engineered stress-rated product that consists of two or more layers of lumber in which the grain of all layers is oriented...

  15. Subduing the structural shakes

    International Nuclear Information System (INIS)

    Sharma, S.S.; Mercurio, E.L.; Goldenberg, E.

    1989-01-01

    The evolution of seismic design practices is related to the occurrence of major earthquakes. The amount of damage sustained by power equipment and structures during these earthquakes pointed out a necessity for the power industry to consider the dynamic behavior of equipment and structures and to reassess seismic design practices. Conventional designs typically use codes whose main intent is life safety, and whose failure criteria is structural collapse. These methods allow the entire ground motion to be transmitted to the superstructure; absorbing the seismic energy through inelastic behavior which invariably gives rise to damage, both structural and non-structural. From the standpoint of the structure's essential function, conventional designs may reduce injury to people, but the corresponding damage to the building's equipment and other non-structural components may be catastrophic. The ideal solution for this seismic design problem is to provide a system which absorbs or mitigates the seismic forces before they enter into the structural system. According to the authors, base isolation offers such an alternative

  16. Fire exposed aluminium structures

    NARCIS (Netherlands)

    Maljaars, J.; Fellinger, J.E.J.; Soetens, F.

    2005-01-01

    Material properties and mechanical response models for fire design of steel structures are based on extensive research and experience. Contrarily, the behaviour of aluminium load bearing structures exposed to fire is relatively unexplored. This article gives an overview of physical and mechanical

  17. Buckling of Ship Structures

    CERN Document Server

    Shama, Mohamed

    2013-01-01

    Buckling of Ship Structures presents a comprehensive analysis of the buckling problem of ship structural members. A full analysis of the various types of loadings and stresses imposed on ship plating and primary and secondary structural members is given. The main causes and consequences of the buckling mode of failure of ship structure and the methods commonly used to control buckling failure are clarified. This book contains the main equations required to determine the critical buckling stresses for both ship plating and the primary and secondary stiffening structural members. The critical buckling stresses are given for ship plating subjected to the induced various types of loadings and having the most common boundary conditions encountered in ship structures.  The text bridges the gap existing in most books covering the subject of buckling of ship structures in the classical analytical format, by putting the emphasis on the practical methods required to ensure safety against buckling of ship structur...

  18. Describing migration spatial structure

    NARCIS (Netherlands)

    Rogers, A; Willekens, F; Little, J; Raymer, J

    The age structure of a population is a fundamental concept in demography and is generally depicted in the form of an age pyramid. The spatial structure of an interregional system of origin-destination-specific migration streams is, however, a notion lacking a widely accepted definition. We offer a

  19. Structural and Material Instability

    DEFF Research Database (Denmark)

    Cifuentes, Gustavo Cifuentes

    This work is a small contribution to the general problem of structural and material instability. In this work, the main subject is the analysis of cracking and failure of structural elements made from quasi-brittle materials like concrete. The analysis is made using the finite element method. Three...

  20. Freedom, structure, and creativity

    NARCIS (Netherlands)

    Rietzschel, Eric; Reiter-Palmon, Roni; Kaufman, James

    2018-01-01

    Creativity is commonly thought to depend on freedom and a lack of constraints. While this is true to a large extent, it neglects the creative potential of structure and constraints. In this chapter, I will address the relation between freedom, structure, and creativity. I will explain that freedom,

  1. Metallic glasses: structural models

    International Nuclear Information System (INIS)

    Nassif, E.

    1984-01-01

    The aim of this work is to give a summary of the attempts made up to the present in order to discribe by structural models the atomic arrangement in metallic glasses, showing also why the structure factors and atomic distribution functions cannot be always experimentally determined with a reasonable accuracy. (M.W.O.) [pt

  2. Hierarchical Porous Structures

    Energy Technology Data Exchange (ETDEWEB)

    Grote, Christopher John [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-07

    Materials Design is often at the forefront of technological innovation. While there has always been a push to generate increasingly low density materials, such as aero or hydrogels, more recently the idea of bicontinuous structures has gone more into play. This review will cover some of the methods and applications for generating both porous, and hierarchically porous structures.

  3. Sustainable economic structures

    NARCIS (Netherlands)

    Dellink, R.B.; Bennis, M.; Verbruggen, H.

    1999-01-01

    The paper introduces four scenarios for sustainable economic structures in the Netherlands for 2030. The aim of this paper is to provide possible answers to what a sustainable future might look like in terms of alternative economic structures. To this end, an empirical economy-ecology model is

  4. Languages for structural calculations

    International Nuclear Information System (INIS)

    Thomas, J.B.; Chambon, M.R.

    1988-01-01

    The differences between human and computing languages are recalled. It is argued that they are to some extent structured in antagonistic ways. Languages in structural calculation, in the past, present, and future, are considered. The contribution of artificial intelligence is stressed [fr

  5. Trajectory structures and transport

    International Nuclear Information System (INIS)

    Vlad, Madalina; Spineanu, Florin

    2004-01-01

    The special problem of transport in two-dimensional divergence-free stochastic velocity fields is studied by developing a statistical approach, the nested subensemble method. The nonlinear process of trapping determined by such fields generates trajectory structures whose statistical characteristics are determined. These structures strongly influence the transport

  6. Dynamic term structure models

    DEFF Research Database (Denmark)

    Andreasen, Martin Møller; Meldrum, Andrew

    This paper studies whether dynamic term structure models for US nominal bond yields should enforce the zero lower bound by a quadratic policy rate or a shadow rate specification. We address the question by estimating quadratic term structure models (QTSMs) and shadow rate models with at most four...

  7. Land, structure and depreciation

    NARCIS (Netherlands)

    Francke, M.K.; van de Minne, A.M.

    2017-01-01

    We introduce a hedonic price model that enables us to disentangle the value of a property into the value of land and the value of structure. For given reconstruction costs, we are able to estimate the impact of physical deterioration, functional obsolescence and vintage effects on the structure and

  8. Structure of simple liquids

    International Nuclear Information System (INIS)

    Blain, J.F.

    1969-01-01

    The results obtained by application to argon and sodium of the two important methods of studying the structure of liquids: scattering of X-rays and neutrons, are presented on one hand. On the other hand the principal models employed for reconstituting the structure of simple liquids are exposed: mathematical models, lattice models and their derived models, experimental models. (author) [fr

  9. Tapered structure construction

    Science.gov (United States)

    Smith, Eric D.; Takata, Rosalind K.; Slocum, Alexander H.; Nayfeh, Samir A.

    2016-04-05

    Feeding stock used to form a tapered structure into a curving device such that each point on the stock undergoes rotational motion about a peak location of the tapered structure; and the stock meets a predecessor portion of stock along one or more adjacent edges.

  10. Organisational Structure & Change

    Science.gov (United States)

    National Centre for Vocational Education Research (NCVER), 2006

    2006-01-01

    Structural change is seen as a way to meet the challenges of the future that face many organisations. While some writers agree that broad-ranging structural change may not always transform an organisation or enhance its performance, others claim that innovation will be a major source of competitive advantage to organisations, particularly when…

  11. The Structure of Reciprocity

    Science.gov (United States)

    Molm, Linda D.

    2010-01-01

    Reciprocity is one of the defining features of social exchange and social life, yet exchange theorists have tended to take it for granted. Drawing on work from a decade-long theoretical research program, I argue that reciprocity is structured and variable across different forms of exchange, that these variations in the structure of reciprocity…

  12. Kernel structures for Clouds

    Science.gov (United States)

    Spafford, Eugene H.; Mckendry, Martin S.

    1986-01-01

    An overview of the internal structure of the Clouds kernel was presented. An indication of how these structures will interact in the prototype Clouds implementation is given. Many specific details have yet to be determined and await experimentation with an actual working system.

  13. Homogeneous Poisson structures

    International Nuclear Information System (INIS)

    Shafei Deh Abad, A.; Malek, F.

    1993-09-01

    We provide an algebraic definition for Schouten product and give a decomposition for any homogenenous Poisson structure in any n-dimensional vector space. A large class of n-homogeneous Poisson structures in R k is also characterized. (author). 4 refs

  14. Wind Loads on Structures

    DEFF Research Database (Denmark)

    Dyrbye, Claes; Hansen, Svend Ole

    Wind loads have to be taken into account when designing civil engineering structures. The wind load on structures can be systematised by means of the wind load chain: wind climate (global), terrain (wind at low height), aerodynamic response (wind load to pressure), mechanical response (wind...... pressure to structural response) and design criteria. Starting with an introduction of the wind load chain, the book moves on to meteorological considerations, atmospheric boundary layer, static wind load, dynamic wind load and scaling laws used in wind-tunnel tests. The dynamic wind load covers vibrations...... induced by wind turbulence, vortex shedding, flutter and galloping. The book gives a comprehensive treatment of wind effects on structures and it will be useful for consulting engineers designing wind-sensitive structures. It will also be valuable for students of civil engineering as textbook...

  15. Structure correlation and chemistry

    International Nuclear Information System (INIS)

    Buergi, H.B.

    1998-01-01

    The main goal of crystal and molecular structure determination is to provide a starting point for understanding the physical, chemical and biological properties of matter. At present, results from nearly 300000 crystal structure studies are available in computer-readable form. Structure correlation attempts to extract knowledge and understanding from this body of information, which is not available from its parts. This article reviews some typical examples: libraries of prototypal molecular dimensions, mappings of chemical reaction pathways, correlations between structure on one hand and energy, reaction rate, catalytic activity or magnetism on the other. The knowledge gained from structure-correlation studies, together with quantum-chemical and other modeling techniques, provides conceptual and practical tools for designing molecules and materials with tailor-made properties. (orig.)

  16. Optoelectronic Mounting Structure

    Science.gov (United States)

    Anderson, Gene R.; Armendariz, Marcelino G.; Baca, Johnny R. F.; Bryan, Robert P.; Carson, Richard F.; Chu, Dahwey; Duckett, III, Edwin B.; McCormick, Frederick B.; Peterson, David W.; Peterson, Gary D.; Reber, Cathleen A.; Reysen, Bill H.

    2004-10-05

    An optoelectronic mounting structure is provided that may be used in conjunction with an optical transmitter, receiver or transceiver module. The mounting structure may be a flexible printed circuit board. Thermal vias or heat pipes in the head region may transmit heat from the mounting structure to the heat spreader. The heat spreader may provide mechanical rigidity or stiffness to the heat region. In another embodiment, an electrical contact and ground plane may pass along a surface of the head region so as to provide an electrical contact path to the optoelectronic devices and limit electromagnetic interference. In yet another embodiment, a window may be formed in the head region of the mounting structure so as to provide access to the heat spreader. Optoelectronic devices may be adapted to the heat spreader in such a manner that the devices are accessible through the window in the mounting structure.

  17. Nonlinear dynamics of structures

    CERN Document Server

    Oller, Sergio

    2014-01-01

    This book lays the foundation of knowledge that will allow a better understanding of nonlinear phenomena that occur in structural dynamics.   This work is intended for graduate engineering students who want to expand their knowledge on the dynamic behavior of structures, specifically in the nonlinear field, by presenting the basis of dynamic balance in non‐linear behavior structures due to the material and kinematics mechanical effects.   Particularly, this publication shows the solution of the equation of dynamic equilibrium for structure with nonlinear time‐independent materials (plasticity, damage and frequencies evolution), as well as those time dependent non‐linear behavior materials (viscoelasticity and viscoplasticity). The convergence conditions for the non‐linear dynamic structure solution  are studied, and the theoretical concepts and its programming algorithms are presented.  

  18. Coulomb double helical structure

    Science.gov (United States)

    Kamimura, Tetsuo; Ishihara, Osamu

    2012-01-01

    Structures of Coulomb clusters formed by dust particles in a plasma are studied by numerical simulation. Our study reveals the presence of various types of self-organized structures of a cluster confined in a prolate spheroidal electrostatic potential. The stable configurations depend on a prolateness parameter for the confining potential as well as on the number of dust particles in a cluster. One-dimensional string, two-dimensional zigzag structure and three-dimensional double helical structure are found as a result of the transition controlled by the prolateness parameter. The formation of stable double helical structures resulted from the transition associated with the instability of angular perturbations on double strings. Analytical perturbation study supports the findings of numerical simulations.

  19. Robustness of structures

    DEFF Research Database (Denmark)

    Vrouwenvelder, T.; Sørensen, John Dalsgaard

    2009-01-01

    After the collapse of the World Trade Centre towers in 2001 and a number of collapses of structural systems in the beginning of the century, robustness of structural systems has gained renewed interest. Despite many significant theoretical, methodical and technological advances, structural...... of robustness for structural design such requirements are not substantiated in more detail, nor have the engineering profession been able to agree on an interpretation of robustness which facilitates for its uantification. A European COST action TU 601 on ‘Robustness of structures' has started in 2007...... by a group of members of the CSS. This paper describes the ongoing work in this action, with emphasis on the development of a theoretical and risk based quantification and optimization procedure on the one side and a practical pre-normative guideline on the other....

  20. Structure of Warm Nuclei

    International Nuclear Information System (INIS)

    Aaberg, S.; Uhrenholt, H.

    2009-01-01

    We study the structure of nuclei in the energy region between the ground state and the neutron separation energy, here called warm nuclei. The onset of chaos in the nucleus as excitation energy is increased is briefly reviewed. Chaos implies fluctuations of energies and wave functions qualitatively the same for all chaotic nuclei. On the other hand, large structure effects are seen, e.g. in the level-density function at same excitation energies. A microscopic model for the level density is reviewed and we discuss effects on structure of the total level-density function, parity enhancement, and the spin distribution function. Comparisons to data are performed at the neutron separation energy for all observed nuclei, and structure of the level-density function for a few measured cases. The role of structure effects in the level-density function for fission dynamics is exemplified.

  1. Ligands in PSI structures

    International Nuclear Information System (INIS)

    Kumar, Abhinav; Chiu, Hsiu-Ju; Axelrod, Herbert L.; Morse, Andrew; Elsliger, Marc-André; Wilson, Ian A.; Deacon, Ashley

    2010-01-01

    A survey of the types and frequency of ligands that are bound to PSI structures is analyzed as well as their utility in functional annotation of previously uncharacterized proteins. Approximately 65% of PSI structures report some type of ligand(s) that is bound in the crystal structure. Here, a description is given of how such ligands are handled and analyzed at the JCSG and a survey of the types, variety and frequency of ligands that are observed in the PSI structures is also compiled and analyzed, including illustrations of how these bound ligands have provided functional clues for annotation of proteins with little or no previous experimental characterization. Furthermore, a web server was developed as a tool to mine and analyze the PSI structures for bound ligands and other identifying features

  2. Urban structures and substructures

    Directory of Open Access Journals (Sweden)

    Mierzejewska Lidia

    2017-06-01

    Full Text Available In urban geography, a traditional but always important research problem has been the spatial-functional structure of towns and changes that occur in this field. Two approaches can be distinguished here: the sociological and the geographical. The former follows in the steps of the so-called Chicago school, i.e. Park, Burgess and Hoyt, and the other of Ullman and Harris. It seems, however, that those two approaches do not exhaust the range of spatial-structural studies which may be conducted in modern towns since there are areas within them endowed with specific properties that can be called their substructures. This paper will present the general characteristics of such substructures and identify factors responsible for their appearance and development. It will also propose an empirical research pattern. The term ‘substructures’ is taken to denote relatively autonomous, highly uniform wholes standing out in the spatial-functional structure of a town, distinguished on the basis of spatial relations generated by people. While structural elements of towns in the approach of the Chicago school or that of Harris and Ullman can be identified with structural regions, urban substructures show a similarity to functional regions in their organisation, structure and operation. Thus, towns with identified substructures have a polycentric spatial- functional structure, favourable in terms of both the level of service of their inhabitants and their sustainable development.

  3. Structural dynamics in FBR

    International Nuclear Information System (INIS)

    Bhoje, S.B.

