The human MCP-2 gene (SCYA8): Cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2

Energy Technology Data Exchange (ETDEWEB)

Van Coillie, E.; Fiten, P.; Van Damme, J.; Opdenakker, G. [Univ. of Leuven (Belgium)] [and others

1997-03-01

Monocyte chemotactic proteins (MCPs) form a subfamily of chemokines that recruit leukocytes to sites of inflammation and that may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. With the use of degenerate primers that were based on CC chemokine consensus sequences, the known MIP-1{alpha}/LD78{alpha}, MCP-1, and MCP-3 genes and the previously unidentified eotaxin and MCP-2 genes were isolated from a YAC contig from human chromosome 17q11.2. The amplified genomic MCP-2 fragment was used to isolate an MCP-2 cosmid from which the gene sequence was determined. The MCP-2 gene shares with the MCP-1 and MCP-3 genes a conserved intron-exon structure and a coding nucleotide sequence homology of 77%. By Northern blot analysis the 1.0-kb MCP-2 mRNA was predominantly detectable in the small intestine, peripheral blood, heart, placenta, lung, skeletal muscle, ovary, colon, spinal cord, pancreas, and thymus. Transcripts of 1.5 and 2.4 kb were found in the testis, the small intestine, and the colon. The isolation of the MCP-2 gene from the chemokine contig localized it on YAC clones of chromosome 17q11.2, which also contain the eotaxin, MCP-1, MCP-3, and NCC-1/MCP-4 genes. The combination of using degenerate primer PCR and YACs illustrates that novel genes can efficiently be isolated from gene cluster contigs with less redundancy and effort than the isolation of novel ESTs. 42 refs., 5 figs., 2 tabs.

INE: a rice genome database with an integrated map view.

Science.gov (United States)

Sakata, K; Antonio, B A; Mukai, Y; Nagasaki, H; Sakai, Y; Makino, K; Sasaki, T

2000-01-01

The Rice Genome Research Program (RGP) launched a large-scale rice genome sequencing in 1998 aimed at decoding all genetic information in rice. A new genome database called INE (INtegrated rice genome Explorer) has been developed in order to integrate all the genomic information that has been accumulated so far and to correlate these data with the genome sequence. A web interface based on Java applet provides a rapid viewing capability in the database. The first operational version of the database has been completed which includes a genetic map, a physical map using YAC (Yeast Artificial Chromosome) clones and PAC (P1-derived Artificial Chromosome) contigs. These maps are displayed graphically so that the positional relationships among the mapped markers on each chromosome can be easily resolved. INE incorporates the sequences and annotations of the PAC contig. A site on low quality information ensures that all submitted sequence data comply with the standard for accuracy. As a repository of rice genome sequence, INE will also serve as a common database of all sequence data obtained by collaborating members of the International Rice Genome Sequencing Project (IRGSP). The database can be accessed at http://www. dna.affrc.go.jp:82/giot/INE. html or its mirror site at http://www.staff.or.jp/giot/INE.html

A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

Energy Technology Data Exchange (ETDEWEB)

Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

1996-04-15

We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

Physical mapping of the Bloom syndrome region by the identification of YAC and P1 clones from human chromosome 15 band q26.1

Energy Technology Data Exchange (ETDEWEB)

Straughen, J.; Groden, J. [Univ. of Cincinnati College of Medicine, OH (United States); Ciocci, S. [New York Blood Center, NY (United States)] [and others

1996-07-01

The gene for Bloom syndrome (BLM) has been mapped to human chromosome 15 band q26.1 by homozygosity mapping. Further refinement of the location of BLM has relied upon linkage-disequilibrium mapping and somatic intragenic recombination. In combination with these mapping approaches and to identify novel DNA markers and probes for the BLM candidate region, a contiguous representation of the 2-Mb region that contains the BLM gene was generated and is presented here. YAC and P1 clones from the region have been identified and ordered by using previously available genetic markers in the region along with newly developed sequence-tagged sites from radiation-restriction map of the 2-Mb region that allowed estimation of the distance between polymorphic microsatellite loci is also reported. This map and the DNA markers derived from it were instrumental in the recent identification of the BLM gene. 25 refs., 3 figs., 3 tabs.

Radiation hybrid mapping of human chromosome 18

International Nuclear Information System (INIS)

Francke, U.; Moon, A.J.; Chang, E.; Foellmer, B.; Strauss, B.; Haschke, A.; Chihlin Hsieh; Geigl, E.M.; Welch, S.

1990-01-01

The authors have generated a Chinese hamster V79/380-6 HPRT minus x human leukocyte hybrid cell line (18/V79) with chromosome 18 as the only human chromosome that is retained at high frequency without specific selection. Hybrid cells were selected in HAT medium, and 164 individual colonies were isolated. Of 110 colonies screened for human DNA by PCR amplification using a primer specific for human Alu repeats 67 (61%) were positive. These were expanded in culture for large-scale DNA preparations. Retesting expanded clones by PCR with Alu and LINE primers has revealed unique patterns of amplification products. In situ hybridization of biotin labelled total human DNA to metaphase spreads from various hybrids revealed the presence of one or more human DNA fragments integrated in hamster chromosomes. The authors have generated a resource that should allow the construction of a radiation map, to be compared with the YAC contig map also under construction in their laboratory

Automated integration of genomic physical mapping data via parallel simulated annealing

Energy Technology Data Exchange (ETDEWEB)

Slezak, T.

1994-06-01

The Human Genome Center at the Lawrence Livermore National Laboratory (LLNL) is nearing closure on a high-resolution physical map of human chromosome 19. We have build automated tools to assemble 15,000 fingerprinted cosmid clones into 800 contigs with minimal spanning paths identified. These islands are being ordered, oriented, and spanned by a variety of other techniques including: Fluorescence Insitu Hybridization (FISH) at 3 levels of resolution, ECO restriction fragment mapping across all contigs, and a multitude of different hybridization and PCR techniques to link cosmid, YAC, AC, PAC, and Pl clones. The FISH data provide us with partial order and distance data as well as orientation. We made the observation that map builders need a much rougher presentation of data than do map readers; the former wish to see raw data since these can expose errors or interesting biology. We further noted that by ignoring our length and distance data we could simplify our problem into one that could be readily attacked with optimization techniques. The data integration problem could then be seen as an M x N ordering of our N cosmid clones which ``intersect`` M larger objects by defining ``intersection`` to mean either contig/map membership or hybridization results. Clearly, the goal of making an integrated map is now to rearrange the N cosmid clone ``columns`` such that the number of gaps on the object ``rows`` are minimized. Our FISH partially-ordered cosmid clones provide us with a set of constraints that cannot be violated by the rearrangement process. We solved the optimization problem via simulated annealing performed on a network of 40+ Unix machines in parallel, using a server/client model built on explicit socket calls. For current maps we can create a map in about 4 hours on the parallel net versus 4+ days on a single workstation. Our biologists are now using this software on a daily basis to guide their efforts toward final closure.

Human Chromosome 21: Mapping of the chromosomes and cloning of cDNAs

Energy Technology Data Exchange (ETDEWEB)

Antonarakis, S.E.

1991-09-01

The objective of the research funded by DOE grant DE-FG02-89ER60857 from 6/15/89 to 8/31/91 was to contribute to the physical mapping of human chromosome 21 (HC21) by cloning large fragments of DNA into Yeast Artificial Chromosomes (YACs) and identify YACs that map on HC21. A total of 54 sequence tagged sites (STS) have been developed and mapped in our laboratory to HC21 and can be used as initial reference points for YAC identification and construction of overlapping clones. A small YAC library was constructed which is HC21 specific. DNA from somatic cell hybrid WAV17 or from flow-sorted HC21 was partially digested with EcoRI, ligated into vectors PJS97, PJS98, and YACs have been obtained with average size insert of more than 300 kb. This library has been deposited in D. Patterson's lab for the Joint YAC screening effort. Additional YAC libraries from ICI Pharmaceuticals or from Los Alamos National Laboratories have been screened with several STS and positive YACs have been identified. Work in progress includes screening of YAC libraries in order to construct overlapping clones, characterization of the cloning ends of YACs, characterization of additional STS and cloning of HC21 specific cDNAs. 15 refs., 2 figs., 5 tabs.

Transfer of an expression YAC into goat fetal fibroblasts by cell fusion for mammary gland bioreactor

International Nuclear Information System (INIS)

Zhang Xufeng; Wu Guoxiang; Chen, Jian-Quan; Zhang Aimin; Liu Siguo; Jiao Binghua; Cheng Guoxiang

2005-01-01

Yeast artificial chromosomes (YACs) as transgenes in transgenic animals are likely to ensure optimal expression levels. Microinjection of YACs is the exclusive technique used to produce YACs transgenic livestock so far. However, low efficiency and high cost are its critical restrictive factors. In this study, we presented a novel procedure to produce YACs transgenic livestock as mammary gland bioreactor. A targeting vector, containing the gene of interest-a human serum albumin minigene (intron 1, 2), yeast selectable marker (G418R), and mammalian cell resistance marker (neo r ), replaced the α-lactalbumin gene in a 210 kb human α-lactalbumin YAC by homogeneous recombination in yeasts. The chimeric YAC was introduced into goat fetal fibroblasts using polyethylene glycol-mediated spheroplast fusion. PCR and Southern analysis showed that intact YAC was integrated in the genome of resistant cells. Perhaps, it may offer a cell-based route by nuclear transfer to produce YACs transgenic livestock

Report of the fifth international workshop on human X chromosome mapping

Energy Technology Data Exchange (ETDEWEB)

Willard, H.F.; Cremers, F.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Schlessinger, D.

1994-12-31

A high-quality integrated genetic and physical map of the X chromosome from telomere to telomere, based primarily on YACs formatted with probes and STSs, is increasingly close to reality. At the Fifth International X Chromosome Workshop, organized by A.M. Poustka and D. Schlessinger in Heidelberg, Germany, April 24--27, 1994, substantial progress was recorded on extension and refinement of the physical map, on the integration of genetic and cytogenetic data, on attempts to use the map to direct gene searches, and on nascent large-scale sequencing efforts. This report summarizes physical and genetic mapping information presented at the workshop and/or published since the reports of the fourth International X Chromosome Workshop. The principle aim of the workshop was to derive a consensus map of the chromosome, in terms of physical contigs emphasizing the location of genes and microsatellite markers. The resulting map is presented and updates previous versions. This report also updates the list of highly informative microsatellites. The text highlights the working state of the map, the genes known to reside on the X, and the progress toward integration of various types of data.

Comparative mapping in the beige-satin region of mouse chromosome 13

Energy Technology Data Exchange (ETDEWEB)

Perou, C.M.; Pryor, R.; Kaplan, J. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)] [and others

1997-01-15

The proximal end of mouse chromosome (Chr) 13 contains regions conserved on human chromosomes 1q42-q44, 6p23-p21, and 7p22-p13. This region also contains mutations that may be models for human disease, including beige (human Chediak-Higashi syndrome). An interspecific backcross of SB/Le and Mus spretus mice was used to generate a molecular genetic linkage map of mouse chromosome 13 with an emphasis on the proximal region including beige (bg) and satin (sa). This map provides the gene order of the two phenotypic markers bg and sa relative to restriction fragment length polymorphisms and simple sequence length polymorphisms in 131 backcross animals. In parallel, we have created a physical map of the region using Nidogen (Nid) as a molecular starting point for cloning a YAC contig that was used to identify the beige gene. The physical map provides the fine-structure order of genes and anonymous DNA fragments that was not resolved by the genetic linkage mapping. The results show that the bg region of mouse Chr 13 is highly conserved on human Chr 1q42-q44 and provide a starting point for a complete functional analysis of the entire bg-sa interval. 37 refs., 4 figs., 1 tab.

Delineating Rearrangements in Single Yeast Artificial Chromosomes by Quantitative DNA Fiber Mapping

Energy Technology Data Exchange (ETDEWEB)

Weier, Heinz-Ulrich G.; Greulich-Bode, Karin M.; Wu, Jenny; Duell, Thomas

2009-09-18

Cloning of large chunks of human genomic DNA in recombinant systems such as yeast or bacterial artificial chromosomes has greatly facilitated the construction of physical maps, the positional cloning of disease genes or the preparation of patient-specific DNA probes for diagnostic purposes. For this process to work efficiently, the DNA cloning process and subsequent clone propagation need to maintain stable inserts that are neither deleted nor otherwise rearranged. Some regions of the human genome; however, appear to have a higher propensity than others to rearrange in any host system. Thus, techniques to detect and accurately characterize such rearrangements need to be developed. We developed a technique termed 'Quantitative DNA Fiber Mapping (QDFM)' that allows accurate tagging of sequence elements of interest with near kilobase accuracy and optimized it for delineation of rearrangements in recombinant DNA clones. This paper demonstrates the power of this microscopic approach by investigating YAC rearrangements. In our examples, high-resolution physical maps for regions within the immunoglobulin lambda variant gene cluster were constructed for three different YAC clones carrying deletions of 95 kb and more. Rearrangements within YACs could be demonstrated unambiguously by pairwise mapping of cosmids along YAC DNA molecules. When coverage by YAC clones was not available, distances between cosmid clones were estimated by hybridization of cosmids onto DNA fibers prepared from human genomic DNA. In addition, the QDFM technology provides essential information about clone stability facilitating closure of the maps of the human genome as well as those of model organisms.

A method for high efficiency YAC lipofection into murine embryonic stem cells.

Science.gov (United States)

Lee, J T; Jaenisch, R

1996-01-01

We describe a modified protocol for introducing yeast artificial chromosomes (YACs) into murine embryonic stem (ES) cells by lipofection. With a decreased DNA:cell ratio, increased concentration of condensing agents and altered culture conditions, this protocol reduces the requirement for YAC DNA to a few micrograms, improves the recovery of neomycin-resistant ES colonies and increases the yield of clones containing both flanking vector markers and insert. These modifications enable generation of sufficient 'intact' transgenic clones for biological analysis with a single experiment. PMID:9016681

Fine mapping of the EDA gene: A translocation breakpoint is associated with a CpG island that is transcribed

Energy Technology Data Exchange (ETDEWEB)

Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Montonen, O. [Univ. of Helsinki (Finland)] [and others

1996-01-01

In order to identify the gene for human X-linked anhidrotic ectodermal dysplasia (EDA), a translocation breakpoint in a female with t(X;1)(q13.1;p36.3) and EDA (patient AK) was finely mapped. The EDA region contains five groups of rare-cutter restriction sites that define CpG islands. The two more centromeric of these islands are associated with transcripts of 3.5 kb and 1.8 kb. The third CpG island maps within <1 kb of the translocation breakpoint in patient AK, as indicated by a genomic rearrangement, and {approximately}100 kb centromeric from another previously mapped translocation breakpoint (patient AnLy). Northern analysis with a probe from this CpG island detected an {approximately}6-kb mRNA in several fetal tissues tested. An extended YAC contig of 1,200 kb with an average of fivefold coverage was constructed. The two most telomeric CpG islands map 350 kb telomeric of the two translocations. Taken together, the results suggest that the CpG island just proximal of the AK translocation breakpoint lies at the 5{prime} end of a candidate gene for EDA. 26 refs., 4 figs., 1 tab.

Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

Energy Technology Data Exchange (ETDEWEB)

Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

1996-11-01

Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

A physical map of the heterozygous grapevine 'Cabernet Sauvignon' allows mapping candidate genes for disease resistance

Directory of Open Access Journals (Sweden)

Scalabrin Simone

2008-06-01

Full Text Available Abstract Background Whole-genome physical maps facilitate genome sequencing, sequence assembly, mapping of candidate genes, and the design of targeted genetic markers. An automated protocol was used to construct a Vitis vinifera 'Cabernet Sauvignon' physical map. The quality of the result was addressed with regard to the effect of high heterozygosity on the accuracy of contig assembly. Its usefulness for the genome-wide mapping of genes for disease resistance, which is an important trait for grapevine, was then assessed. Results The physical map included 29,727 BAC clones assembled into 1,770 contigs, spanning 715,684 kbp, and corresponding to 1.5-fold the genome size. Map inflation was due to high heterozygosity, which caused either the separation of allelic BACs in two different contigs, or local mis-assembly in contigs containing BACs from the two haplotypes. Genetic markers anchored 395 contigs or 255,476 kbp to chromosomes. The fully automated assembly and anchorage procedures were validated by BAC-by-BAC blast of the end sequences against the grape genome sequence, unveiling 7.3% of chimerical contigs. The distribution across the physical map of candidate genes for non-host and host resistance, and for defence signalling pathways was then studied. NBS-LRR and RLK genes for host resistance were found in 424 contigs, 133 of them (32% were assigned to chromosomes, on which they are mostly organised in clusters. Non-host and defence signalling genes were found in 99 contigs dispersed without a discernable pattern across the genome. Conclusion Despite some limitations that interfere with the correct assembly of heterozygous clones into contigs, the 'Cabernet Sauvignon' physical map is a useful and reliable intermediary step between a genetic map and the genome sequence. This tool was successfully exploited for a quick mapping of complex families of genes, and it strengthened previous clues of co-localisation of major NBS-LRR clusters and

A Blumeria graminis f.sp. hordei BAC library - contig building and microsynteny studies

DEFF Research Database (Denmark)

Pedersen, C.; Wu, B.; Giese, H.