    2003-01-01

    In view of thin walled large diameter shell structures with associated fluid effects, structural dynamics problems are very critical in a fast breeder reactor. Structural characteristics and consequent structural dynamics problems in typical pool type Fast Breeder Reactor are highlighted. A few important structural dynamics problems are pump induced as well as flow induced vibrations, seismic excitations, pressure transients in the intermediate heat exchangers and pipings due to a large sodium water reaction in the steam generator, and core disruptive accident loadings. The vibration problems which call for identification of excitation forces, formulation of special governing equations and detailed analysis with fluid structure interaction and sloshing effects, particularly for the components such as PSP, inner vessel, CP, CSRDM and TB are elaborated. Seismic design issues are presented in a comprehensive way. Other transient loadings which are specific to FBR, resulting from sodium-water reaction and core disruptive accident are highlighted. A few important results of theoretical as well as experimental works carried out for 500 MWe Prototype Fast Breeder Reactor (PFBR), in the domain of structural dynamics are presented. (author)

  4. Cell packing structures

    KAUST Repository

    Pottmann, Helmut

    2015-03-03

    This paper is an overview of architectural structures which are either composed of polyhedral cells or closely related to them. We introduce the concept of a support structure of such a polyhedral cell packing. It is formed by planar quads and obtained by connecting corresponding vertices in two combinatorially equivalent meshes whose corresponding edges are coplanar and thus determine planar quads. Since corresponding triangle meshes only yield trivial structures, we focus on support structures associated with quad meshes or hex-dominant meshes. For the quadrilateral case, we provide a short survey of recent research which reveals beautiful relations to discrete differential geometry. Those are essential for successfully initializing numerical optimization schemes for the computation of quad-based support structures. Hex-dominant structures may be designed via Voronoi tessellations, power diagrams, sphere packings and various extensions of these concepts. Apart from the obvious application as load-bearing structures, we illustrate here a new application to shading and indirect lighting. On a higher level, our work emphasizes the interplay between geometry, optimization, statics, and manufacturing, with the overall aim of combining form, function and fabrication into novel integrated design tools.

  5. Fundamentals of Structural Geology

    Science.gov (United States)

    Pollard, David D.; Fletcher, Raymond C.

    2005-09-01

    Fundamentals of Structural Geology provides a new framework for the investigation of geological structures by integrating field mapping and mechanical analysis. Assuming a basic knowledge of physical geology, introductory calculus and physics, it emphasizes the observational data, modern mapping technology, principles of continuum mechanics, and the mathematical and computational skills, necessary to quantitatively map, describe, model, and explain deformation in Earth's lithosphere. By starting from the fundamental conservation laws of mass and momentum, the constitutive laws of material behavior, and the kinematic relationships for strain and rate of deformation, the authors demonstrate the relevance of solid and fluid mechanics to structural geology. This book offers a modern quantitative approach to structural geology for advanced students and researchers in structural geology and tectonics. It is supported by a website hosting images from the book, additional colour images, student exercises and MATLAB scripts. Solutions to the exercises are available to instructors. The book integrates field mapping using modern technology with the analysis of structures based on a complete mechanics MATLAB is used to visualize physical fields and analytical results and MATLAB scripts can be downloaded from the website to recreate textbook graphics and enable students to explore their choice of parameters and boundary conditions The supplementary website hosts color images of outcrop photographs used in the text, supplementary color images, and images of textbook figures for classroom presentations The textbook website also includes student exercises designed to instill the fundamental relationships, and to encourage the visualization of the evolution of geological structures; solutions are available to instructors

  6. Selective structural source identification

    Science.gov (United States)

    Totaro, Nicolas

    2018-04-01

    In the field of acoustic source reconstruction, the inverse Patch Transfer Function (iPTF) has been recently proposed and has shown satisfactory results whatever the shape of the vibrating surface and whatever the acoustic environment. These two interesting features are due to the virtual acoustic volume concept underlying the iPTF methods. The aim of the present article is to show how this concept of virtual subsystem can be used in structures to reconstruct the applied force distribution. Some virtual boundary conditions can be applied on a part of the structure, called virtual testing structure, to identify the force distribution applied in that zone regardless of the presence of other sources outside the zone under consideration. In the present article, the applicability of the method is only demonstrated on planar structures. However, the final example show how the method can be applied to a complex shape planar structure with point welded stiffeners even in the tested zone. In that case, if the virtual testing structure includes the stiffeners the identified force distribution only exhibits the positions of external applied forces. If the virtual testing structure does not include the stiffeners, the identified force distribution permits to localize the forces due to the coupling between the structure and the stiffeners through the welded points as well as the ones due to the external forces. This is why this approach is considered here as a selective structural source identification method. It is demonstrated that this approach clearly falls in the same framework as the Force Analysis Technique, the Virtual Fields Method or the 2D spatial Fourier transform. Even if this approach has a lot in common with these latters, it has some interesting particularities like its low sensitivity to measurement noise.

  7. Glucosinolate structures in evolution.

    Science.gov (United States)

    Agerbirk, Niels; Olsen, Carl Erik

    2012-05-01

    By 2000, around 106 natural glucosinolates (GSLs) were probably documented. In the past decade, 26 additional natural GSL structures have been elucidated and documented. Hence, the total number of documented GSLs from nature by 2011 can be estimated to around 132. A considerable number of additional suggested structures are concluded not to be sufficiently documented. In many cases, NMR spectroscopy would have provided the missing structural information. Of the GSLs documented in the past decade, several are of previously unexpected structures and occur at considerable levels. Most originate from just four species: Barbarea vulgaris, Arabidopsis thaliana, Eruca sativa and Isatis tinctoria. Acyl derivatives of known GSLs comprised 15 of the 26 newly documented structures, while the remaining exhibited new substitution patterns or chain length, or contained a mercapto group or related thio-functionality. GSL identification methods are reviewed, and the importance of using authentic references and structure-sensitive detection methods such as MS and NMR is stressed, especially when species with relatively unknown chemistry are analyzed. An example of qualitative GSL analysis is presented with experimental details (group separation and HPLC of both intact and desulfated GSLs, detection and structure determination by UV, MS, NMR and susceptibility to myrosinase) with emphasis on the use of NMR for structure elucidation of even minor GSLs and GSL hydrolysis products. The example includes identification of a novel GSL, (R)-2-hydroxy-2-(3-hydroxyphenyl)ethylglucosinolate. Recent investigations of GSL evolution, based on investigations of species with well established phylogeny, are reviewed. From the relatively few such investigations, it is already clear that GSL profiles are regularly subject to evolution. This result is compatible with natural selection for specific GSL side chains. The probable existence of structure-specific GSL catabolism in intact plants suggests

  8. Structure-mediated nanoscopy

    DEFF Research Database (Denmark)

    Glückstad, Jesper; Bañas, Andrew Rafael; Aabo, Thomas

    2013-01-01

    of optimal light-sculpting techniques [4] with the use of optimized shapes in micro-robotics structures [5]. Micro-fabrication processes such as two-photon photo-polymerization offer three-dimensional resolutions for creating custom-designed monolithic microstructures that can be equipped with optical...... that are utilized in conventional optical trapping and manipulation. We took this approach to extend the opto-mechanical light-force driven capabilities by including functionalised mechanisms to the fabricated monolithic structures. Aided by collaborators who fabricated test structures with built-in waveguides...

  9. Integrated Structural Design Education

    DEFF Research Database (Denmark)

    Bjerregaard Jensen, Lotte; Almegaard, Henrik

    2011-01-01

    to EU legislation. And a successful engineering student must be prepared to work in the open-ended, multidisciplinary environment necessary to produce structures which comply with EIA demands. This paper describes an innovative course developed at the Technical University of Denmark which integrates...... landscaping and structural design. The integrated courses create a setting for learning about the design of large-scale structures and involve geometry, statics, computer simulation, graphical design and landscape architecture. Together, they educate engineers who can take part in the early design phases...... of a project, function well in design teams, and comply with EU EIA demands....

  10. Kernels for structured data

    CERN Document Server

    Gärtner, Thomas

    2009-01-01

    This book provides a unique treatment of an important area of machine learning and answers the question of how kernel methods can be applied to structured data. Kernel methods are a class of state-of-the-art learning algorithms that exhibit excellent learning results in several application domains. Originally, kernel methods were developed with data in mind that can easily be embedded in a Euclidean vector space. Much real-world data does not have this property but is inherently structured. An example of such data, often consulted in the book, is the (2D) graph structure of molecules formed by

  11. Product Structuring, an overview

    DEFF Research Database (Denmark)

    Tichem, Marcel; Storm, Ton; Andreasen, Mogens Myrup

    1997-01-01

    .In the paper, the field of product structuring is defined and broken down into topics. For each of the topics, results of research are presented. Issues for further research are identified. The references in the paper refer to papers in the proceedings of the workshops.......This paper presents the highlights of two WDK Workshops on Product Structuring. Product structuring plays an important role in creating products which have good functional and life-cycle related properties, in design process management, and in several other company functions like production control...

  12. Structural Reliability Methods

    DEFF Research Database (Denmark)

    Ditlevsen, Ove Dalager; Madsen, H. O.

    The structural reliability methods quantitatively treat the uncertainty of predicting the behaviour and properties of a structure given the uncertain properties of its geometry, materials, and the actions it is supposed to withstand. This book addresses the probabilistic methods for evaluation...... of structural reliability, including the theoretical basis for these methods. Partial safety factor codes under current practice are briefly introduced and discussed. A probabilistic code format for obtaining a formal reliability evaluation system that catches the most essential features of the nature...... of the uncertainties and their interplay is the developed, step-by-step. The concepts presented are illustrated by numerous examples throughout the text....

  13. Multiplicative Galois module structure

    CERN Document Server

    Weiss, A

    1996-01-01

    This book is the result of a short course on the Galois structure of S-units that was given at The Fields Institute in the fall of 1993. Offering a new angle on an old problem, the main theme is that this structure should be determined by class field theory, in its cohomological form, and by the behavior of Artin L-functions at s=0. A proof of this-or even a precise formulation-is still far away, but the available evidence all points in this direction. The work brings together the current evidence that the Galois structure of S-units can be described.

  14. Chromatin Structure and Function

    CERN Document Server

    Wolffe, Alan P

    1999-01-01

    The Third Edition of Chromatin: Structure and Function brings the reader up-to-date with the remarkable progress in chromatin research over the past three years. It has been extensively rewritten to cover new material on chromatin remodeling, histone modification, nuclear compartmentalization, DNA methylation, and transcriptional co-activators and co-repressors. The book is written in a clear and concise fashion, with 60 new illustrations. Chromatin: Structure and Function provides the reader with a concise and coherent account of the nature, structure, and assembly of chromatin and its active

  15. Programming language structures

    CERN Document Server

    Organick, Elliott Irving; Plummer, Robert P

    1978-01-01

    Programming Language Structures deals with the structures of programming languages and introduces the reader to five important programming languages: Algol, Fortran, Lisp, Snobol, and Pascal. The fundamental similarities and differences among these languages are discussed. A unifying framework is constructed that can be used to study the structure of other languages, such as Cobol, PL/I, and APL. Several of the tools and methodologies needed to construct large programs are also considered.Comprised of 10 chapters, this book begins with a summary of the relevant concepts and principles about al

  16. Sparse structure regularized ranking

    KAUST Repository

    Wang, Jim Jing-Yan; Sun, Yijun; Gao, Xin

    2014-01-01

    Learning ranking scores is critical for the multimedia database retrieval problem. In this paper, we propose a novel ranking score learning algorithm by exploring the sparse structure and using it to regularize ranking scores. To explore the sparse

  17. QCD and hadron structure

    International Nuclear Information System (INIS)

    Kaplan, D.B.

    1995-01-01

    I give a brief and selective overview of QCD as it pertains to determining hadron structure, and the relevant directions in this field for nuclear theory. This document is intended to start discussion about priorities, not end it

  18. Robustness of Structures

    DEFF Research Database (Denmark)

    Sørensen, John Dalsgaard

    2008-01-01

    This paper describes the background of the robustness requirements implemented in the Danish Code of Practice for Safety of Structures and in the Danish National Annex to the Eurocode 0, see (DS-INF 146, 2003), (DS 409, 2006), (EN 1990 DK NA, 2007) and (Sørensen and Christensen, 2006). More...... frequent use of advanced types of structures with limited redundancy and serious consequences in case of failure combined with increased requirements to efficiency in design and execution followed by increased risk of human errors has made the need of requirements to robustness of new structures essential....... According to Danish design rules robustness shall be documented for all structures in high consequence class. The design procedure to document sufficient robustness consists of: 1) Review of loads and possible failure modes / scenarios and determination of acceptable collapse extent; 2) Review...

  19. Halos and related structures

    DEFF Research Database (Denmark)

    Riisager, Karsten

    2013-01-01

    The halo structure originated from nuclear physics but is now encountered more widely. It appears in loosely bound, clustered systems where the spatial extension of the system is significantly larger than that of the binding potentials. A review is given on our current understanding of these stru......The halo structure originated from nuclear physics but is now encountered more widely. It appears in loosely bound, clustered systems where the spatial extension of the system is significantly larger than that of the binding potentials. A review is given on our current understanding...... of these structures, with an emphasis on how the structures evolve as more cluster components are added and on the experimental situation concerning halo states in light nuclei....

  20. Fundamentals of Structural Engineering

    CERN Document Server

    Connor, Jerome J

    2013-01-01

    Fundamentals of Structural Engineering provides a balanced, seamless treatment of both classic, analytic methods and contemporary, computer-based techniques for conceptualizing and designing a structure. The book’s principle goal is to foster an intuitive understanding of structural behavior based on problem solving experience for students of civil engineering and architecture who have been exposed to the basic concepts of engineering mechanics and mechanics of materials. Making it distinct from many other undergraduate textbooks, the authors of this text recognize the notion that engineers reason about behavior using simple models and intuition they acquire through problem solving. The approach adopted in this text develops this type of intuition  by presenting extensive, realistic problems and case studies together with computer simulation, which allows rapid exploration of  how a structure responds to changes in geometry and physical parameters. This book also: Emphasizes problem-based understanding of...

  1. Submicron superconducting structures

    International Nuclear Information System (INIS)

    Golovashkin, A.I.; Lykov, A.N.

    1986-01-01

    An overview of works concerning superconducting structures of submicron dimensions and a system of such structures is given. It is noted that usage of the above structures in superconducting microelectronics permits, first, to increase the element packing density, to decrease the signal transmission time, capacity, power dissipated in high-frequency applications. Secondly, negligible coherence length in transition metals, their alloys and high-temperature compounds also restrict the dimensions of superconducting weak couplings when the 'classical' Josephson effect is displayed. The most effective methods for production of submicron superconducting structures are the following: lithography, double scribering. Recently the systems of superconducting submicron elements are extensively studied. It is shown that such systems can be phased by magnetic field

  2. Encapsulation with structured triglycerides

    Science.gov (United States)

    Lipids provide excellent materials to encapsulate bioactive compounds for food and pharmaceutical applications. Lipids are renewable, biodegradable, and easily modified to provide additional chemical functionality. The use of structured lipids that have been modified with photoactive properties are ...

  3. Vacuum structure and QCD

    International Nuclear Information System (INIS)

    Gross, D.

    1979-01-01

    An overview of QCD is given, and some of the dynamical issues that arise in attempts to solve this theory are discussed. In particular, attention is focused on the problems that appear in attempts to discuss the structure of low-lying hadrons, e.g. nucleons, on the basis of a color gauge theory of quarks. The picture of hadronic structure developed by Callan, Dashen, and Gross is reviewed; this picture maintains that it presents the qualitative features of hadronic structure emerging in a direct way from first principles. Finally, the relevance of the emerging understanding of the structure of hadrons to the question of what hadronic matter (nuclear or quark matter) might look like at high densities is discussed

  4. Extremely deformable structures

    CERN Document Server

    2015-01-01

    Recently, a new research stimulus has derived from the observation that soft structures, such as biological systems, but also rubber and gel, may work in a post critical regime, where elastic elements are subject to extreme deformations, though still exhibiting excellent mechanical performances. This is the realm of ‘extreme mechanics’, to which this book is addressed. The possibility of exploiting highly deformable structures opens new and unexpected technological possibilities. In particular, the challenge is the design of deformable and bi-stable mechanisms which can reach superior mechanical performances and can have a strong impact on several high-tech applications, including stretchable electronics, nanotube serpentines, deployable structures for aerospace engineering, cable deployment in the ocean, but also sensors and flexible actuators and vibration absorbers. Readers are introduced to a variety of interrelated topics involving the mechanics of extremely deformable structures, with emphasis on ...

  5. Robustness of Structural Systems

    DEFF Research Database (Denmark)

    Canisius, T.D.G.; Sørensen, John Dalsgaard; Baker, J.W.

    2007-01-01

    The importance of robustness as a property of structural systems has been recognised following several structural failures, such as that at Ronan Point in 1968,where the consequenceswere deemed unacceptable relative to the initiating damage. A variety of research efforts in the past decades have...... attempted to quantify aspects of robustness such as redundancy and identify design principles that can improve robustness. This paper outlines the progress of recent work by the Joint Committee on Structural Safety (JCSS) to develop comprehensive guidance on assessing and providing robustness in structural...... systems. Guidance is provided regarding the assessment of robustness in a framework that considers potential hazards to the system, vulnerability of system components, and failure consequences. Several proposed methods for quantifying robustness are reviewed, and guidelines for robust design...