2002-01-01

A bacterial artificial chromosome (BAC) library of Blumeria graminis f.sp. hordei, containing 12,000 clones with an average insert size of 41 kb, was constructed. The library represents about three genome equivalents and BAC-end sequencing showed a high content of repetitive sequences, making...... contigs, at or close to avirulence loci, were constructed. Single nucleotide polymorphism (SNP) markers were developed from BAC-end sequences to link the contigs to the genetic maps. Two other BAC contigs were used to study microsynteny between B. graminis and two other ascomycetes, Neurospora crassa...

Evaluation of Texture Profile, Color and Determination of FOS in Yacón Products (Smallanthus sonchifolius

Directory of Open Access Journals (Sweden)

Valeria Cristina Del Castillo

2016-07-01

Full Text Available Textural characteristics, color and fructooligosaccharides (FOS content, in yacón root products (syrup and dried snack subjected to different pretreatments with NaCl, blanching and ascorbic acid were evaluated. Yacón from Salta Capital, with 8 months of growth were used. Texture profiles and Color were evaluated instrumentally and FOS content by HPLC. There were significant differences between the samples treated with NaCl and the ones treated by blanching and ascorbic acid for fracture strength, fracture number and hardness according to pretreatment used, and for hardness and tackiness by the drying time. Regarding to color: longer drying time reduces sample brightness. In processed products the FOS content is lower than in fresh yacón, but higher in sucrose, glucose and fructose.

Genome-wide SNP identification by high-throughput sequencing and selective mapping allows sequence assembly positioning using a framework genetic linkage map

Directory of Open Access Journals (Sweden)

Xu Xiangming

2010-12-01

Full Text Available Abstract Background Determining the position and order of contigs and scaffolds from a genome assembly within an organism's genome remains a technical challenge in a majority of sequencing projects. In order to exploit contemporary technologies for DNA sequencing, we developed a strategy for whole genome single nucleotide polymorphism sequencing allowing the positioning of sequence contigs onto a linkage map using the bin mapping method. Results The strategy was tested on a draft genome of the fungal pathogen Venturia inaequalis, the causal agent of apple scab, and further validated using sequence contigs derived from the diploid plant genome Fragaria vesca. Using our novel method we were able to anchor 70% and 92% of sequences assemblies for V. inaequalis and F. vesca, respectively, to genetic linkage maps. Conclusions We demonstrated the utility of this approach by accurately determining the bin map positions of the majority of the large sequence contigs from each genome sequence and validated our method by mapping single sequence repeat markers derived from sequence contigs on a full mapping population.

Efecto de gelificantes en la formulación de dulce de yacón

OpenAIRE

Maldonado,Silvina; Singh,Judith del Carmen

2008-01-01

El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

Two sequence-ready contigs spanning the two copies of a 200-kb duplication on human 21q: partial sequence and polymorphisms.

Science.gov (United States)

Potier, M; Dutriaux, A; Orti, R; Groet, J; Gibelin, N; Karadima, G; Lutfalla, G; Lynn, A; Van Broeckhoven, C; Chakravarti, A; Petersen, M; Nizetic, D; Delabar, J; Rossier, J

1998-08-01

Physical mapping across a duplication can be a tour de force if the region is larger than the size of a bacterial clone. This was the case of the 170- to 275-kb duplication present on the long arm of chromosome 21 in normal human at 21q11.1 (proximal region) and at 21q22.1 (distal region), which we described previously. We have constructed sequence-ready contigs of the two copies of the duplication of which all the clones are genuine representatives of one copy or the other. This required the identification of four duplicon polymorphisms that are copy-specific and nonallelic variations in the sequence of the STSs. Thirteen STSs were mapped inside the duplicated region and 5 outside but close to the boundaries. Among these STSs 10 were end clones from YACs, PACs, or cosmids, and the average interval between two markers in the duplicated region was 16 kb. Eight PACs and cosmids showing minimal overlaps were selected in both copies of the duplication. Comparative sequence analysis along the duplication showed three single-basepair changes between the two copies over 659 bp sequenced (4 STSs), suggesting that the duplication is recent (less than 4 mya). Two CpG islands were located in the duplication, but no genes were identified after a 36-kb cosmid from the proximal copy of the duplication was sequenced. The homology of this chromosome 21 duplicated region with the pericentromeric regions of chromosomes 13, 2, and 18 suggests that the mechanism involved is probably similar to pericentromeric-directed mechanisms described in interchromosomal duplications. Copyright 1998 Academic Press.

Dicty_cDB: Contig-U12086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

Dicty_cDB: Contig-U09640-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U09694-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

AcEST: CL1889Contig1 [AcEST

Lifescience Database Archive (English)

Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91

Dicty_cDB: Contig-U15058-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U14745-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U03367-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

Dicty_cDB: Contig-U16086-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U13737-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U06307-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

Dicty_cDB: Contig-U15541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U06822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U01997-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

Dicty_cDB: Contig-U13254-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

Dicty_cDB: Contig-U13891-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

Dicty_cDB: Contig-U16093-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

Dicty_cDB: Contig-U06384-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

Dicty_cDB: Contig-U12545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

Dicty_cDB: Contig-U10823-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

Dicty_cDB: Contig-U13065-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

Dicty_cDB: Contig-U08861-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

Dicty_cDB: Contig-U06829-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

Dicty_cDB: Contig-U12073-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

Dicty_cDB: Contig-U09615-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

Dicty_cDB: Contig-U04432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

Dicty_cDB: Contig-U15828-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U01750-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U07021-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

Dicty_cDB: Contig-U16108-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

Dicty_cDB: Contig-U13974-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

Dicty_cDB: Contig-U16008-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

Dicty_cDB: Contig-U11342-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

Dicty_cDB: Contig-U11195-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

Dicty_cDB: Contig-U01791-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

Dicty_cDB: Contig-U09412-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

Dicty_cDB: Contig-U12357-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

Dicty_cDB: Contig-U10996-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

Dicty_cDB: Contig-U12049-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

Dicty_cDB: Contig-U13894-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

Dicty_cDB: Contig-U15462-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

Dicty_cDB: Contig-U09720-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

Dicty_cDB: Contig-U09379-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

Dicty_cDB: Contig-U15566-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

Dicty_cDB: Contig-U04334-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

Dicty_cDB: Contig-U10335-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

Dicty_cDB: Contig-U12399-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

Dicty_cDB: Contig-U11404-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

Dicty_cDB: Contig-U09569-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

Dicty_cDB: Contig-U15306-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

Dicty_cDB: Contig-U14772-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

Dicty_cDB: Contig-U11141-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

Dicty_cDB: Contig-U13202-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

Dicty_cDB: Contig-U15062-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

Dicty_cDB: Contig-U09432-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

Dicty_cDB: Contig-U15005-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

Dicty_cDB: Contig-U10406-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

Dicty_cDB: Contig-U16457-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

Dicty_cDB: Contig-U04768-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

Dicty_cDB: Contig-U13326-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

Dicty_cDB: Contig-U15036-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

Dicty_cDB: Contig-U13455-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

Dicty_cDB: Contig-U14400-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

Dicty_cDB: Contig-U10709-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

Dicty_cDB: Contig-U10837-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

Dicty_cDB: Contig-U12765-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

Dicty_cDB: Contig-U09480-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

Dicty_cDB: Contig-U09345-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

Dicty_cDB: Contig-U15323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

Dicty_cDB: Contig-U14236-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

Dicty_cDB: Contig-U10291-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

Dicty_cDB: Contig-U07545-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

Dicty_cDB: Contig-U15359-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

Dicty_cDB: Contig-U09581-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

Dicty_cDB: Contig-U04729-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

Dicty_cDB: Contig-U06929-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

Dicty_cDB: Contig-U15525-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

Dicty_cDB: Contig-U09822-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

Dicty_cDB: Contig-U11883-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

Dicty_cDB: Contig-U13680-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

Dicty_cDB: Contig-U15718-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

Dicty_cDB: Contig-U15573-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

Dicty_cDB: Contig-U01204-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

Dicty_cDB: Contig-U12043-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

Dicty_cDB: Contig-U16467-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

Dicty_cDB: Contig-U12682-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

BAC-HAPPY mapping (BAP mapping: a new and efficient protocol for physical mapping.

Directory of Open Access Journals (Sweden)

Giang T H Vu

2010-02-01

Full Text Available Physical and linkage mapping underpin efforts to sequence and characterize the genomes of eukaryotic organisms by providing a skeleton framework for whole genome assembly. Hitherto, linkage and physical "contig" maps were generated independently prior to merging. Here, we develop a new and easy method, BAC HAPPY MAPPING (BAP mapping, that utilizes BAC library pools as a HAPPY mapping panel together with an Mbp-sized DNA panel to integrate the linkage and physical mapping efforts into one pipeline. Using Arabidopsis thaliana as an exemplar, a set of 40 Sequence Tagged Site (STS markers spanning approximately 10% of chromosome 4 were simultaneously assembled onto a BAP map compiled using both a series of BAC pools each comprising 0.7x genome coverage and dilute (0.7x genome samples of sheared genomic DNA. The resultant BAP map overcomes the need for polymorphic loci to separate genetic loci by recombination and allows physical mapping in segments of suppressed recombination that are difficult to analyze using traditional mapping techniques. Even virtual "BAC-HAPPY-mapping" to convert BAC landing data into BAC linkage contigs is possible.

Dicty_cDB: Contig-U03323-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

Cellular, molecular and functional characterisation of YAC transgenic mouse models of Friedreich ataxia.

Directory of Open Access Journals (Sweden)

Sara Anjomani Virmouni

Full Text Available Friedreich ataxia (FRDA is an autosomal recessive neurodegenerative disorder, caused by a GAA repeat expansion mutation within intron 1 of the FXN gene. We have previously established and performed preliminary characterisation of several human FXN yeast artificial chromosome (YAC transgenic FRDA mouse models containing GAA repeat expansions, Y47R (9 GAA repeats, YG8R (90 and 190 GAA repeats and YG22R (190 GAA repeats.We now report extended cellular, molecular and functional characterisation of these FXN YAC transgenic mouse models. FXN transgene copy number analysis of the FRDA mice demonstrated that the YG22R and Y47R lines each have a single copy of the FXN transgene while the YG8R line has two copies. Single integration sites of all transgenes were confirmed by fluorescence in situ hybridisation (FISH analysis of metaphase and interphase chromosomes. We identified significant functional deficits, together with a degree of glucose intolerance and insulin hypersensitivity, in YG8R and YG22R FRDA mice compared to Y47R and wild-type control mice. We also confirmed increased somatic GAA repeat instability in the cerebellum and brain of YG22R and YG8R mice, together with significantly reduced levels of FXN mRNA and protein in the brain and liver of YG8R and YG22R compared to Y47R.Together these studies provide a detailed characterisation of our GAA repeat expansion-based YAC transgenic FRDA mouse models that will help investigations of FRDA disease mechanisms and therapy.

Dicty_cDB: Contig-U15069-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

Dicty_cDB: Contig-U12316-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

A first generation integrated physical and genetic map of the rainbow trout genome

Science.gov (United States)

The rainbow trout physical map was previously constructed from DNA fingerprinting of 192,096 BAC clones using the 4-color high-information content fingerprinting (HICF) method. The clones were assembled into physical map contigs using the finger-printing contig (FPC) program. The map is composed of ...

A first generation BAC-based physical map of the rainbow trout genome

Directory of Open Access Journals (Sweden)

Thorgaard Gary H

2009-10-01

Full Text Available Abstract Background Rainbow trout (Oncorhynchus mykiss are the most-widely cultivated cold freshwater fish in the world and an important model species for many research areas. Coupling great interest in this species as a research model with the need for genetic improvement of aquaculture production efficiency traits justifies the continued development of genomics research resources. Many quantitative trait loci (QTL have been identified for production and life-history traits in rainbow trout. A bacterial artificial chromosome (BAC physical map is needed to facilitate fine mapping of QTL and the selection of positional candidate genes for incorporation in marker-assisted selection (MAS for improving rainbow trout aquaculture production. This resource will also facilitate efforts to obtain and assemble a whole-genome reference sequence for this species. Results The physical map was constructed from DNA fingerprinting of 192,096 BAC clones using the 4-color high-information content fingerprinting (HICF method. The clones were assembled into physical map contigs using the finger-printing contig (FPC program. The map is composed of 4,173 contigs and 9,379 singletons. The total number of unique fingerprinting fragments (consensus bands in contigs is 1,185,157, which corresponds to an estimated physical length of 2.0 Gb. The map assembly was validated by 1 comparison with probe hybridization results and agarose gel fingerprinting contigs; and 2 anchoring large contigs to the microsatellite-based genetic linkage map. Conclusion The production and validation of the first BAC physical map of the rainbow trout genome is described in this paper. We are currently integrating this map with the NCCCWA genetic map using more than 200 microsatellites isolated from BAC end sequences and by identifying BACs that harbor more than 300 previously mapped markers. The availability of an integrated physical and genetic map will enable detailed comparative genome

The first generation of a BAC-based physical map of Brassica rapa

Directory of Open Access Journals (Sweden)

Lee Soo

2008-06-01

Full Text Available Abstract Background The genus Brassica includes the most extensively cultivated vegetable crops worldwide. Investigation of the Brassica genome presents excellent challenges to study plant genome evolution and divergence of gene function associated with polyploidy and genome hybridization. A physical map of the B. rapa genome is a fundamental tool for analysis of Brassica "A" genome structure. Integration of a physical map with an existing genetic map by linking genetic markers and BAC clones in the sequencing pipeline provides a crucial resource for the ongoing genome sequencing effort and assembly of whole genome sequences. Results A genome-wide physical map of the B. rapa genome was constructed by the capillary electrophoresis-based fingerprinting of 67,468 Bacterial Artificial Chromosome (BAC clones using the five restriction enzyme SNaPshot technique. The clones were assembled into contigs by means of FPC v8.5.3. After contig validation and manual editing, the resulting contig assembly consists of 1,428 contigs and is estimated to span 717 Mb in physical length. This map provides 242 anchored contigs on 10 linkage groups to be served as seed points from which to continue bidirectional chromosome extension for genome sequencing. Conclusion The map reported here is the first physical map for Brassica "A" genome based on the High Information Content Fingerprinting (HICF technique. This physical map will serve as a fundamental genomic resource for accelerating genome sequencing, assembly of BAC sequences, and comparative genomics between Brassica genomes. The current build of the B. rapa physical map is available at the B. rapa Genome Project website for the user community.

BAC-end sequence-based SNPs and Bin mapping for rapid integration of physical and genetic maps in apple.

Science.gov (United States)

Han, Yuepeng; Chagné, David; Gasic, Ksenija; Rikkerink, Erik H A; Beever, Jonathan E; Gardiner, Susan E; Korban, Schuyler S

2009-03-01

A genome-wide BAC physical map of the apple, Malus x domestica Borkh., has been recently developed. Here, we report on integrating the physical and genetic maps of the apple using a SNP-based approach in conjunction with bin mapping. Briefly, BAC clones located at ends of BAC contigs were selected, and sequenced at both ends. The BAC end sequences (BESs) were used to identify candidate SNPs. Subsequently, these candidate SNPs were genetically mapped using a bin mapping strategy for the purpose of mapping the physical onto the genetic map. Using this approach, 52 (23%) out of 228 BESs tested were successfully exploited to develop SNPs. These SNPs anchored 51 contigs, spanning approximately 37 Mb in cumulative physical length, onto 14 linkage groups. The reliability of the integration of the physical and genetic maps using this SNP-based strategy is described, and the results confirm the feasibility of this approach to construct an integrated physical and genetic maps for apple.

Physical Mapping of Bread Wheat Chromosome 5A: An Integrated Approach

Directory of Open Access Journals (Sweden)

Delfina Barabaschi

2015-11-01

Full Text Available The huge size, redundancy, and highly repetitive nature of the bread wheat [ (L.] genome, makes it among the most difficult species to be sequenced. To overcome these limitations, a strategy based on the separation of individual chromosomes or chromosome arms and the subsequent production of physical maps was established within the frame of the International Wheat Genome Sequence Consortium (IWGSC. A total of 95,812 bacterial artificial chromosome (BAC clones of short-arm chromosome 5A (5AS and long-arm chromosome 5A (5AL arm-specific BAC libraries were fingerprinted and assembled into contigs by complementary analytical approaches based on the FingerPrinted Contig (FPC and Linear Topological Contig (LTC tools. Combined anchoring approaches based on polymerase chain reaction (PCR marker screening, microarray, and sequence homology searches applied to several genomic tools (i.e., genetic maps, deletion bin map, neighbor maps, BAC end sequences (BESs, genome zipper, and chromosome survey sequences allowed the development of a high-quality physical map with an anchored physical coverage of 75% for 5AS and 53% for 5AL with high portions (64 and 48%, respectively of contigs ordered along the chromosome. In the genome of grasses, [ (L. Beauv.], rice ( L., and sorghum [ (L. Moench] homologs of genes on wheat chromosome 5A were separated into syntenic blocks on different chromosomes as a result of translocations and inversions during evolution. The physical map presented represents an essential resource for fine genetic mapping and map-based cloning of agronomically relevant traits and a reference for the 5A sequencing projects.

Genome scan identifies a locus affecting gamma-globin expression in human beta-cluster YAC transgenic mice

Energy Technology Data Exchange (ETDEWEB)

Lin, S.D.; Cooper, P.; Fung, J.; Weier, H.U.G.; Rubin, E.M.