  6. Structure, Reactivity and Dynamics

    Indian Academy of Sciences (India)

    Understanding structure, reactivity and dynamics is the core issue in chemical ... functional theory (DFT) calculations, molecular dynamics (MD) simulations, light- ... between water and protein oxygen atoms, the superionic conductors which ...

  7. OAS :: Our Structure

    Science.gov (United States)

    the Human Resources of the OAS, including its organizational structure, each organizational unit's contract and travel control measure reports, the applicable procurement rules and regulations, and the Related Links OAS Charter Organizational Charts Organizational List Authorities Our Locations Contact Us

  8. Crystalline structure of metals

    International Nuclear Information System (INIS)

    Holas, A.

    1972-01-01

    An attempt is made to find the crystalline structure of metals on the basis of the existing theory of metals. The considerations are limited to the case of free crystals, that is, not subjected to any stresses and with T=0. The energy of the crystal lattice has been defined and the dependence of each term on structures and other properties of metals has been described. The energy has been used to find the values of crystalline structure parameters as the values at which the energy has an absolute minimum. The stability of the structure has been considered in cases of volume changes and shearing deformations. A semiqualitative description has been obtained which explains characteristic properties of one-electron metals. (S.B.)

  9. Dynamics test on structures

    International Nuclear Information System (INIS)

    De Canio, G.; Ranieri, N.

    2009-01-01

    Shake table tests allow to assess the effectiveness of technologies for structures protection from natural events such as earthquakes. The article summarizes the remarkable results of the most significant projects. [it

  10. Introduction to structure functions

    International Nuclear Information System (INIS)

    Kwiecinski, J.

    1996-07-01

    The theory of deep inelastic scattering structure functions is reviewed with an emphasis put on the QCD expectations of their behaviour in the region of small values of Bjorken parameter x. (author). 56 refs

  11. Wimps and stellar structure

    International Nuclear Information System (INIS)

    Bouquet, A.; Salati, P.

    1988-01-01

    We present the results of an analytic approximation to compute the effects of WIMPs on stellar structures in a self-consistent way. We examine in particular the case of the Sun and of horizontal branch stars

  12. STRUCTURE OF ECONOMIC MECHANISM

    Directory of Open Access Journals (Sweden)

    L. I. Podderegina

    2006-01-01

    Full Text Available The paper considers and analyzes scientific approaches of economists to the essence and contents of the economic mechanism. Proposals for methodological formation of economic mechanism structure are substantiated in the paper.

  13. Structural Identification Problem

    Directory of Open Access Journals (Sweden)

    Suvorov Aleksei

    2016-01-01

    Full Text Available The identification problem of the existing structures though the Quasi-Newton and its modification, Trust region algorithms is discussed. For the structural problems, which could be represented by means of the mathematical modelling of the finite element code discussed method is extremely useful. The nonlinear minimization problem of the L2 norm for the structures with linear elastic behaviour is solved by using of the Optimization Toolbox of Matlab. The direct and inverse procedures for the composition of the desired function to minimize are illustrated for the spatial 3D truss structure as well as for the problem of plane finite elements. The truss identification problem is solved with 2 and 3 unknown parameters in order to compare the computational efforts and for the graphical purposes. The particular commands of the Matlab codes are present in this paper.

  14. Modeling Structural Brain Connectivity

    DEFF Research Database (Denmark)

    Ambrosen, Karen Marie Sandø

    The human brain consists of a gigantic complex network of interconnected neurons. Together all these connections determine who we are, how we react and how we interpret the world. Knowledge about how the brain is connected can further our understanding of the brain’s structural organization, help...... improve diagnosis, and potentially allow better treatment of a wide range of neurological disorders. Tractography based on diffusion magnetic resonance imaging is a unique tool to estimate this “structural connectivity” of the brain non-invasively and in vivo. During the last decade, brain connectivity...... has increasingly been analyzed using graph theoretic measures adopted from network science and this characterization of the brain’s structural connectivity has been shown to be useful for the classification of populations, such as healthy and diseased subjects. The structural connectivity of the brain...

  15. Structures and their analysis

    CERN Document Server

    Fuchs, Maurice Bernard

    2016-01-01

    Addressing structures, this book presents a classic discipline in a modern setting by combining illustrated examples with insights into the solutions. It is the fruit of the author’s many years of teaching the subject and of just as many years of research into the design of optimal structures. Although intended for an advanced level of instruction it has an undergraduate course at its core. Further, the book was written with the advantage of having massive computer power in the background, an aspect which changes the entire approach to many engineering disciplines and in particular to structures. This paradigm shift has dislodged the force (flexibility) method from its former prominence and paved the way for the displacement (stiffness) method, despite the multitude of linear equations it spawns. In this book, however, both methods are taught: the force method offers a perfect vehicle for understanding structural behavior, bearing in mind that it is the displacement method which does the heavy number crunch...

  16. Differential geometric structures

    CERN Document Server

    Poor, Walter A

    2007-01-01

    This introductory text defines geometric structure by specifying parallel transport in an appropriate fiber bundle and focusing on simplest cases of linear parallel transport in a vector bundle. 1981 edition.

  17. Product Work Breakdown Structure

    National Research Council Canada - National Science Library

    Okayama, Y; Chirillo, L. D

    1980-01-01

    .... Any such subdivision scheme is a work breakdown structure. Traditional shipbuilders employ work subdivisions by ships functional systems which are natural and appropriate for estimating and for early design stages...

  18. Silicon Carbide Printed Structures

    Data.gov (United States)

    National Aeronautics and Space Administration — The plan is to design a process that will allow precision fabrication of SiC structures using a sterolithographty printer and an oven process to sinter the material...

  19. Sensemaking, structuring and strategy

    DEFF Research Database (Denmark)

    Nielsen, Renate

    With the purpose of generating a new understanding of how organisations develop, an interpretive perspective at continuous processes in organisations will be applied: more specifically at sensemaking, structuring and strategising....

  20. Earth retaining structures manual

    Science.gov (United States)

    2009-10-29

    The objectives of this policy are to obtain statewide uniformity, establish standard : procedures and delineate responsibility for the preparation and review of plans, : design and construction control of earth retaining structures. In addition, it i...

  1. Nanoscale Turing structures

    DEFF Research Database (Denmark)

    Dziekan, Piotr; Hansen, Jesper Schmidt; Nowakowski, Bogdan

    2014-01-01

    Formation of Turing patterns of nanoscopic length scale is simulated using molecular dynamics. Based on Fourier spectra of the concentrations of species, we compare stabilities of the structures of different wavelengths and for different intermolecular potentials. Long range attraction is shown...... to oppose the formation of structures. Our simulations suggest that Turing patterns can be a method of self-organization at a length scale of down to 20 molecular diameters...

  2. Estonian Tax Structure

    Directory of Open Access Journals (Sweden)

    Viktor Trasberg

    2014-08-01

    Full Text Available The paper analyses Estonian tax structure changes during the last decade and critically assesses the current situation. The country’s tax mix is rather unique among EU countries – it has one of the highest proportions of consumption taxes in total taxes and the lowest level of capital and profit taxes. Such an unbalanced tax structure creates risks for public finances, limits revenue collection and distorts the business environment.

  3. Structure function monitor

    Science.gov (United States)

    McGraw, John T [Placitas, NM; Zimmer, Peter C [Albuquerque, NM; Ackermann, Mark R [Albuquerque, NM

    2012-01-24

    Methods and apparatus for a structure function monitor provide for generation of parameters characterizing a refractive medium. In an embodiment, a structure function monitor acquires images of a pupil plane and an image plane and, from these images, retrieves the phase over an aperture, unwraps the retrieved phase, and analyzes the unwrapped retrieved phase. In an embodiment, analysis yields atmospheric parameters measured at spatial scales from zero to the diameter of a telescope used to collect light from a source.

  4. Structural Dynamics, Vol. 3

    DEFF Research Database (Denmark)

    Nielsen, Søren R.K.

    The present textbook has been written for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M.Sc. students in structural engineering.......The present textbook has been written for a course on stochastic vibration theory that is being given on the 9th semester at Aalborg University for M.Sc. students in structural engineering....

  5. Physics of structural colors

    International Nuclear Information System (INIS)

    Kinoshita, S; Yoshioka, S; Miyazaki, J

    2008-01-01

    In recent years, structural colors have attracted great attention in a wide variety of research fields. This is because they are originated from complex interaction between light and sophisticated nanostructures generated in the natural world. In addition, their inherent regular structures are one of the most conspicuous examples of non-equilibrium order formation. Structural colors are deeply connected with recent rapidly growing fields of photonics and have been extensively studied to clarify their peculiar optical phenomena. Their mechanisms are, in principle, of a purely physical origin, which differs considerably from the ordinary coloration mechanisms such as in pigments, dyes and metals, where the colors are produced by virtue of the energy consumption of light. It is generally recognized that structural colors are mainly based on several elementary optical processes including thin-layer interference, diffraction grating, light scattering, photonic crystals and so on. However, in nature, these processes are somehow mixed together to produce complex optical phenomena. In many cases, they are combined with the irregularity of the structure to produce the diffusive nature of the reflected light, while in some cases they are accompanied by large-scale structures to generate the macroscopic effect on the coloration. Further, it is well known that structural colors cooperate with pigmentary colors to enhance or to reduce the brilliancy and to produce special effects. Thus, structure-based optical phenomena in nature appear to be quite multi-functional, the variety of which is far beyond our understanding. In this article, we overview these phenomena appearing particularly in the diversity of the animal world, to shed light on this rapidly developing research field

  6. Renovation of Roof Structure

    DEFF Research Database (Denmark)

    Kjærbye, Per Oluf H

    1997-01-01

    A 30 year old not-watertight roof based on wooden boards with roofing felt have been changed to a pitched structure with cementos plates. At the same time more thermal insulation has been placed.......A 30 year old not-watertight roof based on wooden boards with roofing felt have been changed to a pitched structure with cementos plates. At the same time more thermal insulation has been placed....

  7. Nuclear structure studies

    International Nuclear Information System (INIS)

    Walters, W.B.

    1992-01-01

    New results are reported for the decay and nuclear orientation of 114,116 I and 114 Sb as well as data for the structure of daughter nuclides 114,116 Te. New results for IBM-2 calculations for the structure of 126 Xe are also reported. A new approach to the problem of the underproduction of A = 120 nuclides in the astrophysical r-process is reported

  8. Damping in Timber Structures

    OpenAIRE

    Labonnote, Nathalie

    2012-01-01

    Key point to development of environmentally friendly timber structures, appropriate to urban ways of living, is the development of high-rise timber buildings. Comfort properties are nowadays one of the main limitations to tall timber buildings, and an enhanced knowledge on damping phenomena is therefore required, as well as improved prediction models for damping. The aim of this work has consequently been to estimate various damping quantities in timber structures. In particular, models h...

  9. Trajectory grouping structure

    Directory of Open Access Journals (Sweden)

    Maike Buchin

    2015-03-01

    Full Text Available The collective motion of a set of moving entities like people, birds, or other animals, is characterized by groups arising, merging, splitting, and ending. Given the trajectories of these entities, we define and model a structure that captures all of such changes using the Reeb graph, a concept from topology. The trajectory grouping structure has three natural parameters that allow more global views of the data in group size, group duration, and entity inter-distance. We prove complexity bounds on the maximum number of maximal groups that can be present, and give algorithms to compute the grouping structure efficiently. We also study how the trajectory grouping structure can be made robust, that is, how brief interruptions of groups can be disregarded in the global structure, adding a notion of persistence to the structure. Furthermore, we showcase the results of experiments using data generated by the NetLogo flocking model and from the Starkey project. The Starkey data describe the movement of elk, deer, and cattle. Although there is no ground truth for the grouping structure in this data, the experiments show that the trajectory grouping structure is plausible and has the desired effects when changing the essential parameters. Our research provides the first complete study of trajectory group evolvement, including combinatorial,algorithmic, and experimental results.

  10. Phosphor scintillator structure

    International Nuclear Information System (INIS)

    Cusano, D.A.; Prener, J.S.

    1980-01-01

    A method of fabricating scintillators is described in which the phosphor is distributed within the structure in such a way as to enhance the escape of the visible wavelength radiation that would otherwise be dissipated within the scintillator body. Two embodiments of the present invention are disclosed: one in which the phosphor is distributed in a layered structure and another in which the phosphor is dispersed throughout a transparent matrix. (U.K.)

  11. Purely Functional Structured Programming

    OpenAIRE

    Obua, Steven

    2010-01-01

    The idea of functional programming has played a big role in shaping today's landscape of mainstream programming languages. Another concept that dominates the current programming style is Dijkstra's structured programming. Both concepts have been successfully married, for example in the programming language Scala. This paper proposes how the same can be achieved for structured programming and PURELY functional programming via the notion of LINEAR SCOPE. One advantage of this proposal is that m...

  12. Adaptive structures flight experiments

    Science.gov (United States)

    Martin, Maurice

    The topics are presented in viewgraph form and include the following: adaptive structures flight experiments; enhanced resolution using active vibration suppression; Advanced Controls Technology Experiment (ACTEX); ACTEX program status; ACTEX-2; ACTEX-2 program status; modular control patch; STRV-1b Cryocooler Vibration Suppression Experiment; STRV-1b program status; Precision Optical Bench Experiment (PROBE); Clementine Spacecraft Configuration; TECHSAT all-composite spacecraft; Inexpensive Structures and Materials Flight Experiment (INFLEX); and INFLEX program status.

  13. Structural Equations and Causation

    OpenAIRE

    Hall, Ned

    2007-01-01

    Structural equations have become increasingly popular in recent years as tools for understanding causation. But standard structural equations approaches to causation face deep problems. The most philosophically interesting of these consists in their failure to incorporate a distinction between default states of an object or system, and deviations therefrom. Exploring this problem, and how to fix it, helps to illuminate the central role this distinction plays in our causal thinking.

  14. SSI and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  15. Structural prediction in aphasia

    Directory of Open Access Journals (Sweden)

    Tessa Warren

    2015-05-01

    Full Text Available There is considerable evidence that young healthy comprehenders predict the structure of upcoming material, and that their processing is facilitated when they encounter material matching those predictions (e.g., Staub & Clifton, 2006; Yoshida, Dickey & Sturt, 2013. However, less is known about structural prediction in aphasia. There is evidence that lexical prediction may be spared in aphasia (Dickey et al., 2014; Love & Webb, 1977; cf. Mack et al, 2013. However, predictive mechanisms supporting facilitated lexical access may not necessarily support structural facilitation. Given that many people with aphasia (PWA exhibit syntactic deficits (e.g. Goodglass, 1993, PWA with such impairments may not engage in structural prediction. However, recent evidence suggests that some PWA may indeed predict upcoming structure (Hanne, Burchert, De Bleser, & Vashishth, 2015. Hanne et al. tracked the eyes of PWA (n=8 with sentence-comprehension deficits while they listened to reversible subject-verb-object (SVO and object-verb-subject (OVS sentences in German, in a sentence-picture matching task. Hanne et al. manipulated case and number marking to disambiguate the sentences’ structure. Gazes to an OVS or SVO picture during the unfolding of a sentence were assumed to indicate prediction of the structure congruent with that picture. According to this measure, the PWA’s structural prediction was impaired compared to controls, but they did successfully predict upcoming structure when morphosyntactic cues were strong and unambiguous. Hanne et al.’s visual-world evidence is suggestive, but their forced-choice sentence-picture matching task places tight constraints on possible structural predictions. Clearer evidence of structural prediction would come from paradigms where the content of upcoming material is not as constrained. The current study used self-paced reading study to examine structural prediction among PWA in less constrained contexts. PWA (n=17 who

  16. RNA Thermodynamic Structural Entropy.

    Science.gov (United States)

    Garcia-Martin, Juan Antonio; Clote, Peter

    2015-01-01

    Conformational entropy for atomic-level, three dimensional biomolecules is known experimentally to play an important role in protein-ligand discrimination, yet reliable computation of entropy remains a difficult problem. Here we describe the first two accurate and efficient algorithms to compute the conformational entropy for RNA secondary structures, with respect to the Turner energy model, where free energy parameters are determined from UV absorption experiments. An algorithm to compute the derivational entropy for RNA secondary structures had previously been introduced, using stochastic context free grammars (SCFGs). However, the numerical value of derivational entropy depends heavily on the chosen context free grammar and on the training set used to estimate rule probabilities. Using data from the Rfam database, we determine that both of our thermodynamic methods, which agree in numerical value, are substantially faster than the SCFG method. Thermodynamic structural entropy is much smaller than derivational entropy, and the correlation between length-normalized thermodynamic entropy and derivational entropy is moderately weak to poor. In applications, we plot the structural entropy as a function of temperature for known thermoswitches, such as the repression of heat shock gene expression (ROSE) element, we determine that the correlation between hammerhead ribozyme cleavage activity and total free energy is improved by including an additional free energy term arising from conformational entropy, and we plot the structural entropy of windows of the HIV-1 genome. Our software RNAentropy can compute structural entropy for any user-specified temperature, and supports both the Turner'99 and Turner'04 energy parameters. It follows that RNAentropy is state-of-the-art software to compute RNA secondary structure conformational entropy. Source code is available at https://github.com/clotelab/RNAentropy/; a full web server is available at http

  17. RNA Thermodynamic Structural Entropy.

    Directory of Open Access Journals (Sweden)

    Juan Antonio Garcia-Martin

    Full Text Available Conformational entropy for atomic-level, three dimensional biomolecules is known experimentally to play an important role in protein-ligand discrimination, yet reliable computation of entropy remains a difficult problem. Here we describe the first two accurate and efficient algorithms to compute the conformational entropy for RNA secondary structures, with respect to the Turner energy model, where free energy parameters are determined from UV absorption experiments. An algorithm to compute the derivational entropy for RNA secondary structures had previously been introduced, using stochastic context free grammars (SCFGs. However, the numerical value of derivational entropy depends heavily on the chosen context free grammar and on the training set used to estimate rule probabilities. Using data from the Rfam database, we determine that both of our thermodynamic methods, which agree in numerical value, are substantially faster than the SCFG method. Thermodynamic structural entropy is much smaller than derivational entropy, and the correlation between length-normalized thermodynamic entropy and derivational entropy is moderately weak to poor. In applications, we plot the structural entropy as a function of temperature for known thermoswitches, such as the repression of heat shock gene expression (ROSE element, we determine that the correlation between hammerhead ribozyme cleavage activity and total free energy is improved by including an additional free energy term arising from conformational entropy, and we plot the structural entropy of windows of the HIV-1 genome. Our software RNAentropy can compute structural entropy for any user-specified temperature, and supports both the Turner'99 and Turner'04 energy parameters. It follows that RNAentropy is state-of-the-art software to compute RNA secondary structure conformational entropy. Source code is available at https://github.com/clotelab/RNAentropy/; a full web server is available at http

  18. WEB STRUCTURE MINING

    Directory of Open Access Journals (Sweden)

    CLAUDIA ELENA DINUCĂ

    2011-01-01

    Full Text Available The World Wide Web became one of the most valuable resources for information retrievals and knowledge discoveries due to the permanent increasing of the amount of data available online. Taking into consideration the web dimension, the users get easily lost in the web’s rich hyper structure. Application of data mining methods is the right solution for knowledge discovery on the Web. The knowledge extracted from the Web can be used to raise the performances for Web information retrievals, question answering and Web based data warehousing. In this paper, I provide an introduction of Web mining categories and I focus on one of these categories: the Web structure mining. Web structure mining, one of three categories of web mining for data, is a tool used to identify the relationship between Web pages linked by information or direct link connection. It offers information about how different pages are linked together to form this huge web. Web Structure Mining finds hidden basic structures and uses hyperlinks for more web applications such as web search.

  19. PRSEUS Structural Concept Development

    Science.gov (United States)

    Velicki, Alex; Jegley, Dawn

    2014-01-01

    A lighter, more robust airframe is one of the key technological advancements necessary for the successful launch of any large next-generation transport aircraft. Such a premise dictates that considerable improvements beyond current state-of-the-art aluminum structures is needed, and that improvements of this magnitude will require an extensive use of composite materials that are not only lightweight, but also economical to produce. To address this challenge, researchers at NASA and The Boeing Company are developing a novel structural concept called the Pultruded Rod Stitched Efficient Unitized Structure (PRSEUS) under the Environmentally Responsible Aviation (ERA) Project. It is an integrally stiffened panel concept that is stitched together and designed to maintain residual load-carrying capabilities under a variety of damage scenarios. In addition to improved structural performance, an important facet of this unique arrangement of stitched carbon fibers is its innovative manufacturing method that has the potential to lower fabrication costs by eliminating fasteners and autoclave cures. The rationale and development status for this new approach forms the basis of the work described in this paper. The test specimens described herein were fabricated, or are currently being fabricated, by The Boeing Company, while the structural analyses and testing tasks are being performed by NASA and Boeing personnel.

  20. Integrated smart structures wingbox

    Science.gov (United States)

    Simon, Solomon H.

    1993-09-01

    One objective of smart structures development is to demonstrate the ability of a mechanical component to monitor its own structural integrity and health. Achievement of this objective requires the integration of different technologies, i.e.: (1) structures, (2) sensors, and (3) artificial intelligence. We coordinated a team of experts from these three fields. These experts used reliable knowledge towards the forefront of their technologies and combined the appropriate features into an integrated hardware/software smart structures wingbox (SSW) test article. A 1/4 in. hole was drilled into the SSW test article. Although the smart structure had never seen damage of this type, it correctly recognized and located the damage. Based on a knowledge-based simulation, quantification and assessment were also carried out. We have demonstrated that the SSW integrated hardware & software test article can perform six related functions: (1) identification of a defect; (2) location of the defect; (3) quantification of the amount of damage; (4) assessment of performance degradation; (5) continued monitoring in spite of damage; and (6) continuous recording of integrity data. We present the successful results of the integrated test article in this paper, along with plans for future development and deployment of the technology.

  1. Hierarchically Structured Electrospun Fibers

    Directory of Open Access Journals (Sweden)

    Nicole E. Zander

    2013-01-01

    Full Text Available Traditional electrospun nanofibers have a myriad of applications ranging from scaffolds for tissue engineering to components of biosensors and energy harvesting devices. The generally smooth one-dimensional structure of the fibers has stood as a limitation to several interesting novel applications. Control of fiber diameter, porosity and collector geometry will be briefly discussed, as will more traditional methods for controlling fiber morphology and fiber mat architecture. The remainder of the review will focus on new techniques to prepare hierarchically structured fibers. Fibers with hierarchical primary structures—including helical, buckled, and beads-on-a-string fibers, as well as fibers with secondary structures, such as nanopores, nanopillars, nanorods, and internally structured fibers and their applications—will be discussed. These new materials with helical/buckled morphology are expected to possess unique optical and mechanical properties with possible applications for negative refractive index materials, highly stretchable/high-tensile-strength materials, and components in microelectromechanical devices. Core-shell type fibers enable a much wider variety of materials to be electrospun and are expected to be widely applied in the sensing, drug delivery/controlled release fields, and in the encapsulation of live cells for biological applications. Materials with a hierarchical secondary structure are expected to provide new superhydrophobic and self-cleaning materials.

  2. Expert Cold Structure Development

    Science.gov (United States)

    Atkins, T.; Demuysere, P.

    2011-05-01

    The EXPERT Program is funded by ESA. The objective of the EXPERT mission is to perform a sub-orbital flight during which measurements of critical aero- thermodynamic phenomena will be obtained by using state-of-the-art instrumentation. As part of the EXPERT Flight Segment, the responsibility of the Cold Structure Development Design, Manufacturing and Validation was committed to the Belgian industrial team SONACA/SABCA. The EXPERT Cold Structure includes the Launcher Adapter, the Bottom Panel, the Upper Panel, two Cross Panels and the Parachute Bay. An additional Launcher Adapter was manufactured for the separation tests. The selected assembly definition and manufacturing technologies ( machined parts and sandwich panels) were dictated classically by the mass and stiffness, but also by the CoG location and the sensitive separation interface. Used as support for the various on-board equipment, the Cold Structure is fixed to but thermally uncoupled from the PM 1000 thermal shield. It is protect on its bottom panel by a thermal blanket. As it is a protoflight, analysis was the main tool for the verification. Low level stiffness and modal analysis tests have also been performed on the Cold Structure equipped with its ballast. It allowed to complete its qualification and to prepare SONACA/SABCA support for the system dynamic tests foreseen in 2011. The structure was finally coated with a thermal control black painting and delivered on time to Thales Alenia Space-Italy end of March 201.

  3. Carbon Structure Hazard Control

    Science.gov (United States)

    Yoder, Tommy; Greene, Ben; Porter, Alan

    2015-01-01

    Carbon composite structures are widely used in virtually all advanced technology industries for a multitude of applications. The high strength-to-weight ratio and resistance to aggressive service environments make them highly desirable. Automotive, aerospace, and petroleum industries extensively use, and will continue to use, this enabling technology. As a result of this broad range of use, field and test personnel are increasingly exposed to hazards associated with these structures. No single published document exists to address the hazards and make recommendations for the hazard controls required for the different exposure possibilities from damaged structures including airborne fibers, fly, and dust. The potential for personnel exposure varies depending on the application or manipulation of the structure. The effect of exposure to carbon hazards is not limited to personnel, protection of electronics and mechanical equipment must be considered as well. The various exposure opportunities defined in this document include pre-manufacturing fly and dust, the cured structure, manufacturing/machining, post-event cleanup, and post-event test and/or evaluation. Hazard control is defined as it is applicable or applied for the specific exposure opportunity. The carbon exposure hazard includes fly, dust, fiber (cured/uncured), and matrix vapor/thermal decomposition products. By using the recommendations in this document, a high level of confidence can be assured for the protection of personnel and equipment.

  4. Fluid structure coupling algorithm

    International Nuclear Information System (INIS)

    McMaster, W.H.; Gong, E.Y.; Landram, C.S.; Quinones, D.F.

    1980-01-01

    A fluid-structure-interaction algorithm has been developed and incorporated into the two-dimensional code PELE-IC. This code combines an Eulerian incompressible fluid algorithm with a Lagrangian finite element shell algorithm and incorporates the treatment of complex free surfaces. The fluid structure and coupling algorithms have been verified by the calculation of solved problems from the literature and from air and steam blowdown experiments. The code has been used to calculate loads and structural response from air blowdown and the oscillatory condensation of steam bubbles in water suppression pools typical of boiling water reactors. The techniques developed have been extended to three dimensions and implemented in the computer code PELE-3D

  5. Graphene heat dissipating structure

    Science.gov (United States)

    Washburn, Cody M.; Lambert, Timothy N.; Wheeler, David R.; Rodenbeck, Christopher T.; Railkar, Tarak A.

    2017-08-01

    Various technologies presented herein relate to forming one or more heat dissipating structures (e.g., heat spreaders and/or heat sinks) on a substrate, wherein the substrate forms part of an electronic component. The heat dissipating structures are formed from graphene, with advantage being taken of the high thermal conductivity of graphene. The graphene (e.g., in flake form) is attached to a diazonium molecule, and further, the diazonium molecule is utilized to attach the graphene to material forming the substrate. A surface of the substrate is treated to comprise oxide-containing regions and also oxide-free regions having underlying silicon exposed. The diazonium molecule attaches to the oxide-free regions, wherein the diazonium molecule bonds (e.g., covalently) to the exposed silicon. Attachment of the diazonium plus graphene molecule is optionally repeated to enable formation of a heat dissipating structure of a required height.

  6. Transcendental idealism and structuralism

    Directory of Open Access Journals (Sweden)

    Ivan Vuković

    2016-02-01

    Full Text Available The author examines possible analogies between Kant’s transcendental idealism and de Saussure’s and Levi-Strauss’s structuralism, in order to analyse if the former can be understood as a predecessor for the later. The author shows that both teachings assume a priori formal framework, but they diverge in the ways they describe it, as well as in understanding of its function. Consequently, the author concludes that structuralism can be seen as one possible use of Kant’s idea about the existence of such a frame. Furthermore, the author claims that Ricker’s understanding of structuralism as ‘Kantianism without transcendental subject’ should be rejected, since a teaching which does not assume existence of such subject cannot be understood as Kantian.

  7. Structural power flow measurement

    Energy Technology Data Exchange (ETDEWEB)

    Falter, K.J.; Keltie, R.F.

    1988-12-01

    Previous investigations of structural power flow through beam-like structures resulted in some unexplained anomalies in the calculated data. In order to develop structural power flow measurement as a viable technique for machine tool design, the causes of these anomalies needed to be found. Once found, techniques for eliminating the errors could be developed. Error sources were found in the experimental apparatus itself as well as in the instrumentation. Although flexural waves are the carriers of power in the experimental apparatus, at some frequencies longitudinal waves were excited which were picked up by the accelerometers and altered power measurements. Errors were found in the phase and gain response of the sensors and amplifiers used for measurement. A transfer function correction technique was employed to compensate for these instrumentation errors.

  8. Freeform Honeycomb Structures

    KAUST Repository

    Jiang, Caigui

    2014-07-01

    Motivated by requirements of freeform architecture, and inspired by the geometry of hexagonal combs in beehives, this paper addresses torsion-free structures aligned with hexagonal meshes. Since repetitive geometry is a very important contribution to the reduction of production costs, we study in detail “honeycomb structures”, which are defined as torsion-free structures where the walls of cells meet at 120 degrees. Interestingly, the Gauss-Bonnet theorem is useful in deriving information on the global distribution of node axes in such honeycombs. This paper discusses the computation and modeling of honeycomb structures as well as applications, e.g. for shading systems, or for quad meshing. We consider this paper as a contribution to the wider topic of freeform patterns, polyhedral or otherwise. Such patterns require new approaches on the technical level, e.g. in the treatment of smoothness, but they also extend our view of what constitutes aesthetic freeform geometry.

  9. Structural Sparse Tracking

    KAUST Repository

    Zhang, Tianzhu

    2015-06-01

    Sparse representation has been applied to visual tracking by finding the best target candidate with minimal reconstruction error by use of target templates. However, most sparse representation based trackers only consider holistic or local representations and do not make full use of the intrinsic structure among and inside target candidates, thereby making the representation less effective when similar objects appear or under occlusion. In this paper, we propose a novel Structural Sparse Tracking (SST) algorithm, which not only exploits the intrinsic relationship among target candidates and their local patches to learn their sparse representations jointly, but also preserves the spatial layout structure among the local patches inside each target candidate. We show that our SST algorithm accommodates most existing sparse trackers with the respective merits. Both qualitative and quantitative evaluations on challenging benchmark image sequences demonstrate that the proposed SST algorithm performs favorably against several state-of-the-art methods.

  10. Dynamic Data Structures

    DEFF Research Database (Denmark)

    Kejlberg-Rasmussen, Casper

    statements about our data structure, which are based on the structure of the underlying problem, that we are trying to solve. We can rely on the properties of the invariants when performing queries, and in return we need to ensure that the invariants remain true after we perform updates. When designing data......In this thesis I will address three dynamic data structure problems using the concept of invariants. The first problem is maintaining a dynamically changing set of keys – a dictionary – where the queries we can ask are: does it contain a given key? and what is the preceding (or succeeding) key...... to a given key? The updates we can do are: inserting a new key or deleting a given key. Our dictionary has the working set property, which means that the running time of a query depends on the query distribution. Specifically the time to search for a key depends on when we last searched for it. Our data...

  11. Structure and biophysics

    CERN Document Server

    Puglisi, Joseph D

    2007-01-01

    This volume is a collection of articles from the proceedings of the ISSBMR 7th Course: Structure and Biophysics - New Technologies for Current Challenges in Biology and Beyond. This NATO Advanced Institute (ASI) was held in Erice at the Ettore Majorana Foundation and Centre for Scientific Culture on 22 June through 3 July 2005. The ASI brought together a diverse group of experts in the fields of Structural Biology, Biophysics and Physics. Prominent lecturers, from seven different countries, and students from around the world participated in the NATO ASI organized by Professors Joseph Puglisi (Stanford University, USA) and Alexander Arseniev (Moscow, RU). Advances in nuclear magnetic resonance spectroscopy (NMR) and x-ray crystallography have allowed the three-dimensional structures of many biological macromolecules and their complexes, including the ribosome and RNA polymerase to be solved. Fundamental principles of NMR spectroscopy and dynamics, x-ray crystallography, computation and experimental dynamics we...

  12. Diagnostics and structure

    International Nuclear Information System (INIS)

    Vial, J.C.