2000-03-01

Genetic factors affecting post-natal g-globin expression - a major modifier of the severity of both b-thalassemia and sickle cell anemia, have been difficult to study. This is especially so in mice, an organism lacking a globin gene with an expression pattern equivalent to that of human g-globin. To model the human b-cluster in mice, with the goal of screening for loci affecting human g-globin expression in vivo, we introduced a human b-globin cluster YAC transgene into the genome of FVB mice . The b-cluster contained a Greek hereditary persistence of fetal hemoglobin (HPFH) g allele resulting in postnatal expression of human g-globin in transgenic mice. The level of human g-globin for various F1 hybrids derived from crosses between the FVB transgenics and other inbred mouse strains was assessed. The g-globin level of the C3HeB/FVB transgenic mice was noted to be significantly elevated. To map genes affecting postnatal g-globin expression, a 20 centiMorgan (cM) genome scan of a C3HeB/F VB transgenics [prime] FVB backcross was performed, followed by high-resolution marker analysis of promising loci. From this analysis we mapped a locus within a 2.2 cM interval of mouse chromosome 1 at a LOD score of 4.2 that contributes 10.4% of variation in g-globin expression level. Combining transgenic modeling of the human b-globin gene cluster with quantitative trait analysis, we have identified and mapped a murine locus that impacts on human g-globin expression in vivo.

Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

OpenAIRE

Ramos Zapana, Rubén; Arias Arroyo, Gladys

2014-01-01

Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

Generation of a BAC-based physical map of the melon genome

Directory of Open Access Journals (Sweden)

Puigdomènech Pere

2010-05-01

Full Text Available Abstract Background Cucumis melo (melon belongs to the Cucurbitaceae family, whose economic importance among horticulture crops is second only to Solanaceae. Melon has high intra-specific genetic variation, morphologic diversity and a small genome size (450 Mb, which make this species suitable for a great variety of molecular and genetic studies that can lead to the development of tools for breeding varieties of the species. A number of genetic and genomic resources have already been developed, such as several genetic maps and BAC genomic libraries. These tools are essential for the construction of a physical map, a valuable resource for map-based cloning, comparative genomics and assembly of whole genome sequencing data. However, no physical map of any Cucurbitaceae has yet been developed. A project has recently been started to sequence the complete melon genome following a whole-genome shotgun strategy, which makes use of massive sequencing data. A BAC-based melon physical map will be a useful tool to help assemble and refine the draft genome data that is being produced. Results A melon physical map was constructed using a 5.7 × BAC library and a genetic map previously developed in our laboratories. High-information-content fingerprinting (HICF was carried out on 23,040 BAC clones, digesting with five restriction enzymes and SNaPshot labeling, followed by contig assembly with FPC software. The physical map has 1,355 contigs and 441 singletons, with an estimated physical length of 407 Mb (0.9 × coverage of the genome and the longest contig being 3.2 Mb. The anchoring of 845 BAC clones to 178 genetic markers (100 RFLPs, 76 SNPs and 2 SSRs also allowed the genetic positioning of 183 physical map contigs/singletons, representing 55 Mb (12% of the melon genome, to individual chromosomal loci. The melon FPC database is available for download at http://melonomics.upv.es/static/files/public/physical_map/. Conclusions Here we report the construction

Features of the organization of bread wheat chromosome 5BS based on physical mapping.

Science.gov (United States)

Salina, Elena A; Nesterov, Mikhail A; Frenkel, Zeev; Kiseleva, Antonina A; Timonova, Ekaterina M; Magni, Federica; Vrána, Jan; Šafář, Jan; Šimková, Hana; Doležel, Jaroslav; Korol, Abraham; Sergeeva, Ekaterina M

2018-02-09

The IWGSC strategy for construction of the reference sequence of the bread wheat genome is based on first obtaining physical maps of the individual chromosomes. Our aim is to develop and use the physical map for analysis of the organization of the short arm of wheat chromosome 5B (5BS) which bears a number of agronomically important genes, including genes conferring resistance to fungal diseases. A physical map of the 5BS arm (290 Mbp) was constructed using restriction fingerprinting and LTC software for contig assembly of 43,776 BAC clones. The resulting physical map covered ~ 99% of the 5BS chromosome arm (111 scaffolds, N50 = 3.078 Mb). SSR, ISBP and zipper markers were employed for anchoring the BAC clones, and from these 722 novel markers were developed based on previously obtained data from partial sequencing of 5BS. The markers were mapped using a set of Chinese Spring (CS) deletion lines, and F2 and RICL populations from a cross of CS and CS-5B dicoccoides. Three approaches have been used for anchoring BAC contigs on the 5BS chromosome, including clone-by-clone screening of BACs, GenomeZipper analysis, and comparison of BAC-fingerprints with in silico fingerprinting of 5B pseudomolecules of T. dicoccoides. These approaches allowed us to reach a high level of BAC contig anchoring: 96% of 5BS BAC contigs were located on 5BS. An interesting pattern was revealed in the distribution of contigs along the chromosome. Short contigs (200-999 kb) containing markers for the regions interrupted by tandem repeats, were mainly localized to the 5BS subtelomeric block; whereas the distribution of larger 1000-3500 kb contigs along the chromosome better correlated with the distribution of the regions syntenic to rice, Brachypodium, and sorghum, as detected by the Zipper approach. The high fingerprinting quality, LTC software and large number of BAC clones selected by the informative markers in screening of the 43,776 clones allowed us to significantly increase the

Mice lacking caspase-2 are protected from behavioral changes, but not pathology, in the YAC128 model of Huntington disease

Directory of Open Access Journals (Sweden)

Bissada Nagat

2011-08-01

Full Text Available Abstract Background Huntington Disease (HD is a neurodegenerative disorder in which caspase activation and cleavage of substrates, including the huntingtin protein, has been invoked as a pathological mechanism. Specific changes in caspase-2 (casp2 activity have been suggested to contribute to the pathogenesis of HD, however unique casp2 cleavage substrates have remained elusive. We thus utilized mice completely lacking casp2 (casp2-/- to examine the role played by casp2 in the progression of HD. This 'substrate agnostic' approach allows us to query the effect of casp2 on HD progression without pre-defining proteolytic substrates of interest. Results YAC128 HD model mice lacking casp2 show protection from well-validated motor and cognitive features of HD, including performance on rotarod, swimming T-maze, pre-pulse inhibition, spontaneous alternation and locomotor tasks. However, the specific pathological features of the YAC128 mice including striatal volume loss and testicular degeneration are unaltered in mice lacking casp2. The application of high-resolution magnetic resonance imaging (MRI techniques validates specific neuropathology in the YAC128 mice that is not altered by ablation of casp2. Conclusions The rescue of behavioral phenotypes in the absence of pathological improvement suggests that different pathways may be operative in the dysfunction of neural circuitry in HD leading to behavioral changes compared to the processes leading to cell death and volume loss. Inhibition of caspase-2 activity may be associated with symptomatic improvement in HD.

Cinética de la transferencia de masa durante la deshidratación osmótica de yacón (Smallanthus sonchifolius Cinética de transferência de massa durante a desidratação osmótica de yacón (Smallanthus sonchifolius

Directory of Open Access Journals (Sweden)

Silvina Maldonado

2008-03-01

Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino de vida útil muy corta bajo condiciones ambientales. Los objetivos de este trabajo fueron determinar: 1 la cinética de deshidratación osmótica de yacón, utilizando sacarosa como soluto; 2 el ajuste de la ecuación de Peleg a los datos experimentales; y 3 el coeficiente de difusión usando la ecuación de Hawkes y Flink. La fruta se peló y cortó en placas de 3 x 3 x 0,3 cm. Se la deshidrató osmóticamente con solución de sacarosa al 40% (p/p, hasta aw = 0,97. El proceso se realizó a temperatura de 25 °C y con agitación continua (105 rpm. Se determinó la pérdida de peso de las muestras, la ganancia de sólidos y la retención de agua. Los parámetros obtenidos para el ajuste de pérdida de agua y ganancia de sólidos son respectivamente: k1: 8,2 0,1 y k2: 0,53 ± 0,06; k1: 234 ± 8 y k2: 2,6 ± 0,5. La mayor transferencia de masa, tanto de agua como de soluto, ocurre durante los primeros 60 a 90 minutos de proceso, lográndose una ganancia media de sólidos de 9,5 [g.100 g-1 MF] y una pérdida de agua de 68,8 [g.100 g-1MF]. Se puede asegurar que es posible aplicar satisfactoriamente el proceso de deshidratación osmótica en yacón como pre tratamiento de conservación.O yacón (Smallanthus sonchifolius é um tubérculo andino de vida útil muito curta sob condições ambientais. Os objetivos deste trabalho foram determinar: 1 a cinética de desidratação osmótica do yacón, utilizando sacarose como soluto; 2 o ajuste da equação de Peleg aos dados experimentais; e 3 o coeficiente de difusão usando a equação de Hawkes e Flink. A fruta foi descascada e cortada em placas de 3 x 3 x 0,3 cm. Foi desidratada osmoticamente usando uma solução de sacarose aos 40% (p/p, até aw = 0,97. O processo foi conduzido mantendo a temperatura constante em 25 °C e com agitação orbital contínua (105 rpm. Determinou-se a perda de peso das mostras, o ganho de sólidos e a retenção de

Integrated physical map of bread wheat chromosome arm 7DS to facilitate gene cloning and comparative studies.

Science.gov (United States)

Tulpová, Zuzana; Luo, Ming-Cheng; Toegelová, Helena; Visendi, Paul; Hayashi, Satomi; Vojta, Petr; Paux, Etienne; Kilian, Andrzej; Abrouk, Michaël; Bartoš, Jan; Hajdúch, Marián; Batley, Jacqueline; Edwards, David; Doležel, Jaroslav; Šimková, Hana

2018-03-08

Bread wheat (Triticum aestivum L.) is a staple food for a significant part of the world's population. The growing demand on its production can be satisfied by improving yield and resistance to biotic and abiotic stress. Knowledge of the genome sequence would aid in discovering genes and QTLs underlying these traits and provide a basis for genomics-assisted breeding. Physical maps and BAC clones associated with them have been valuable resources from which to generate a reference genome of bread wheat and to assist map-based gene cloning. As a part of a joint effort coordinated by the International Wheat Genome Sequencing Consortium, we have constructed a BAC-based physical map of bread wheat chromosome arm 7DS consisting of 895 contigs and covering 94% of its estimated length. By anchoring BAC contigs to one radiation hybrid map and three high resolution genetic maps, we assigned 73% of the assembly to a distinct genomic position. This map integration, interconnecting a total of 1713 markers with ordered and sequenced BAC clones from a minimal tiling path, provides a tool to speed up gene cloning in wheat. The process of physical map assembly included the integration of the 7DS physical map with a whole-genome physical map of Aegilops tauschii and a 7DS Bionano genome map, which together enabled efficient scaffolding of physical-map contigs, even in the non-recombining region of the genetic centromere. Moreover, this approach facilitated a comparison of bread wheat and its ancestor at BAC-contig level and revealed a reconstructed region in the 7DS pericentromere. Copyright © 2018. Published by Elsevier B.V.

Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

Science.gov (United States)

Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

2016-01-01

A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

OpenAIRE

Silvina Maldonado; Judith del Carmen Singh

2008-01-01

El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

A BAC/BIBAC-based physical map of chickpea, Cicer arietinum L

Directory of Open Access Journals (Sweden)

Abbo Shahal

2010-09-01

Full Text Available Abstract Background Chickpea (Cicer arietinum L. is the third most important pulse crop worldwide. Despite its importance, relatively little is known about its genome. The availability of a genome-wide physical map allows rapid fine mapping of QTL, development of high-density genome maps, and sequencing of the entire genome. However, no such a physical map has been developed in chickpea. Results We present a genome-wide, BAC/BIBAC-based physical map of chickpea developed by fingerprint analysis. Four chickpea BAC and BIBAC libraries, two of which were constructed in this study, were used. A total of 67,584 clones were fingerprinted, and 64,211 (~11.7 × of the fingerprints validated and used in the physical map assembly. The physical map consists of 1,945 BAC/BIBAC contigs, with each containing an average of 28.3 clones and having an average physical length of 559 kb. The contigs collectively span approximately 1,088 Mb. By using the physical map, we identified the BAC/BIBAC contigs containing or closely linked to QTL4.1 for resistance to Didymella rabiei (RDR and QTL8 for days to first flower (DTF, thus further verifying the physical map and confirming its utility in fine mapping and cloning of QTL. Conclusion The physical map represents the first genome-wide, BAC/BIBAC-based physical map of chickpea. This map, along with other genomic resources previously developed in the species and the genome sequences of related species (soybean, Medicago and Lotus, will provide a foundation necessary for many areas of advanced genomics research in chickpea and other legume species. The inclusion of transformation-ready BIBACs in the map greatly facilitates its utility in functional analysis of the legume genomes.

Physical mapping of chromosome 8p22 markers and their homozygous deletion in a metastatic prostate cancer

Energy Technology Data Exchange (ETDEWEB)

Bova, G.S.; Pin, S.S.; Isaacs, W.B. [Johns Hopkins Univ. School of Medicine, Baltimore, MD (United States)]|[Brady Urological Institute, Baltimore, MD (United States)] [and others

1996-07-01

Numerous studies have implicated the short arm of chromosome 8 as the site of one or more tumor suppressor genes inactivated in carcinogenesis of the prostate, colon, lung, and liver. Previously, we identified a homozygous deletion on chromosome 8p22 in a metastatic prostate cancer. To map this homozygous deletion physically, long-range restriction mapping was performed using yeast artificial chromosomes (YACs) spanning approximately 2 Mb of chromosome band 8p22. Subcloned genomic DNA and cDNA probes isolated by hybrid capture from these YACs were mapped in relation to one another, reinforcing map integrity. Mapped single-copy probes from the region were then applied to DNA isolated from a metastatic prostate cancer containing a chromosome 8p22 homozygous deletion and indicated that its deletion spans 730-970 kb. Candidate genes PRLTS (PDGF-receptor {beta}-like tumor suppressor) and CTSB (cathepsin B) are located outside the region of homozygous deletion. Genethon marker D8S549 is located approximately at the center of this region of homozygous deletion. Two new microsatellite polymorphisms, D8S1991 and D8S1992, also located within the region of homozygous deletion on chromosome 8p22, are described. Physical mapping places cosmid CI8-2644 telomeric to MSR (macrophage scavenger receptor), the reverse of a previously published map, altering the interpretation of published deletion studies. This work should prove helpful in the identification of candidate tumor suppressor genes in this region. 47 refs., 5 figs., 1 tab.

difusividad, masa, humedad, volumen y sólidos en yacón (Smallantus sonchifolius deshidratado osmóticamente

Directory of Open Access Journals (Sweden)

Julio Rojas Naccha

2012-01-01

Full Text Available Se evaluó la capacidad predictiva de la Red Neuronal Artificial (RNA en el efecto de la concentración (30,40, 50 y 60 % p/p y temperatura (30, 40 y 50°C de la solución de fructooligosacaridos (FOS en la masa,humedad, volumen y sólidos en cubos de yacón osmodeshidratados, y en el coeficiente de difusividad efectivamedia del agua, con y sin encogimiento. Se aplicó la RNA del tipoFeedforwardcon los algoritmos deentrenamientoBackpropagationy de ajuste de pesosLevenberg-Marquardt, usando la topología: error metade 10-5, tasa de aprendizaje de 0.01, coeficiente de momento de 0.5, 2 neuronas de entrada, 6 neuronas desalida, una capa oculta con 18 neuronas, 15 etapas de entrenamiento y funciones de transferencialogsig-purelin. El error promedio global por la RNA fue 3.44% y los coeficientes de correlación fueron mayores a0.9. No se encontraron diferencias significativas entre los valores experimentales con losvalores predichos porla RNA y con los valores predichos por un modelo estadístico de regresión polinomial de segundo orden (p >0.95.Palabras clave:Red Neuronal Artificial (RNA, difusividad efectiva, yacón, deshidratación osmótica

A BAC-based physical map of the Drosophila buzzatii genome

Energy Technology Data Exchange (ETDEWEB)

Gonzalez, Josefa; Nefedov, Michael; Bosdet, Ian; Casals, Ferran; Calvete, Oriol; Delprat, Alejandra; Shin, Heesun; Chiu, Readman; Mathewson, Carrie; Wye, Natasja; Hoskins, Roger A.; Schein, JacquelineE.; de Jong, Pieter; Ruiz, Alfredo

2005-03-18

Large-insert genomic libraries facilitate cloning of large genomic regions, allow the construction of clone-based physical maps and provide useful resources for sequencing entire genomes. Drosophilabuzzatii is a representative species of the repleta group in the Drosophila subgenus, which is being widely used as a model in studies of genome evolution, ecological adaptation and speciation. We constructed a Bacterial Artificial Chromosome (BAC) genomic library of D. buzzatii using the shuttle vector pTARBAC2.1. The library comprises 18,353 clones with an average insert size of 152 kb and a {approx}18X expected representation of the D. buzzatii euchromatic genome. We screened the entire library with six euchromatic gene probes and estimated the actual genome representation to be {approx}23X. In addition, we fingerprinted by restriction digestion and agarose gel electrophoresis a sample of 9,555 clones, and assembled them using Finger Printed Contigs (FPC) software and manual editing into 345 contigs (mean of 26 clones per contig) and 670singletons. Finally, we anchored 181 large contigs (containing 7,788clones) to the D. buzzatii salivary gland polytene chromosomes by in situ hybridization of 427 representative clones. The BAC library and a database with all the information regarding the high coverage BAC-based physical map described in this paper are available to the research community.