    1986-01-01

    The structure of prominences and the diagnostic techniques used to evaluate their physical parameters are discussed. These include electron temperature, various densities (n sub p, n sub e, n sub l), ionization degree, velocities, and magnetic field vector. UV and radio measurements have already evidenced the existence of different temperature regions, corresponding to different geometrical locations, e.g., the so called Prominence-Corona (P-C) interface. Velocity measurements are important for considering formation and mass balance of prominences but there are conflicting velocity measurements which have led to the basic question: what structure is actually observed at a given wavelength; what averaging is performed within the projected slit area during the exposure time? In optically thick lines, the question of the formation region of the radiation along the line of sight is also not a trivial one. The same is true for low resolution measurements of the magnetic field. Coupling diagnostics with structure is now a general preoccupation

  13. Structural motion engineering

    CERN Document Server

    Connor, Jerome

    2014-01-01

    This innovative volume provides a systematic treatment of the basic concepts and computational procedures for structural motion design and engineering for civil installations. The authors illustrate the application of motion control to a wide spectrum of buildings through many examples. Topics covered include optimal stiffness distributions for building-type structures, the role of damping in controlling motion, tuned mass dampers, base isolation systems, linear control, and nonlinear control. The book's primary objective is the satisfaction of motion-related design requirements, such as restrictions on displacement and acceleration. The book is ideal for practicing engineers and graduate students. This book also: ·         Broadens practitioners' understanding of structural motion control, the enabling technology for motion-based design ·         Provides readers the tools to satisfy requirements of modern, ultra-high strength materials that lack corresponding stiffness, where the motion re...

  14. Structures of Feeling

    DEFF Research Database (Denmark)

    Taking as its point of departure Raymond Williams' notion 'structure of feeling', this volume investigates how affectivity makes a difference in memory studies, performance studies, and the range of cultural studies across the humanities and social sciences today. It illustrates the importance of...... of theorizing affectivity at a moment when social and cultural life are becoming increasingly affect-driven.......Taking as its point of departure Raymond Williams' notion 'structure of feeling', this volume investigates how affectivity makes a difference in memory studies, performance studies, and the range of cultural studies across the humanities and social sciences today. It illustrates the importance...

  15. Dynamics of structures

    CERN Document Server

    Paultre, Patrick

    2013-01-01

    This book covers structural dynamics from a theoretical and algorithmic approach. It covers systems with both single and multiple degrees-of-freedom. Numerous case studies are given to provide the reader with a deeper insight into the practicalities of the area, and the solutions to these case studies are given in terms of real-time and frequency in both geometric and modal spaces. Emphasis is also given to the subject of seismic loading. The text is based on many lectures on the subject of structural dynamics given at numerous institutions and thus will be an accessible and practical aid to

  16. Bellefonte primary containment structure

    International Nuclear Information System (INIS)

    Olyniec, J.H.

    1981-01-01

    Construction of the reactor building primary containment structure at the Bellefonte Nuclear Plant involved several specialized construction techniques. This two unit plant is one of the nine nuclear units at six different sites now under construction by the Tennessee Valley Authority (TVA). The post-Tensioned, cast-in-place interior steel lined containment structure is unique within TVA. Problems during construction were identified at weekly planning meetings, and options were discussed. Close coordination between craft supervisors and on-site engineering personnel drew together ''hands-on''experience and technical background. Details of the construction techniques, problems, and solutions are presented

  17. Nucleon structure functions

    International Nuclear Information System (INIS)

    Virchaux, M.

    1992-11-01

    The present status of experimental measurements of the nucleon structure functions is reviewed. The results from nearly all deep inelastic experiments are in good mutual agreement. Principles of the analysis of these structure function data in the framework of QCD are described. The specific features of the perturbative QCD predictions are observed in the data. This provides quantitative tests of the validity of QCD as well as determinations of the various parton distributions in the nucleon and some of the most precise measurements of the strong coupling constant αs. The future of this field of experimental physics is sketched

  18. Structured Analog CMOS Design

    CERN Document Server

    Stefanovic, Danica

    2008-01-01

    Structured Analog CMOS Design describes a structured analog design approach that makes it possible to simplify complex analog design problems and develop a design strategy that can be used for the design of large number of analog cells. It intentionally avoids treating the analog design as a mathematical problem, developing a design procedure based on the understanding of device physics and approximations that give insight into parameter interdependences. The proposed transistor-level design procedure is based on the EKV modeling approach and relies on the device inversion level as a fundament

  19. Structural mechanics simulations

    International Nuclear Information System (INIS)

    Biffle, J.H.

    1992-01-01

    Sandia National Laboratory has a very broad structural capability. Work has been performed in support of reentry vehicles, nuclear reactor safety, weapons systems and components, nuclear waste transport, strategic petroleum reserve, nuclear waste storage, wind and solar energy, drilling technology, and submarine programs. The analysis environment contains both commercial and internally developed software. Included are mesh generation capabilities, structural simulation codes, and visual codes for examining simulation results. To effectively simulate a wide variety of physical phenomena, a large number of constitutive models have been developed

  20. Complex photonic structures

    International Nuclear Information System (INIS)

    Wiersma, D.S.

    2013-01-01

    We discuss in detail the optical properties of complex photonic structures, in particular those with a dominating disorder component. We will focus on their general transport properties, as well as on their use as light sources (random lasers). The basis for the theory of multiple light scattering in random systems will be explained as a tutorial introduction to the topic, including the explicit calculation of the effect of coherent backscattering. We will discuss various structures that go beyond regular disordered ones, in particular Levy glasses, liquid crystals, and quasicrystals, and show examples of their optical properties both from a conceptual and practical point of view.

  1. Timber in Bridge Structures

    OpenAIRE

    Detkin, Viktoria

    2016-01-01

    The purpose of this final year project was to study the properties of timber as a structural material and the suitability of wood in load bearing members for bridge structures. For a case study, an existing timber bridge was selected. Due to its condition the bridge should be replaced. The design of a new bridge with steel beams holding a glulam deck was made. During the case study the replacement of steel beams by glulam timber ones was discussed. Some calculations were made in order to ...

  2. Space dissipative structures

    International Nuclear Information System (INIS)

    Chernousenko, V.M.; Kuklin, V.M.; Panachenko, I.P.; Vorob'yov, V.M.

    1990-01-01

    This paper reports on a wide spectrum of oscillations that is excited due to the evolution instabilities, being in a weak above-threshold state, in the inequilibrium media with decaying spectrum. In this case the pumping, whose part is played by an intensive wave or occupation inversion in the active medium, synchronized the phases of excited modes and, thus, forms the space dissipative structure of the field. In dissipative nonlinear media with nondecaying spectrum the space structures, formed due to the development of instability, experience small-scale hexagonal modulation

  3. Structure - materials - production

    DEFF Research Database (Denmark)

    Gammelgaard Nielsen, Anders; Gammel, Peder; Busch, Jens

    2002-01-01

    For the last six years th Aarhus School of Architecture has introduced the first year students (there are about 200 students admitted each year) to structure, materials, design and production through a five week course in collaboration with a group of local companies.......For the last six years th Aarhus School of Architecture has introduced the first year students (there are about 200 students admitted each year) to structure, materials, design and production through a five week course in collaboration with a group of local companies....

  4. Determinants of capital structure.

    Science.gov (United States)

    McCue, M J; Ozcan, Y A

    1992-01-01

    This study analyzes the determinants of hospital capital structure in a new market setting that are created by the financial pressures of prospective payment and the intense price competition among hospitals. Using California data, the study found hospital system affiliation, bed size, growth rate in revenues, operating risk, and asset structure affected both short- and long-term debt borrowings. In addition, percentage of uncompensated care, profitability, and payer mix influenced short-term borrowings while market conditions and ownership affected long-term borrowings. Most significant of all is the finding that smaller hospitals tend to borrow more, possibly because they cannot generate funds internally.

  5. Vibration-based structural health monitoring of harbor caisson structure

    Science.gov (United States)

    Lee, So-Young; Lee, So-Ra; Kim, Jeong-Tae

    2011-04-01

    This study presents vibration-based structural health monitoring method in foundation-structure interface of harbor caisson structure. In order to achieve the objective, the following approaches are implemented. Firstly, vibration-based response analysis method is selected and structural health monitoring (SHM) technique is designed for harbor caisson structure. Secondly, the performance of designed SHM technique for harbor structure is examined by FE analysis. Finally, the applicability of designed SHM technique for harbor structure is evaluated by dynamic tests on a lab-scaled caisson structure.

  6. Structural Evaluation Procedures for Heavy Wood Truss Structures

    National Research Council Canada - National Science Library

    Issa, Mohsen

    1998-01-01

    .... An evaluation procedure for wood structures differs from conventional methods used in steel, concrete, and masonry structures because, in wood construction, the allowable stresses used in design...

  7. Prosodic structure as a parallel to musical structure

    Directory of Open Access Journals (Sweden)

    Christopher Cullen Heffner

    2015-12-01

    Full Text Available What structural properties do language and music share? Although early speculation identified a wide variety of possibilities, the literature has largely focused on the parallels between musical structure and syntactic structure. Here, we argue that parallels between musical structure and prosodic structure deserve more attention. We review the evidence for a link between musical and prosodic structure and find it to be strong. In fact, certain elements of prosodic structure may provide a parsimonious comparison with musical structure without sacrificing empirical findings related to the parallels between language and music. We then develop several predictions related to such a hypothesis.

  8. Coastal Structures and Barriers 2012

    Data.gov (United States)

    California Natural Resource Agency — This dataset is a compilation of the UCSC Sand Retention Structures, MC Barriers, and USACE Coastal Structures. UCSC Sand Retention Structures originate from a...

  9. System Reliability of Timber Structures

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Sørensen, John Dalsgaard

    2010-01-01

    elements, alternate load path(s) etc. in the structural design. In general these characteristics can have a positive influence on system reliability of a structure however, in Eurocodes ductility is only awarded for concrete and steel structures but not for timber structures. It is well......-know that structural systems can redistribute internal forces due to ductility of a connection, i.e. some additional loads can be carried by the structure. The same effect is also possible for reinforced concrete structures and structures of steel. However, for timber structures codes do not award that ductility......For reduction of the risk of collapse in the event of loss of structural element(s), a structural engineer may take necessary steps to design a collapse-resistant structure that is insensitive to accidental circumstances e.g. by incorporating characteristics like redundancy, ties, ductility, key...

  10. Probabilistic Structural Analysis Program

    Science.gov (United States)

    Pai, Shantaram S.; Chamis, Christos C.; Murthy, Pappu L. N.; Stefko, George L.; Riha, David S.; Thacker, Ben H.; Nagpal, Vinod K.; Mital, Subodh K.

    2010-01-01

    NASA/NESSUS 6.2c is a general-purpose, probabilistic analysis program that computes probability of failure and probabilistic sensitivity measures of engineered systems. Because NASA/NESSUS uses highly computationally efficient and accurate analysis techniques, probabilistic solutions can be obtained even for extremely large and complex models. Once the probabilistic response is quantified, the results can be used to support risk-informed decisions regarding reliability for safety-critical and one-of-a-kind systems, as well as for maintaining a level of quality while reducing manufacturing costs for larger-quantity products. NASA/NESSUS has been successfully applied to a diverse range of problems in aerospace, gas turbine engines, biomechanics, pipelines, defense, weaponry, and infrastructure. This program combines state-of-the-art probabilistic algorithms with general-purpose structural analysis and lifting methods to compute the probabilistic response and reliability of engineered structures. Uncertainties in load, material properties, geometry, boundary conditions, and initial conditions can be simulated. The structural analysis methods include non-linear finite-element methods, heat-transfer analysis, polymer/ceramic matrix composite analysis, monolithic (conventional metallic) materials life-prediction methodologies, boundary element methods, and user-written subroutines. Several probabilistic algorithms are available such as the advanced mean value method and the adaptive importance sampling method. NASA/NESSUS 6.2c is structured in a modular format with 15 elements.

  11. The Fine Structure Constant

    Indian Academy of Sciences (India)

    IAS Admin

    The article discusses the importance of the fine structure constant in quantum mechanics, along with the brief history of how it emerged. Al- though Sommerfelds idea of elliptical orbits has been replaced by wave mechanics, the fine struc- ture constant he introduced has remained as an important parameter in the field of ...

  12. Structured Mechanical Collage.

    Science.gov (United States)

    Huang, Zhe; Wang, Jiang; Fu, Hongbo; Lau, Rynson W H

    2014-07-01

    We present a method to build 3D structured mechanical collages consisting of numerous elements from the database given artist-designed proxy models. The construction is guided by some graphic design principles, namely unity, variety and contrast. Our results are visually more pleasing than previous works as confirmed by a user study.

  13. Teaching concrete structures

    DEFF Research Database (Denmark)

    Goltermann, Per

    2014-01-01

    The teaching of concrete structures has been revised and a number of new approaches have been developed, implemented and evaluated. Inductive teaching, E-learning and “patches” have been found to be improvements and may be an inspiration and help for others development of the teaching and learning...

  14. DNA: Structure and function

    DEFF Research Database (Denmark)

    Sinden, Richard R.; E. Pearson, Christopher; N. Potaman, Vladimir

    1998-01-01

    This chapter discusses the structure and function of DNA. DNA occupies a critical role in cells, because it is the source of all intrinsic genetic information. Chemically, DNA is a very stable molecule, a characteristic important for a macromolecule that may have to persist in an intact form...

  15. Housing And Mounting Structure

    Science.gov (United States)

    Anderson, Gene R.; Armendariz, Marcelino G.; Baca, Johnny R.F.; Bryan, Robert P.; Carson, Richard F.; Duckett, III, Edwin B.; McCormick, Frederick B.; Miller, Gregory V.; Peterson, David W.; Smith, Terrance T.

    2005-03-08

    This invention relates to an optical transmitter, receiver or transceiver module, and more particularly, to an apparatus for connecting a first optical connector to a second optical connector. The apparatus comprises: (1) a housing having at least a first end and at least a second end, the first end of the housing capable of receiving the first optical connector, and the second end of the housing capable of receiving the second optical connector; (2) a longitudinal cavity extending from the first end of the housing to the second end of the housing; and (3) an electromagnetic shield comprising at least a portion of the housing. This invention also relates to an apparatus for housing a flexible printed circuit board, and this apparatus comprises: (1) a mounting structure having at least a first surface and a second surface; (2) alignment ridges along the first and second surfaces of the mounting structure, the alignment ridges functioning to align and secure a flexible printed circuit board that is wrapped around and attached to the first and second surfaces of the mounting structure; and (3) a series of heat sink ridges adapted to the mounting structure, the heat sink ridges functioning to dissipate heat that is generated from the flexible printed circuit board.

  16. Silicon Betavoltaic Batteries Structures

    OpenAIRE

    V.N. Murashev; S.A. Legotin; O.I. Rabinovich; O.R. Abdulaev; U.V. Osipov

    2015-01-01

    For low-power miniature energy creation sources the particular interest is nickel Ni63. This paper discusses the main types of betavoltaic battery structures with the prospects for industrial application using - isotope of nickel Ni63. It is shown that the prospects for improving the effective efficiency are planar multijunction betavoltaic batteries.

  17. Circular arc structures

    KAUST Repository

    Bo, Pengbo; Pottmann, Helmut; Kilian, Martin; Wang, Wen Ping; Wallner, Johannes

    2011-01-01

    and connecting elements as well as repetition of costly parts. This paper proposes so-called circular arc structures as a means to faithfully realize freeform designs without giving up smooth appearance. In contrast to non-smooth meshes with straight edges where

  18. Hadron-structure

    International Nuclear Information System (INIS)

    De, S.S.

    1989-01-01

    The paper deals with the space-time structure of the sub-atomic world and attempts to construct the fields of the constitutents of the hadrons. Then it is attempted to construct the fields of the hadrons from these micro-fields. (autho r). 24 refs

  19. New level of structure

    International Nuclear Information System (INIS)

    Greenberg, O.W.

    1985-01-01

    In the standard model of matter, ther are five stages of compositeness- molecules, atoms, nuclei, nucleons, and quarks and leptons-but we are beginning to see regularities at the fifth layer that may point to a deeper, sixth level of structure

  20. Adaptive building skin structures

    International Nuclear Information System (INIS)

    Del Grosso, A E; Basso, P

    2010-01-01

    The concept of adaptive and morphing structures has gained considerable attention in the recent years in many fields of engineering. In civil engineering very few practical applications are reported to date however. Non-conventional structural concepts like deployable, inflatable and morphing structures may indeed provide innovative solutions to some of the problems that the construction industry is being called to face. To give some examples, searches for low-energy consumption or even energy-harvesting green buildings are amongst such problems. This paper first presents a review of the above problems and technologies, which shows how the solution to these problems requires a multidisciplinary approach, involving the integration of architectural and engineering disciplines. The discussion continues with the presentation of a possible application of two adaptive and dynamically morphing structures which are proposed for the realization of an acoustic envelope. The core of the two applications is the use of a novel optimization process which leads the search for optimal solutions by means of an evolutionary technique while the compatibility of the resulting configurations of the adaptive envelope is ensured by the virtual force density method

  1. Space-time structure

    CERN Document Server

    Schrödinger, Erwin

    1985-01-01

    In response to repeated requests this classic book on space-time structure by Professor Erwin Schrödinger is now available in the Cambridge Science Classics series. First published in 1950, and reprinted in 1954 and 1960, this lucid and profound exposition of Einstein's 1915 theory of gravitation still provides valuable reading for students and research workers in the field.