Dicty_cDB: Contig-U16279-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

Genetic and physical analysis of a YAC contig spanning the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

NARCIS (Netherlands)

Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.; Hille, J.; Nijkamp, H.J.J.

1998-01-01

The Alternaria stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped on

Genetic and physical analysis of a YAC contig spannig the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

NARCIS (Netherlands)

Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.J.F.; Hille, J.; Nijkamp, H.J.J.

1999-01-01

The Alternaria in stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped

Human cDNA mapping using fluorescence in situ hybridization

Energy Technology Data Exchange (ETDEWEB)

Korenberg, J.R.

1993-03-04

Genetic mapping is approached using the techniques of high resolution fluorescence in situ hybridization (FISH). This technology and the results of its application are designed to rapidly generate whole genome as tool box of expressed sequence to speed the identification of human disease genes. The results of this study are intended to dovetail with and to link the results of existing technologies for creating backbone YAC and genetic maps. In the first eight months, this approach generated 60--80% of the expressed sequence map, the remainder expected to be derived through more long-term, labor-intensive, regional chromosomal gene searches or sequencing. The laboratory has made significant progress in the set-up phase, in mapping fetal and adult brain and other cDNAs, in testing a model system for directly linking genetic and physical maps using FISH with small fragments, in setting up a database, and in establishing the validity and throughput of the system.

Fine mapping of Best`s macular dystrophy localises the gene in close proximity to, but distinct from, the D115480/ROM1

Energy Technology Data Exchange (ETDEWEB)

Graff, C.; Ahlbom, B.E.; Anneren, G. [University Hospital, Uppsala (Sweden)] [and others

1994-09-01

Best`s macular dystrophy (BMD) is an autosomal dominant disease characterized by accumulation of lipofuscin beneath the pigment epithelium of the macula, leading to early-onset impairment of central vision. The gene has previously been mapped to 11q13. Based on DNA from 191 people from a large 12-generation family, the gene now has been mapped to a 1.5 cM interval between the markers Fc{epsilon}RI and D11S480/ROM1. By disequilibrium analysis the gene was estimated to be 0.321 cM centromeric to the marker D11S480. Since this on average corresponds to 300 kb, the gene may be at a distance contained in YAC molecules. To physically characterize this region, YAC clones positive for markers flanking BMD have been identified. Sequence analysis of the candidate gene ROM1 did not reveal any mutation. However, one recombination between intragenic ROM1 polymorphisms and BMD was detected, which make it highly unlikely that mutations in ROM1 are causing BMD.

A physical map of Brassica oleracea shows complexity of chromosomal changes following recursive paleopolyploidizations

Directory of Open Access Journals (Sweden)

Giattina Emily

2011-09-01

Full Text Available Abstract Background Evolution of the Brassica species has been recursively affected by polyploidy events, and comparison to their relative, Arabidopsis thaliana, provides means to explore their genomic complexity. Results A genome-wide physical map of a rapid-cycling strain of B. oleracea was constructed by integrating high-information-content fingerprinting (HICF of Bacterial Artificial Chromosome (BAC clones with hybridization to sequence-tagged probes. Using 2907 contigs of two or more BACs, we performed several lines of comparative genomic analysis. Interspecific DNA synteny is much better preserved in euchromatin than heterochromatin, showing the qualitative difference in evolution of these respective genomic domains. About 67% of contigs can be aligned to the Arabidopsis genome, with 96.5% corresponding to euchromatic regions, and 3.5% (shown to contain repetitive sequences to pericentromeric regions. Overgo probe hybridization data showed that contigs aligned to Arabidopsis euchromatin contain ~80% of low-copy-number genes, while genes with high copy number are much more frequently associated with pericentromeric regions. We identified 39 interchromosomal breakpoints during the diversification of B. oleracea and Arabidopsis thaliana, a relatively high level of genomic change since their divergence. Comparison of the B. oleracea physical map with Arabidopsis and other available eudicot genomes showed appreciable 'shadowing' produced by more ancient polyploidies, resulting in a web of relatedness among contigs which increased genomic complexity. Conclusions A high-resolution genetically-anchored physical map sheds light on Brassica genome organization and advances positional cloning of specific genes, and may help to validate genome sequence assembly and alignment to chromosomes. All the physical mapping data is freely shared at a WebFPC site (http://lulu.pgml.uga.edu/fpc/WebAGCoL/brassica/WebFPC/; Temporarily password-protected: account

A physical map of Brassica oleracea shows complexity of chromosomal changes following recursive paleopolyploidizations

Science.gov (United States)

2011-01-01

Background Evolution of the Brassica species has been recursively affected by polyploidy events, and comparison to their relative, Arabidopsis thaliana, provides means to explore their genomic complexity. Results A genome-wide physical map of a rapid-cycling strain of B. oleracea was constructed by integrating high-information-content fingerprinting (HICF) of Bacterial Artificial Chromosome (BAC) clones with hybridization to sequence-tagged probes. Using 2907 contigs of two or more BACs, we performed several lines of comparative genomic analysis. Interspecific DNA synteny is much better preserved in euchromatin than heterochromatin, showing the qualitative difference in evolution of these respective genomic domains. About 67% of contigs can be aligned to the Arabidopsis genome, with 96.5% corresponding to euchromatic regions, and 3.5% (shown to contain repetitive sequences) to pericentromeric regions. Overgo probe hybridization data showed that contigs aligned to Arabidopsis euchromatin contain ~80% of low-copy-number genes, while genes with high copy number are much more frequently associated with pericentromeric regions. We identified 39 interchromosomal breakpoints during the diversification of B. oleracea and Arabidopsis thaliana, a relatively high level of genomic change since their divergence. Comparison of the B. oleracea physical map with Arabidopsis and other available eudicot genomes showed appreciable 'shadowing' produced by more ancient polyploidies, resulting in a web of relatedness among contigs which increased genomic complexity. Conclusions A high-resolution genetically-anchored physical map sheds light on Brassica genome organization and advances positional cloning of specific genes, and may help to validate genome sequence assembly and alignment to chromosomes. All the physical mapping data is freely shared at a WebFPC site (http://lulu.pgml.uga.edu/fpc/WebAGCoL/brassica/WebFPC/; Temporarily password-protected: account: pgml; password: 123qwe123

BioNano genome mapping of individual chromosomes supports physical mapping and sequence assembly in complex plant genomes.

Science.gov (United States)

Staňková, Helena; Hastie, Alex R; Chan, Saki; Vrána, Jan; Tulpová, Zuzana; Kubaláková, Marie; Visendi, Paul; Hayashi, Satomi; Luo, Mingcheng; Batley, Jacqueline; Edwards, David; Doležel, Jaroslav; Šimková, Hana

2016-07-01

The assembly of a reference genome sequence of bread wheat is challenging due to its specific features such as the genome size of 17 Gbp, polyploid nature and prevalence of repetitive sequences. BAC-by-BAC sequencing based on chromosomal physical maps, adopted by the International Wheat Genome Sequencing Consortium as the key strategy, reduces problems caused by the genome complexity and polyploidy, but the repeat content still hampers the sequence assembly. Availability of a high-resolution genomic map to guide sequence scaffolding and validate physical map and sequence assemblies would be highly beneficial to obtaining an accurate and complete genome sequence. Here, we chose the short arm of chromosome 7D (7DS) as a model to demonstrate for the first time that it is possible to couple chromosome flow sorting with genome mapping in nanochannel arrays and create a de novo genome map of a wheat chromosome. We constructed a high-resolution chromosome map composed of 371 contigs with an N50 of 1.3 Mb. Long DNA molecules achieved by our approach facilitated chromosome-scale analysis of repetitive sequences and revealed a ~800-kb array of tandem repeats intractable to current DNA sequencing technologies. Anchoring 7DS sequence assemblies obtained by clone-by-clone sequencing to the 7DS genome map provided a valuable tool to improve the BAC-contig physical map and validate sequence assembly on a chromosome-arm scale. Our results indicate that creating genome maps for the whole wheat genome in a chromosome-by-chromosome manner is feasible and that they will be an affordable tool to support the production of improved pseudomolecules. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

Physical and transcript map of the region between D6S264 and D6S149 on chromosome 6q27, the minimal region of allele loss in sporadic epithelial ovarian cancer

DEFF Research Database (Denmark)

Liu, Ying; Emilion, Gracy; Mungall, Andrew J

2002-01-01

We have previously shown a high frequency of allele loss at D6S193 (62%) on chromosomal arm 6q27 in ovarian tumours and mapped the minimal region of allele loss between D6S297 and D6S264 (3 cM). We isolated and mapped a single non-chimaeric YAC (17IA12, 260-280 kb) containing D6S193 and D6S297...

ESTminer: a Web interface for mining EST contig and cluster databases.