  2. Materials with structural hierarchy

    Science.gov (United States)

    Lakes, Roderic

    1993-01-01

    The role of structural hierarchy in determining bulk material properties is examined. Dense hierarchical materials are discussed, including composites and polycrystals, polymers, and biological materials. Hierarchical cellular materials are considered, including cellular solids and the prediction of strength and stiffness in hierarchical cellular materials.

  3. Structural Pest Control.

    Science.gov (United States)

    Kahn, M. S.; Hoffman, W. M.

    This manual is designed for those who seek certification as pesticide applicators for industrial, institutional, structural, and health-related pest control. It is divided into six sections covering general pest control, wood-destroying organisms, bird control, fumigation, rodent control, and industrial weed control. The manual gives information…

  4. Artificially structured materials

    International Nuclear Information System (INIS)

    Cho, A.Y.

    1988-01-01

    Recent developments in crystal growth methods such as molecular beam epitaxy (MBE) and metal-organic chemical vapor deposition (MOCVD) allow us to artifically structure new materials on an atomic scale. These structures may have electrical or optical properties that cannot be obtained in bulk crystals. There has been a dramatic increase in the study of layered structures during the past decade which has led to the discovery of many unexpected physical phenomena and opened a completely new branch of device physics. Since the advanced crystal growth techniques can tailor the compositions and doping profiles of the material to atomic scales, it pushes the frontier of devices to the ultimate imagination of device physicists and engineers. It is likely that for the next century the new generation of devices will rely heavily on artifically structured materials. This article will be limited to a discussion of recent developments in the area of semiconductor thin epitaxial films which may have technological impact. 21 refs., 12 figs

  5. Nature teaching structures

    DEFF Research Database (Denmark)

    Wester, Ture

    2002-01-01

    -living nature a number of striking statical and kinematical peculiarities have been observed. The paper will try to isolate and describe some of these observations and their relation to our engineered structures based on human thinking. The paper will deal with basic aspects as geometry, topology, redundancy...

  6. Unequal by Structure

    DEFF Research Database (Denmark)

    Holck, Lotte

    2018-01-01

    generates inequality. Second, inequality is sustained by inadequate integration methods that merge a formal–informal hierarchy, which results in peer competition and majority elites. The structural approach to organizational diversity developed in this article nuances the current research on diversity...

  7. Diquark structure of baryons

    International Nuclear Information System (INIS)

    Silvestre-Brac, B.

    1987-01-01

    Three body calculations for studying the baryons are performed in a non-relativistic treatment with three quarks interacting via Bhaduri's potential. From the resulting wave functions, it is analysed under which conditions can a diquark structure occurs. Several photos showing quark distributions inside the baryons are presented and discussed in details

  8. Reforming Organizational Structures

    NARCIS (Netherlands)

    S.G.J. Van de Walle (Steven)

    2016-01-01

    textabstractPublic sectors have undergone major transformations. Public sector reform touches upon the core building blocks of the public sector: organizational structures, people and finances. These are objects of reform. This chapter presents and discusses a set of major transformations with

  9. Structural Emergency Control Paradigm

    DEFF Research Database (Denmark)

    Vu, Thanh Long; Chatzivasileiadis, Spyros; Chiang, Hsiao-Dong

    2017-01-01

    demand and hopefully stabilize the system. This traditional emergency control results in interrupted service with severe economic damage to customers. Also, such control is usually less effective due to the lack of coordination among protective devices. In this paper, we propose a novel structural...

  10. Hypernuclei and nuclear structure

    International Nuclear Information System (INIS)

    Rayet, M.

    1977-01-01

    The relations between several aspects of nuclear structure and the Λ hyperon properties inside nuclei are discussed, particularly in connexion with the possibilities offered by the development of new experimental techniques. It is emphasized that Hartree-Fock methods provide an interesting tool for predicting hypernuclear phenomena where the Λ hyperon may be used as a probe of the nucleus [fr

  11. The Structure of Pectin

    Energy Technology Data Exchange (ETDEWEB)

    Mort, Andrew [Oklahoma State Univ., Stillwater, OK (United States). Dept. of Biochemistry and Molecular Biology

    2017-01-12

    At the beginning of this project we hypothesized that pectin, which is a major polysaccharide in primary plant cell walls, is composed of various distinct structural regions covalently linked together into a high molecular weight complex polymer. We also hypothesized that a considerable portion of xyloglucan, the major hemicellulose in most primary cell walls, is linked to the pectin. Our goal was to determine if these interconnections exist and to characterize the exact nature of the interactions. It seems imperative that we have a complete knowledge of the structure of pectin to be able to propose realistic models of cell walls. There is a lot of interest in the biosynthesis of pectin. I do not think it will be possible to completely understand the biosynthesis of pectin without knowing the structure of pectin and thus the sequence of reactions needed to put each sugar or ester in its correct position in the polymer. We made considerable progress in determining the detailed structure of pectin and within a year or so will be able to put forward a comprehensive model of it.

  12. Cell Structure Study.

    Science.gov (United States)

    Ekstrom, James V.

    2000-01-01

    Presents an activity in which students use microscopes and digital images to examine Elodea, a fresh water plant, before and after the process of plasmolysis, identify plant cellular structures before and after plasmolysis, and calculate the size of the plant's vacuole. (ASK)

  13. THE STRUCTURE OF RIFF.

    Science.gov (United States)

    APPLEGATE, JOSEPH R.

    THE PURPOSE OF THIS DESCRIPTIVE STUDY IS TO DEFINE THE MAJOR STRUCTURAL FEATURES OF RIFF, A BERBER LANGUAGE SPOKEN BY THE BERBER TRIBESMEN OF THE RIF IN NORTHERN MOROCCO. THE DESCRIPTION IS PRESENTED IN THREE PARTS--PHONOLOGY, MORPHOLOGY, AND SYNTAX. THE PHONEMES ARE DESCRIBED IN TERMS OF DISTINCTIVE FEATURES. PHARYNGEALIZATION AND TENSION ARE…

  14. Dynamic Data Structures

    DEFF Research Database (Denmark)

    Tsakalidis, Konstantinos

    multi-versioned indexing database. We first present a generic method for making data structures fully persistent in external memory. This method can render any database multi-versioned, as long as its implementation abides by our assumptions. We obtain the result by presenting an implementation of B...

  15. Sub-structure

    CSIR Research Space (South Africa)

    Van Wyk, Llewellyn V

    2010-04-01

    Full Text Available in Conventional Sub-structure Element Concrete Volume (m 3 ) kgCO2/m 3 (see footnote) Total CO2 (kg) Foundations 1 3.69 209 2 771 Foundation walls 3 1.79 174 4 311 Concrete slab 5 4.09 250 6 1022 Total 9.57 2104 Raft foundations...

  16. Extracellular matrix structure.

    Science.gov (United States)

    Theocharis, Achilleas D; Skandalis, Spyros S; Gialeli, Chrysostomi; Karamanos, Nikos K

    2016-02-01

    Extracellular matrix (ECM) is a non-cellular three-dimensional macromolecular network composed of collagens, proteoglycans/glycosaminoglycans, elastin, fibronectin, laminins, and several other glycoproteins. Matrix components bind each other as well as cell adhesion receptors forming a complex network into which cells reside in all tissues and organs. Cell surface receptors transduce signals into cells from ECM, which regulate diverse cellular functions, such as survival, growth, migration, and differentiation, and are vital for maintaining normal homeostasis. ECM is a highly dynamic structural network that continuously undergoes remodeling mediated by several matrix-degrading enzymes during normal and pathological conditions. Deregulation of ECM composition and structure is associated with the development and progression of several pathologic conditions. This article emphasizes in the complex ECM structure as to provide a better understanding of its dynamic structural and functional multipotency. Where relevant, the implication of the various families of ECM macromolecules in health and disease is also presented. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Advanced Polymer Network Structures

    Science.gov (United States)

    2016-02-01

    attractive interaction (n = 2.0) and a neutral interaction (n = 1.0); n is equal to unity for self-interactions among the monomers of first network and...... Network Structures by Robert Lambeth, Joseph Lenhart, and Tim Sirk Weapons and Materials Research Directorate, ARL Yelena Sliozberg TKC Global

  18. Electromagnetic structure of nuclei

    International Nuclear Information System (INIS)

    Arnold, R.G.

    1986-07-01

    A brief review is given of selected topics in the electromagnetic structure of nucleons and nuclei, including nucleon form factors from both quantum chromodynamics and electron scattering data, measurements of the deuteron and triton form factors, quasi-elastic scattering, and the EMC effect. 47 refs., 13 figs

  19. Structure of multidimensional patterns

    International Nuclear Information System (INIS)

    Smith, S.P.

    1982-01-01

    The problem of describing the structure of multidimensional data is important in exploratory data analysis, statistical pattern recognition, and image processing. A data set is viewed as a collection of points embedded in a high dimensional space. The primary goal of this research is to determine if the data have any clustering structure; such a structure implies the presence of class information (categories) in the data. A statistical hypothesis is used in the decision making. To this end, data with no structure are defined as data following the uniform distribution over some compact convex set in K-dimensional space, called the sampling window. This thesis defines two new tests for uniformity along with various sampling window estimators. The first test is a volume-based test which captures density changes in the data. The second test compares a uniformly distributed sample to the data by using the minimal spanning tree (MST) of the polled samples. Sampling window estimators are provided for simple sampling windows and use the convex hull of the data as a general sampling window estimator. For both of the tests for uniformity, theoretical results are provided on their size, and study their size and power against clustered alternatives is studied. Simulation is also used to study the efficacy of the sampling window estimators

  20. GKZ Hypergeometric Structures

    NARCIS (Netherlands)

    Stienstra, J.

    2007-01-01

    This text is based on lectures by the author in the Summer School Algebraic Geometry and Hypergeometric Functions in Istanbul in June 2005. It gives a review of some of the basic aspects of the theory of hypergeometric structures of Gelfand, Kapranov and Zelevinsky, including Differential

  1. Land, Structure & Depreciation

    NARCIS (Netherlands)

    Francke, M.; van de Minne, A.

    2013-01-01

    We introduce a hedonic price model which enables us to disentangle the value of a residential property into the value of land and the value of structure, while controlling for depreciation and vintage effects. For given reconstruction costs we are able to estimate the impact of physical

  2. Industrialized timber structures.

    Science.gov (United States)

    1974-01-01

    It was recently learned that a number of innovations in structural timber components are available to the construction industry, but that they were largely unknown to bridge designers. The purpose of this study was to develop for the Department a fea...

  3. Hydraulic Structures : Caissons

    NARCIS (Netherlands)

    Voorendt, M.Z.; Molenaar, W.F.; Bezuyen, K.G.

    These lecture notes on caissons are part of the study material belonging to the course 'Hydraulic Structures 1' (code CTB3355), part of the Bachelor of Science education and the Hydraulic Engineering track of the Master of Science education for civil engineering students at Delft University of

  4. LDR structural experiment definition

    Science.gov (United States)

    Russell, R. A.

    1988-01-01

    A system study to develop the definition of a structural flight experiment for a large precision segmented reflector on the Space Station was accomplished by the Boeing Aerospace Company for NASA's Langley Research Center. The objective of the study was to use a Large Deployable Reflector (LDR) baseline configuration as the basis for focusing an experiment definition, so that the resulting accommodation requirements and interface constraints could be used as part of the mission requirements data base for Space Station. The primary objectives of the first experiment are to construct the primary mirror support truss and to determine its structural and thermal characteristics. Addition of an optical bench, thermal shield and primary mirror segments, and alignment of the optical components, would occur on a second experiment. The structure would then be moved to the payload point system for pointing, optical control, and scientific optical measurement for a third experiment. Experiment 1 will deploy the primary support truss while it is attached to the instrument module structure. The ability to adjust the mirror attachment points and to attach several dummy primary mirror segments with a robotic system will also be demonstrated. Experiment 2 will be achieved by adding new components and equipment to experiment one. Experiment 3 will demonstrate advanced control strategies, active adjustment of the primary mirror alignment, and technologies associated with optical sensing.

  5. LDR structural experiment definition

    Science.gov (United States)

    Russell, Richard A.; Gates, Richard M.

    1988-01-01

    A study was performed to develop the definition of a structural flight experiment for a large precision segmented reflector that would utilize the Space Station. The objective of the study was to use the Large Deployable Reflector (LDR) baseline configuration for focusing on experiment definition activity which would identify the Space Station accommodation requirements and interface constraints. Results of the study defined three Space Station based experiments to demonstrate the technologies needed for an LDR type structure. The basic experiment configurations are the same as the JPL baseline except that the primary mirror truss is 10 meters in diameter instead of 20. The primary objectives of the first experiment are to construct the primary mirror support truss and to determine its structural and thermal characteristics. Addition of the optical bench, thermal shield and primary mirror segments and alignment of the optical components occur on the second experiment. The structure will then be moved to the payload pointing system for pointing, optical control and scientific optical measurement for the third experiment.

  6. Visual Narrative Structure

    Science.gov (United States)

    Cohn, Neil

    2013-01-01

    Narratives are an integral part of human expression. In the graphic form, they range from cave paintings to Egyptian hieroglyphics, from the Bayeux Tapestry to modern day comic books (Kunzle, 1973; McCloud, 1993). Yet not much research has addressed the structure and comprehension of narrative images, for example, how do people create meaning out…

  7. Reactor core structure

    International Nuclear Information System (INIS)

    Higashinakagawa, Emiko; Sato, Kanemitsu.

    1992-01-01

    Taking notice on the fact that Fe based alloys and Ni based alloys are corrosion resistant in a special atmosphere of a nuclear reactor, Fe or Ni based alloys are applied to reactor core structural components such as fuel cladding tubes, fuel channels, spacers, etc. On the other hand, the neutron absorption cross section of zirconium is 0.18 barn while that of iron is 2.52 barn and that of nickel is 4.6 barn, which amounts to 14 to 25 times compared with that of zirconium. Accordingly, if the reactor core structural components are constituted by the Fe or Ni based alloys, neutron economy is lowered. Since it is desirable that neutrons contribute to uranium fission with least absorption to the reactor core structural components, the reactor core structural components are constituted with the Fe or Ni based alloys of good corrosion resistance only at a portion in contact with reactor water, that is, at a surface portion, while the main body is constituted with zircalloy in the present invention. Accordingly, corrosion resistnace can be kept while keeping small neutron absorption cross section. (T.M.)

  8. Manipulating Combinatorial Structures.

    Science.gov (United States)

    Labelle, Gilbert

    This set of transparencies shows how the manipulation of combinatorial structures in the context of modern combinatorics can easily lead to interesting teaching and learning activities at every level of education from elementary school to university. The transparencies describe: (1) the importance and relations of combinatorics to science and…

  9. Structural Equation Model Trees

    Science.gov (United States)

    Brandmaier, Andreas M.; von Oertzen, Timo; McArdle, John J.; Lindenberger, Ulman

    2013-01-01

    In the behavioral and social sciences, structural equation models (SEMs) have become widely accepted as a modeling tool for the relation between latent and observed variables. SEMs can be seen as a unification of several multivariate analysis techniques. SEM Trees combine the strengths of SEMs and the decision tree paradigm by building tree…

  10. Structural Stator Spacers

    DEFF Research Database (Denmark)

    Rasmussen, Peter Omand; Andreasen, Jens H.; Pijanowski, J. M.

    2001-01-01

    This paper presents a powerful new design aspect to reduce acoustic noise and vibration of electro-magnetic origin for electrical machines, by introducing improved slot wedges referred to as "Structural Stator Spacers". These spacers, by using a very stiff dielectric and non magnetic material...

  11. Simulation of phase structures

    International Nuclear Information System (INIS)

    Lawson, J.

    1995-01-01

    This memo outlines a procedure developed by the author to extract information from phase measurements and produce a simulated phase structure for use in modeling optical systems, including characteristic optics for the Beamlet and NIF laser systems. The report includes an IDL program listing

  12. Organisational Structures & Considerations

    NARCIS (Netherlands)

    Luiijf, H.A.M.; Healey, J.

    2012-01-01

    The purpose of this section is to review specific types of national cyber security (NCS) areas (also called ‘mandates’) and examine the organisational and collaborative models associated with them. Before discussing the wide variety of organisational structures at the national and international

  13. Reliability based structural design

    NARCIS (Netherlands)

    Vrouwenvelder, A.C.W.M.

    2014-01-01

    According to ISO 2394, structures shall be designed, constructed and maintained in such a way that they are suited for their use during the design working life in an economic way. To fulfil this requirement one needs insight into the risk and reliability under expected and non-expected actions. A

  14. Structure from interaction events

    NARCIS (Netherlands)

    de Nooy, W.

    2015-01-01

    In this contribution to the colloquium, I argue why and how I lost interest in the overall structure of social networks even though Big Data techniques are increasingly simplifying the collection, organisation, and analysis of ever larger networks. The challenge that Big Data techniques pose to the

  15. Odd Structures Are Odd

    Czech Academy of Sciences Publication Activity Database

    Markl, Martin

    2017-01-01

    Roč. 27, č. 2 (2017), s. 1567-1580 ISSN 0188-7009 Institutional support: RVO:67985840 Keywords : graded vector space * monoidal structure * Odd endomorphism operad Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.643, year: 2016 http://link.springer.com/article/10.1007%2Fs00006-016-0720-8

  16. Capital Structure and Assets

    DEFF Research Database (Denmark)

    Flor, Christian Riis

    2008-01-01

    This paper analyzes a firm's capital structure choice when assets have outside value. Valuable assets implicitly provide a collateral and increase tax shield exploitation. The key feature in this paper is asset value uncertainty, implying that it is unknown ex ante whether the equity holders ex p...

  17. Heavy ion accelerating structure

    International Nuclear Information System (INIS)

    Pottier, Jacques.

    1977-01-01

    The heavy ion accelerating structure concerned in this invention is of the kind that have a resonance cavity inside which are located at least two longitudinal conducting supports electrically connected to the cavity by one of their ends in such a way that they are in quarter-wavelength resonance and in phase opposition. Slide tubes are electrically connected alternatively to one or the other of the two supports, they being electrically connected respectively to one or the other end of the side wall of the cavity. The feature of the structure is that it includes two pairs of supports symmetrically placed with respect to the centre line of the cavity, the supports of one pair fitted overhanging being placed symmetrically with respect to the centre line of the cavity, each slide tube being connected to the two supports of one pair. These support are connected to the slide wall of the cavity by an insulator located at their electrically free end. The accelerator structure composed of several structures placed end to end, the last one of which is fed by a high frequency field of adjustable amplitude and phase, enables a heavy ion linear accelerator to be built [fr

  18. Bridgescaping - Contextual Structural Design

    DEFF Research Database (Denmark)

    Bjerregaard Jensen, Lotte; Almegaard, Henrik

    2011-01-01

    Large-scale infrastructural projects such as bridges used to be the monopoly of engineers. They were designed as – often very beautiful – expressions of how forces work in a structure, guided by the nature of materials and a rational construction process. However, in recent decades politicians an...

  19. Market structures in international telecommunications

    DEFF Research Database (Denmark)

    Henten, Anders

    1998-01-01

    Paper dealing with the internationalisation of telecommunications and the developing market structures.......Paper dealing with the internationalisation of telecommunications and the developing market structures....

  20. Structural optimization of free-form reciprocal structures

    DEFF Research Database (Denmark)

    Parigi, Dario

    2014-01-01

    This paper presents an optimization algorithm for the design of structurally efficient free-form reciprocal structures. Because of the geometric complexity of reciprocal structures, only a few structural studies have been carried out so far, and we have a limited knowledge of the relation between...

  1. Soil Retaining Structures : Development of models for structural analysis

    NARCIS (Netherlands)

    Bakker, K.J.

    2000-01-01

    The topic of this thesis is the development of models for the structural analysis of soil retaining structures. The soil retaining structures being looked at are; block revetments, flexible retaining walls and bored tunnels in soft soil. Within this context typical structural behavior of these

  2. Robustness Analyses of Timber Structures

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Sørensen, John Dalsgaard; Hald, Frederik

    2013-01-01

    The robustness of structural systems has obtained a renewed interest arising from a much more frequent use of advanced types of structures with limited redundancy and serious consequences in case of failure. In order to minimise the likelihood of such disproportionate structural failures, many mo...... with respect to robustness of timber structures and will discuss the consequences of such robustness issues related to the future development of timber structures.......The robustness of structural systems has obtained a renewed interest arising from a much more frequent use of advanced types of structures with limited redundancy and serious consequences in case of failure. In order to minimise the likelihood of such disproportionate structural failures, many...... modern building codes consider the need for the robustness of structures and provide strategies and methods to obtain robustness. Therefore, a structural engineer may take necessary steps to design robust structures that are insensitive to accidental circumstances. The present paper summaries issues...

  3. Analysis of Pumphouse RCC Frame Structure for Soil Structure Interaction

    OpenAIRE

    Mr A.S. Thombare; Prof. V.P. Kumbhar; Prof. A.H. Kumbhar

    2016-01-01

    When structure is built on ground some elements of structure are direct contact with soil. When loads are applied on structure internal forces are developed in both the structure as well as in soil. It results in deformation of both the components which are independent to each other. This are called soil structure interaction. The analysis is done by using (Bentley STAAD.Pro V8i Version 2007) software. The analysis carried out been pump house structure R.C.C. frame structure find ...

  4. Generative Moire Structures

    Directory of Open Access Journals (Sweden)

    Adrian – Mihail Marian

    2006-01-01

    Full Text Available “GRAPHIC ON COMPUTER” – the work of the Czech Petar Milojevic, published in Titus Mocanu’s book “THE MODERN ART’S MORPHOLOGY”, in 1973, had great influence on me. I tried to discover the algorithm that generated this work. It was not so difficult to do and in a short time I was able to draw 12 such structures. In time, with interruptions, I have returned to this kind of works. In my personal exhibition “CYBERNETIC DESIGN” that took place at “M4-1-13-etopa” gallery of Pitesti, in March 1981, I have presented 8 such structures. To my joy, they had an impact on art lovers.

  5. Patchworking Network Structures

    DEFF Research Database (Denmark)

    Norus, Jesper

    2004-01-01

    analyzes fourdifferent managerial strategies of how to create network structures to deal with theinterfaces between industry, university and public institutions. The research-orientedstrategy, the incubator strategy, the industrial-partnering strategy, and the policyorientedstrategy. The research...... groups has been treated as a contingent factor.However, little attention has been given to the managerial efforts that entrepreneurshave make to establish the fit between small firms, university research, and publicpolicies such as regulatory policies and R&D policies through network-type structures.......New biotechnology organizations are perfect objects to study these relationshipsbecause new biotechnologies and techniques predominantly come from the universitysector (Kenney, 1986; Yoxen; 1984; Zucker & Darby, 1997; Robbins-Roth, 2001).From the perspective of the small biotechnology firms (SBFs,) this paper...

  6. Structural amorphous steels

    International Nuclear Information System (INIS)

    Lu, Z.P.; Liu, C.T.; Porter, W.D.; Thompson, J.R.

    2004-01-01

    Recent advancement in bulk metallic glasses, whose properties are usually superior to their crystalline counterparts, has stimulated great interest in fabricating bulk amorphous steels. While a great deal of effort has been devoted to this field, the fabrication of structural amorphous steels with large cross sections has remained an alchemist's dream because of the limited glass-forming ability (GFA) of these materials. Here we report the discovery of structural amorphous steels that can be cast into glasses with large cross-section sizes using conventional drop-casting methods. These new steels showed interesting physical, magnetic, and mechanical properties, along with high thermal stability. The underlying mechanisms for the superior GFA of these materials are discussed

  7. Radiation shielding wall structure

    International Nuclear Information System (INIS)

    Nishimura, Yoshitaka; Oka, Shinji; Kan, Toshihiko; Misato, Takeshi.

    1990-01-01

    A space between a pair of vertical steel plates laterally disposed in parallel at an optional distance has a structure of a plurality of vertically extending tranks partitioned laterally by vertically placed steel plates. Then, cements are grouted to the tranks. Strip-like steel plates each having a thickness greater than the gap between the each of the vertically placed steel plates and the cement are bonded each at the surface for each of the vertically placed steel plates opposing to the cements. A protrusion of a strip width having radiation shielding performance substantially identical with that by the thickness of the cement is disposed in the strip-like steel plates. With such a constitution, a safety radiation shielding wall structure with no worry of radiation intrusion to gaps, if formed, between the steel plates and the grouted cements due to shrinkage of the cements. (I.N.)

  8. Diagnosable structured logic array

    Science.gov (United States)

    Whitaker, Sterling (Inventor); Miles, Lowell (Inventor); Gambles, Jody (Inventor); Maki, Gary K. (Inventor)

    2009-01-01

    A diagnosable structured logic array and associated process is provided. A base cell structure is provided comprising a logic unit comprising a plurality of input nodes, a plurality of selection nodes, and an output node, a plurality of switches coupled to the selection nodes, where the switches comprises a plurality of input lines, a selection line and an output line, a memory cell coupled to the output node, and a test address bus and a program control bus coupled to the plurality of input lines and the selection line of the plurality of switches. A state on each of the plurality of input nodes is verifiably loaded and read from the memory cell. A trusted memory block is provided. The associated process is provided for testing and verifying a plurality of truth table inputs of the logic unit.

  9. Socio-Technical Structure

    DEFF Research Database (Denmark)

    Rose, Jeremy; Lindgren, Rikard; Henfridsson, Ole

    2004-01-01

    a reference discipline in its own right (in other words a theory exporter), this paper offers an example of integrative theory development. Instead of adapting a theory from another discipline or building a theory from empirical data, we examine the structure concept in some of its various theoretical......When it comes to investigating the relationship between the social and the technical, IS has been a net importer of theories. These theories often carry differing interpretations of central concepts, which then become both confusing and difficult to integrate. In response to calls for IS to become...... adaptations in IS and try to integrate them to produce theory that focuses on IS concerns whilst resolving some of the major areas of contention. Both social and technological versions of structure are investigated through three theoretical IS perspectives drawn from different reference disciplines. The first...

  10. Electronic band structure

    International Nuclear Information System (INIS)

    Grosso, G.

    1986-01-01

    The aim of this chapter is to present, in detail, some theoretical methods used to calculate electronic band structures in crystals. The basic strategies employed to attack the problem of electronic-structure calculations are presented. Successive sections present the basic formulations of the tight-binding, orthogonalized-plane-wave, Green'sfunction, and pseudopotential methods with a discussion of their application to perfect solids. Exemplifications in the case of a few selected problems provide further insight by the author into the physical aspects of the different methods and are a guide to the use of their mathematical techniques. A discussion is offered of completely a priori Hartree-Fock calculations and attempts to extend them. Special aspects of the different methods are also discussed in light of recently published related work

  11. Pairing in hadron structure

    International Nuclear Information System (INIS)

    Chela-Flores, J.

    1981-08-01

    A many-body approach to hadron structure is presented, in which we consider two parton species: spin-0 (b-partons), and spin-1/2 (f-partons). We extend a boson and a fermion pairing scheme for the b-, and f-partons respectively, into a Yang-Mills gauge theory. The main feature of this theory is that the gauge field is not identified with the usual gluon field variable in QCD. We study the confinement problem of the hadron constituents, and obtain, for low temperatures, partons that are confined by energy gaps. As the critical temperatures for the corresponding phase transitions are approached, the energy gap gradually disappears, and confinement is lost. The theory goes beyond the non-relativistic harmonic oscillator quark model, in the sense of giving physical reasons why a non-relativistic approximation is adequate in describing the internal dynamics of hadron structure. (author)

  12. Sparse structure regularized ranking

    KAUST Repository

    Wang, Jim Jing-Yan

    2014-04-17

    Learning ranking scores is critical for the multimedia database retrieval problem. In this paper, we propose a novel ranking score learning algorithm by exploring the sparse structure and using it to regularize ranking scores. To explore the sparse structure, we assume that each multimedia object could be represented as a sparse linear combination of all other objects, and combination coefficients are regarded as a similarity measure between objects and used to regularize their ranking scores. Moreover, we propose to learn the sparse combination coefficients and the ranking scores simultaneously. A unified objective function is constructed with regard to both the combination coefficients and the ranking scores, and is optimized by an iterative algorithm. Experiments on two multimedia database retrieval data sets demonstrate the significant improvements of the propose algorithm over state-of-the-art ranking score learning algorithms.

  13. Resource Structuring and Ambidexterity

    DEFF Research Database (Denmark)

    Ma, Yucheng; Li, Peter Ping

    -shaped effect on organizational ambidexterity in new ventures. Further, because of the traditional culture and economic transition characteristics, new ventures actively leverage managerial ties as key social relations to obtain special resources or nurture business transactions. We propose that ties with other......Focusing on how resource structuring mechanisms and managerial ties influence organizational ambidexterity of new ventures in emerging economy, this study explores the effects of resource structuring mechanisms (i.e., resource acquiring and resource accumulating) on organizational ambidexterity....... It further examines the moderating effects of managerial ties, (i.e., ties with other firms and ties with the government) on the above relationships. Survey data from China¡¯s 202 new ventures demonstrates that the resource acquiring has an inverted U-shaped effect whereas the resource accumulating has a U...

  14. Structure of potato starch

    DEFF Research Database (Denmark)

    Bertoft, Eric; Blennow, Andreas

    2016-01-01

    Potato starch granules consist primarily of two tightly packed polysaccharides, amylose and amylopectin. Amylose, which amount for 20-30%, is the principal linear component, but a fraction is in fact slightly branched. Amylopectin is typically the major component and is extensively branched...... chains extending from the clusters. A range of enzymes is involved in the biosynthesis of the cluster structures and linear segments. These are required for sugar activation, chain elongation, branching, and trimming of the final branching pattern. As an interesting feature, potato amylopectin...... is substituted with low amounts of phosphate groups monoesterified to the C-3 and the C-6 carbons of the glucose units. They seem to align well in the granular structure and have tremendous effects on starch degradation in the potato and functionality of the refined starch. A specific dikinase catalyzes...

  15. Air cathode structure manufacture

    Science.gov (United States)

    Momyer, William R.; Littauer, Ernest L.

    1985-01-01

    An improved air cathode structure for use in primary batteries and the like. The cathode structure includes a matrix active layer, a current collector grid on one face of the matrix active layer, and a porous, nonelectrically conductive separator on the opposite face of the matrix active layer, the collector grid and separator being permanently bonded to the matrix active layer. The separator has a preselected porosity providing low IR losses and high resistance to air flow through the matrix active layer to maintain high bubble pressure during operation of the battery. In the illustrated embodiment, the separator was formed of porous polypropylene. A thin hydrophobic film is provided, in the preferred embodiment, on the current collecting metal grid.

  16. Manipulating structured light

    CSIR Research Space (South Africa)

    Dudley, Angela

    2016-07-01

    Full Text Available SINGULARITY ZERO INTENSITY GAUSSIAN BEAM LAGUERRE-GAUSSIAN BEAM u(r,θ,z) = u0(r,z)exp(ilθ) Our favorite structured light field – has a helical wavefront 10/10/2016 6 Many unique measurement techniques are available for structured light NJP 13, 093014 (2011...). PRL 105(15), 153601 (2010).Nature 412, 314-316 (2001). PRL 105(5), 053904 (2010). PRL 88(25), 257901 (2002). 6? � � � ��Ψ� � �� c1 c2 c3 ∫ ∫ Ψ=Ψ== dxdyUUic nnnnn * ,)exp( φρ Create these modesPerform this integral Modal decomposition expands...

  17. Radio structure in quasars

    International Nuclear Information System (INIS)

    Barthel, P.D.

    1984-01-01

    In this thesis, observational attention is given to the extended extragalactic radio sources associated with quasars. The isolated compact radio sources, often identified with quasars, are only included in the discussions. Three aspects of the radio structure in quasars and their cosmic evolution are considered: a study of the parsec scale morphology in quasar cores, in relation to the extended morphologies; an investigation of possible epoch dependent hotspot properties as well as a more detailed investigation of this fine scale structure; a VLA project was carried out to obtain morphological information on scales of 0.5 arcsec on high redshift quasars and to investigate possible epoch dependent morphological properties. MERLIN observations at 0.1 arcsec resolution to supplement the VLA data were initiated. (Auth.)

  18. The Structured Assessment Dialogue

    DEFF Research Database (Denmark)

    Dolin, Jens; Bruun, Jesper; Nielsen, Sanne Schnell

    2018-01-01

    The two key purposes of assessment, formative and summative, are often in a contradictory position if they are used concurrently. The summative assessment of learning will often prevent the formative assessment for learning to be realised (Butler, J Educ Psychol 79(4):474, 1987), meaning...... assessment method involving three distinct phases: A 5-min student-teacher dialogue, a 5-min peer feedback phase and finally 2–3-min of student self-reflection. We describe the rationales for the SAD and analyse results from classroom implementations in Denmark and Finland. First, using focus group interview...... that the learning potential of the assessment will often be minimal. It is therefore a central challenge to find ways to combine the dual use of assessment. The structured assessment dialogue (SAD) is a candidate for such a combination. This chapter introduces the structured assessment dialogue – a short ritualised...

  19. Structural analysis of DAEs

    DEFF Research Database (Denmark)

    Poulsen, Mikael Zebbelin

    2002-01-01

    , by the implementation of the Simpy tool box. This is an object oriented system implemented in the Python language. It can be used for analysis of DAEs, ODEs and non-linear equation and uses e.g. symbolic representations of expressions and equations. The presentations of theory and algorithms for structural index......Differential algebraic equations (DAEs) constitute a fundamental model class for many modelling purposes in engineering and other sciences, especially for dynamical simulation of component based systems. This thesis describes a practical methodology and approach for analysing general DAE...... analysis of DAE is original in the sense that it is based on a new matrix representation of the structural information of a general DAE system instead of a graph oriented representation. Also the presentation of the theory is found to be more complete compared to other presentations, since it e.g. proves...

  20. Risk evaluation for structures

    International Nuclear Information System (INIS)

    Freudenthal, A.M.; Schueller, G.I.

    1976-01-01

    The basic principles of the risk analysis, which is based on classical statistics is discussed. The significance of the Asymptotic (Extreme Value) distributions as well as the method of basing the level of acceptable risk on economical optimization procedures is pointed out. The application of the risk analysis to special type structures such as fixed offshore platforms, television towers, reactor containments and the reliability of reactor components under creep and fatigue load is elaborated by carrying out numerical examples. (orig./HP) [de

  1. Integrated circuit structure

    International Nuclear Information System (INIS)

    1981-01-01

    The invention describes the fabrication of integrated circuit structures, such as read-only memory components of field-effect transistors, which may be fabricated and then maintained in inventory, and later selectively modified in accordance with a desired pattern. It is claimed that MOS depletion-mode devices in accordance with the invention can be fabricated at lower cost and at higher yields. (U.K.)

  2. The multidimensional nucleon structure

    Directory of Open Access Journals (Sweden)

    Pasquini Barbara

    2016-01-01

    Full Text Available We discuss different kinds of parton distributions, which allow one to obtain a multidimensional picture of the internal structure of the nucleon. We use the concept of generalized transverse momentum dependent parton distributions and Wigner distributions, which combine the features of transverse-momentum dependent parton distributions and generalized parton distributions. We show examples of these functions within a phenomenological quark model, with focus on the role of the spin-spin and spin-orbit correlations of quarks.

  3. Structural systems reliability analysis

    International Nuclear Information System (INIS)

    Frangopol, D.

    1975-01-01

    For an exact evaluation of the reliability of a structure it appears necessary to determine the distribution densities of the loads and resistances and to calculate the correlation coefficients between loads and between resistances. These statistical characteristics can be obtained only on the basis of a long activity period. In case that such studies are missing the statistical properties formulated here give upper and lower bounds of the reliability. (orig./HP) [de

  4. Birefringent phononic structures

    Directory of Open Access Journals (Sweden)

    I. E. Psarobas

    2014-12-01

    Full Text Available Within the framework of elastic anisotropy, caused in a phononic crystal due to low crystallographic symmetry, we adopt a model structure, already introduced in the case of photonic metamaterials, and by analogy, we study the effect of birefringence and acoustical activity in a phononic crystal. In particular, we investigate its low-frequency behavior and comment on the factors which determine chirality by reference to this model.

  5. Stereochemistry Structure of Odonicin

    Energy Technology Data Exchange (ETDEWEB)

    Li, Bao Lin; Li, Jin; Tong, Ling [Shaanxi Normal University, Xian (China); Pan, Yuan Jiang [Zhejiang University, Hangzhou (China); Yu, Kai Bei [Academia Sinica, Chengdu (China)

    2004-02-15

    Ent-kaurene diterpenoids have various biological activities, such as antitumor, antibacterial, anti-HIV activities etc. The plant of the genus Isodon used in Chinese traditional medicine is a major source of compounds of this structural class. Our investigations on the bitter diterpenoids constituents of the genus Isodon led to the first isolation of odonicin (1) from the leaves and tender branches of Isodon henryi obtained from Taibai Mountain, Shaanxi Province, P. R. China

  6. Foams structure and dynamics

    CERN Document Server

    Cantat, Isabelle; Graner, François; Pitois, Olivier; Höhler, Reinard; Elias, Florence; Saint-Jalmes, Arnaud; Rouyer, Florence

    2013-01-01

    This book is the first to provide a thorough description of all aspects of the physico-chemical properties of foams. It sets out what is known about their structure, their stability, and their rheology. Engineers, researchers and students will find descriptions of all the key concepts, illustrated by numerous applications, as well as experiments and exercises for the reader. A solutions manual for lecturers is available via the publisher's web site.

  7. Design bases - Concrete structures

    International Nuclear Information System (INIS)

    Diaz-Llanos Ros, M.

    1993-01-01

    The most suitable title for Section 2 is 'Design Bases', which covers not only calculation but also the following areas: - Structural design concepts. - Project criteria. - Material specifications. These concepts are developed in more detail in the following sections. The numbering in this document is neither complete nor hierarchical since, for easier cross referencing, it corresponds to the paragraphs of Eurocode 2 Part 1 (hereinafter 'EUR-2') which are commented on. (author)

  8. Hierarchically Structured Electrospun Fibers

    Science.gov (United States)

    2013-01-07

    in the natural lotus and silver ragwort leaves. Figure 4. Examples of electrospun bio-mimics of natural hierarchical structures. (A) Lotus leaf...B) pillared poly(methyl methacrylate) (PMMA) electrospun fiber mimic; (C) silver ragwort leaf; (D) electrospun fiber mimic made from nylon 6 and...domains containing the protein in the surrounding EVA fibers [115]. A wide variety of core-shell fibers have been generated, including PCL/ gelatin

  9. Neutron structural biology

    International Nuclear Information System (INIS)

    Schoenborn, B.

    1997-01-01

    This is the final report of a one-year, Laboratory Directed Research and Development (LDRD) project at Los Alamos National Laboratory (LANL). We investigated design concepts of neutron scattering capabilities for structural biology at spallation sources. This included the analysis of design parameters for protein crystallography as well as membrane diffraction instruments. These instruments are designed to be general user facilities and will be used by scientists from industry, universities, and other national laboratories

  10. Stellar structure and evolution

    International Nuclear Information System (INIS)

    Kippernhahn, R.; Weigert, A.

    1990-01-01

    This book introduces the theory of the internal structure of stars and their evolution in time. It presents the basic physics of stellar interiors, methods for solving the underlying equations, and the most important results necessary for understanding the wide variety of stellar types and phenomena. The evolution of stars is discussed from their birth through normal evolution to possibly spectacular final stages. Chapters on stellar oscillations and rotation are included

  11. Discrete computational structures

    CERN Document Server

    Korfhage, Robert R

    1974-01-01

    Discrete Computational Structures describes discrete mathematical concepts that are important to computing, covering necessary mathematical fundamentals, computer representation of sets, graph theory, storage minimization, and bandwidth. The book also explains conceptual framework (Gorn trees, searching, subroutines) and directed graphs (flowcharts, critical paths, information network). The text discusses algebra particularly as it applies to concentrates on semigroups, groups, lattices, propositional calculus, including a new tabular method of Boolean function minimization. The text emphasize

  12. Wetting on structured substrates

    International Nuclear Information System (INIS)

    Dietrich, S; Popescu, M N; Rauscher, M

    2005-01-01

    Chemically patterned surfaces are of significant interest in the context of microfluidic applications, and miniaturization of such devices aims at generating structures on the nano-scale. Whereas on the micron scale purely macroscopic descriptions of liquid flow are valid, on the nanometre scale long-ranged inter-molecular interactions, thermal fluctuations such as capillary waves, and finally the molecular structure of the liquid become important. We discuss the most important conceptual differences between flow on chemically patterned substrates on the micron scale and on the nanometre scale, and formulate four design issues for nanofluidics related to channel width, channel separation, and channel bending radius. As a specific example of nano-scale transport we present a microscopic model for the dynamics of spreading of monolayers on homogeneous substrates. Kinetic Monte Carlo simulations of this model on a homogeneous substrate reveal a complex spatio-temporal structure of the extracted monolayer, which includes the emergence of interfaces and of scaling properties of density profiles. These features are discussed and rationalized within the corresponding continuum limit derived from the microscopic dynamics. The corresponding spreading behaviour on a patterned substrate is briefly addressed

  13. Quaternary structure of methemoglobin

    International Nuclear Information System (INIS)

    Chevion, M.; Ilan, Y.A.; Samuni, A.; Navok, T.; Czapski, G.

    1979-01-01

    The pulse radiolysis of solutions of adult human methemoglobin was used to reduce a single heme iron within the protein tetramers. The valence hybrids thus formed were reacted with oxygen. Kinetics of the reactions were studied. The effects of pH and inositol hexaphosphate were examined. The kinetics of the ligation of oxygen to stripped valence hybrids showed a single phase behavior at the pH range 6.5 to 9. As the pH was lowered below 6.5, a second, slower phase became apparent. In the presence of inositol hexaphosphate, above pH 8, the kinetics of oxygen binding was of a single phase. As the pH was lowered, a transition to a second, slower phase was noticed. Below pH 7, the slower phase was the only detectable one. On this basis, it is concluded that human adult stripped methemoglobin resides in an R quarternary structure, while the presence of IHP stabilizes the T structure at pH below 7.5. This transition between the quaternary structures of methemoglobin cannot be accounted for by the switch between the high spin and the low spin states of the ferric iron. This switch of spin state takes place at pH>8.2

  14. Classifications of track structures

    International Nuclear Information System (INIS)

    Paretzke, H.G.

    1984-01-01

    When ionizing particles interact with matter they produce random topological structures of primary activations which represent the initial boundary conditions for all subsequent physical, chemical and/or biological reactions. There are two important aspects of research on such track structures, namely their experimental or theoretical determination on one hand and the quantitative classification of these complex structures which is a basic pre-requisite for the understanding of mechanisms of radiation actions. This paper deals only with the latter topic, i.e. the problems encountered in and possible approaches to quantitative ordering and grouping of these multidimensional objects by their degrees of similarity with respect to their efficiency in producing certain final radiation effects, i.e. to their ''radiation quality.'' Various attempts of taxonometric classification with respect to radiation efficiency have been made in basic and applied radiation research including macro- and microdosimetric concepts as well as track entities and stopping power based theories. In this paper no review of those well-known approaches is given but rather an outline and discussion of alternative methods new to this field of radiation research which have some very promising features and which could possibly solve at least some major classification problems

  15. Structural load combinations

    International Nuclear Information System (INIS)

    Hwang, H.; Reich, M.; Ellingwood, B.; Shinozuka, M.

    1985-01-01

    This paper presents the latest results of the program entitled, ''Probability Based Load Combinations For Design of Category I Structures''. In FY 85, a probability-based reliability analysis method has been developed to evaluate safety of shear wall structures. The shear walls are analyzed using stick models with beam elements and may be subjected to dead load, live load and in-plane eqrthquake. Both shear and flexure limit states are defined analytically. The limit state probabilities can be evaluated on the basis of these limit states. Utilizing the reliability analysis method mentioned above, load combinations for the design of shear wall structures have been established. The proposed design criteria are in the load and resistance factor design (LRFD) format. In this study, the resistance factors for shear and flexure and load factors for dead and live loads are preassigned, while the load factor for SSE is determined for a specified target limit state probability of 1.0 x 10 -6 or 1.0 x 10 -5 during a lifetime of 40 years. 23 refs., 9 tabs

  16. Hypersonic Materials and Structures

    Science.gov (United States)

    Glass, David E.

    2016-01-01

    Thermal protection systems (TPS) and hot structures are required for a range of hypersonic vehicles ranging from ballistic reentry to hypersonic cruise vehicles, both within Earth's atmosphere and non-Earth atmospheres. The focus of this presentation is on air breathing hypersonic vehicles in the Earth's atmosphere. This includes single-stage to orbit (SSTO), two-stage to orbit (TSTO) accelerators, access to space vehicles, and hypersonic cruise vehicles. This paper will start out with a brief discussion of aerodynamic heating and thermal management techniques to address the high heating, followed by an overview of TPS for rocket-launched and air-breathing vehicles. The argument is presented that as we move from rocket-based vehicles to air-breathing vehicles, we need to move away from the insulated airplane approach used on the Space Shuttle Orbiter to a wide range of TPS and hot structure approaches. The primary portion of the paper will discuss issues and design options for CMC TPS and hot structure components, including leading edges, acreage TPS, and control surfaces. The current state-of-the-art will be briefly discussed for some of the components.

  17. STRUCTURED CLINICAL EVALUATION

    Directory of Open Access Journals (Sweden)

    Arabela Maria Barbosa Sampaio

    2014-05-01

    Full Text Available In a world experiencing profound technological and socio-political changes in areas of knowledge and capacity, healthcare can not remain static. A new kind of professional is required, whose practice is based on ethics, scientific standards, integrity, citizenship, and health promotion, who develops skills beyond healthcare, such as decision making, communication,leadership, management, and continuing education. No single method can assess all of these elements (knowledge, skills, and attitudes, and only a combination of methods is able to produce a valid evaluation. An alternative method exists: structured clinical assessments based on observation of "to do, or how to do" that aim to complete this evaluation by focusing attention on the performance of specific skills. In order to broaden the scope of evaluation methods that have been used in health education, this article, a literature review, intends to offer readers an overview of the diverse types of structured clinical evaluation, emphasizing Objective Structured Clinical Examination, the most widely used in Brazil, with a goal of advancing opportunities for health professionals to make use of this evaluative tool.

  18. Visual narrative structure.

    Science.gov (United States)

    Cohn, Neil

    2013-04-01

    Narratives are an integral part of human expression. In the graphic form, they range from cave paintings to Egyptian hieroglyphics, from the Bayeux Tapestry to modern day comic books (Kunzle, 1973; McCloud, 1993). Yet not much research has addressed the structure and comprehension of narrative images, for example, how do people create meaning out of sequential images? This piece helps fill the gap by presenting a theory of Narrative Grammar. We describe the basic narrative categories and their relationship to a canonical narrative arc, followed by a discussion of complex structures that extend beyond the canonical schema. This demands that the canonical arc be reconsidered as a generative schema whereby any narrative category can be expanded into a node in a tree structure. Narrative "pacing" is interpreted as a reflection of various patterns of this embedding: conjunction, left-branching trees, center-embedded constituencies, and others. Following this, diagnostic methods are proposed for testing narrative categories and constituency. Finally, we outline the applicability of this theory beyond sequential images, such as to film and verbal discourse, and compare this theory with previous approaches to narrative and discourse. Copyright © 2012 Cognitive Science Society, Inc.

  19. Aseismatic supporting structures

    International Nuclear Information System (INIS)

    Ogasawara, Hideo; Tachi, Yasuo

    1988-01-01

    As one of the large subjects for putting FBRs to practical use, the increase of the economical efficiency is pointed out, and for this purpose, the reduction of the construction cost by the simplification of system and the rationalization of equipment structures becomes an important target of development. The operational condition of FBR cooling system is high temperature above 500 deg C at core exit, and low pressure below 6 kg-cm 2 g. Consequently, the effect of earthquake load in the structural strength design is relatively large, accordingly the reduction of earthquake load is effective from the viewpoint of structural rationalization. Hitachi Ltd. considered that earthquake isolation is an effective means to reduce earthquake response, and has examined the effect and feasibility of introducing earthquake isolation into FBR plants for three years from 1984. In this study, the mechanical characteristics and endurance of the system suitable to the earthquake isolation of FBRs were examined, the effect of reducing earthquake response by earthquake isolation was grasped, and the effect of plant rationalization brought about by the reduction of earthquake input was examined. The summary of these studies is shown. (Kako, I.)

  20. Corneal structure and transparency

    Science.gov (United States)

    Meek, Keith M.; Knupp, Carlo

    2015-01-01

    The corneal stroma plays several pivotal roles within the eye. Optically, it is the main refracting lens and thus has to combine almost perfect transmission of visible light with precise shape, in order to focus incoming light. Furthermore, mechanically it has to be extremely tough to protect the inner contents of the eye. These functions are governed by its structure at all hierarchical levels. The basic principles of corneal structure and transparency have been known for some time, but in recent years X-ray scattering and other methods have revealed that the details of this structure are far more complex than previously thought and that the intricacy of the arrangement of the collagenous lamellae provides the shape and the mechanical properties of the tissue. At the molecular level, modern technologies and theoretical modelling have started to explain exactly how the collagen fibrils are arranged within the stromal lamellae and how proteoglycans maintain this ultrastructure. In this review we describe the current state of knowledge about the three-dimensional stromal architecture at the microscopic level, and about the control mechanisms at the nanoscopic level that lead to optical transparency. PMID:26145225