Science.gov (United States)

Huang, Yecheng; Pumphrey, Janie; Gingle, Alan R

2005-03-01

ESTminer is a Web application and database schema for interactive mining of expressed sequence tag (EST) contig and cluster datasets. The Web interface contains a query frame that allows the selection of contigs/clusters with specific cDNA library makeup or a threshold number of members. The results are displayed as color-coded tree nodes, where the color indicates the fractional size of each cDNA library component. The nodes are expandable, revealing library statistics as well as EST or contig members, with links to sequence data, GenBank records or user configurable links. Also, the interface allows 'queries within queries' where the result set of a query is further filtered by the subsequent query. ESTminer is implemented in Java/JSP and the package, including MySQL and Oracle schema creation scripts, is available from http://cggc.agtec.uga.edu/Data/download.asp agingle@uga.edu.

Sequence finishing and mapping of Drosophila melanogasterheterochromatin

Energy Technology Data Exchange (ETDEWEB)

Hoskins, Roger A.; Carlson, Joseph W.; Kennedy, Cameron; Acevedo,David; Evans-Holm, Martha; Frise, Erwin; Wan, Kenneth H.; Park, Soo; Mendez-Lago, Maria; Rossi, Fabrizio; Villasante, Alfredo; Dimitri,Patrizio; Karpen, Gary H.; Celniker, Susan E.

2007-06-15

Genome sequences for most metazoans are incomplete due tothe presence of repeated DNA in the pericentromeric heterochromatin. Theheterochromatic regions of D. melanogaster contain 20 Mb of sequenceamenable to mapping, sequence assembly and finishing. Here we describethe generation of 15 Mb of finished or improved heterochromatic sequenceusing available clone resources and assembly and mapping methods. We alsoconstructed a BAC-based physical map that spans approximately 13 Mb ofthe pericentromeric heterochromatin, and a cytogenetic map that positionsapproximately 11 Mb of BAC contigs and sequence scaffolds in specificchromosomal locations. The integrated sequence assembly and maps greatlyimprove our understanding of the structure and composition of this poorlyunderstood fraction of a metazoan genome and provide a framework forfunctional analyses.

Validation of rice genome sequence by optical mapping

Directory of Open Access Journals (Sweden)

Pape Louise

2007-08-01

Full Text Available Abstract Background Rice feeds much of the world, and possesses the simplest genome analyzed to date within the grass family, making it an economically relevant model system for other cereal crops. Although the rice genome is sequenced, validation and gap closing efforts require purely independent means for accurate finishing of sequence build data. Results To facilitate ongoing sequencing finishing and validation efforts, we have constructed a whole-genome SwaI optical restriction map of the rice genome. The physical map consists of 14 contigs, covering 12 chromosomes, with a total genome size of 382.17 Mb; this value is about 11% smaller than original estimates. 9 of the 14 optical map contigs are without gaps, covering chromosomes 1, 2, 3, 4, 5, 7, 8 10, and 12 in their entirety – including centromeres and telomeres. Alignments between optical and in silico restriction maps constructed from IRGSP (International Rice Genome Sequencing Project and TIGR (The Institute for Genomic Research genome sequence sources are comprehensive and informative, evidenced by map coverage across virtually all published gaps, discovery of new ones, and characterization of sequence misassemblies; all totalling ~14 Mb. Furthermore, since optical maps are ordered restriction maps, identified discordances are pinpointed on a reliable physical scaffold providing an independent resource for closure of gaps and rectification of misassemblies. Conclusion Analysis of sequence and optical mapping data effectively validates genome sequence assemblies constructed from large, repeat-rich genomes. Given this conclusion we envision new applications of such single molecule analysis that will merge advantages offered by high-resolution optical maps with inexpensive, but short sequence reads generated by emerging sequencing platforms. Lastly, map construction techniques presented here points the way to new types of comparative genome analysis that would focus on discernment of

Dicty_cDB: Contig-U03802-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

The Norrie disease gene maps to a 150 kb region on chromosome Xp11.3.

Science.gov (United States)

Sims, K B; Lebo, R V; Benson, G; Shalish, C; Schuback, D; Chen, Z Y; Bruns, G; Craig, I W; Golbus, M S; Breakefield, X O

1992-05-01

Norrie disease is a human X-linked recessive disorder of unknown etiology characterized by congenital blindness, sensory neural deafness and mental retardation. This disease gene was previously linked to the DXS7 (L1.28) locus and the MAO genes in band Xp11.3. We report here fine physical mapping of the obligate region containing the Norrie disease gene (NDP) defined by a recombination and by the smallest submicroscopic chromosomal deletion associated with Norrie disease identified to date. Analysis, using in addition two overlapping YAC clones from this region, allowed orientation of the MAOA and MAOB genes in a 5'-3'-3'-5' configuration. A recombination event between a (GT)n polymorphism in intron 2 of the MAOB gene and the NDP locus, in a family previously reported to have a recombination between DXS7 and NDP, delineates a flanking marker telomeric to this disease gene. An anonymous DNA probe, dc12, present in one of the YACs and in a patient with a submicroscopic deletion which includes MAOA and MAOB but not L1.28, serves as a flanking marker centromeric to the disease gene. An Alu-PCR fragment from the right arm of the MAO YAC (YMAO.AluR) is not deleted in this patient and also delineates the centromeric extent of the obligate disease region. The apparent order of these loci is telomere ... DXS7-MAOA-MAOB-NDP-dc12-YMAO.AluR ... centromere. Together these data define the obligate region containing the NDP gene to a chromosomal segment less than 150 kb.

High-throughput physical map anchoring via BAC-pool sequencing

Czech Academy of Sciences Publication Activity Database

Cviková, Kateřina; Cattonaro, F.; Alaux, M.; Stein, N.; Mayer, K.F.X.; Doležel, Jaroslav; Bartoš, Jan

2015-01-01

Roč. 15, APR 11 (2015) ISSN 1471-2229 R&D Projects: GA ČR GA13-08786S; GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Physical map * Contig anchoring * Next generation sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.631, year: 2015

Efecto hepatoprotector del extracto acuoso de Smallanthus sonchifolius (yacón en un modelo de intoxicación con acetaminofén

Directory of Open Access Journals (Sweden)

Acela Inés Arnao-Salas

2012-07-01

Full Text Available En la medicina tradicional se ha publicado que las hojas de Smallanthus sonchifolius (yacón poseen efectos antidiabético y hepatoprotector. Objetivos: Evaluar en suero y hematíes el efecto hepatoprotector del extracto acuoso de hojas de yacón (EAY en un modelo de intoxicación con acetaminofén en ratas. Diseño: Experimental, transversal. Institución: Centro de Investigación de Bioquímica y Nutrición, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Hojas de yacón. Intervenciones: Se formó cinco grupos de ratas hembra (n=6 que recibieron por cinco días, por vía oral, suero fisiológico (SF, EAY o silimarina (Sil (50 mg/kg y luego de 1 hora, SF o acetaminofén (A 250 mg/kg, según lo siguiente: G1 (control; SF-SF, G2 (SF-A, G3 (EAY (200 mg/kg-A, G4 (EAY (400 mg/kg-A y G5 (Sil-A. Principales medidas de los resultados: Actividad de aspartato amino transferasas (AST, alanina amino transferasa (ALT, fosfatasa alcalina (FAL γ γ-amino transferasa (γ-GTP; niveles de bilirrubina total (BT, proteνnas y lipoperoxidaciσn (MDA. En hematíes, actividades de superóxido dismutasa (SOD, catalasa (CAT y hemoglobina. Resultados: Se observó aumento significativo (p<0,05 en la actividad de γ-GTP entre el grupo G2 y los grupos G3 y G4. Hubo disminuciσn significativa (p<0,05 de proteνnas en el grupo G2 con respecto G1. El nivel de MDA fue menor en el grupo que recibió 200 mg/kg de EAY con respecto al control. Las actividades de AST, ALT y FAL no mostraron diferencias significativas. La relación SOD/CAT fue similar entre los grupos G1, G4 y G5, evidencia de una recuperación del daño causado por el acetaminofén. Conclusiones: La administración del EAY tuvo un efecto hepatoprotector comparable a la silimarina.

Efecto del smallanthus sonchifolius "yacón" en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007

OpenAIRE

Reyes Beltrán, María Esther Daisy

2009-01-01

Autor: María Esther Daisy Reyes Beltrán Título Tesis Doctoral: Efecto del Smallanthus sonchifolius “yacón” en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007. Asesor: Dr. Juan Jorge Huamán Saavedra. Páginas Totales: 40 Institución: Facultad de Medicina, Universidad Nacional de Trujillo. El aumento de LDL colesterol y de triglicéridos y la disminución de HDL colesterol son factores de riesgo coronario. Es de interés saber si existe alguna variació...

Giant panda BAC library construction and assembly of a 650-kb contig spanning major histocompatibility complex class II region

Directory of Open Access Journals (Sweden)

Pan Hui-Juan

2007-09-01

Full Text Available Abstract Background Giant panda is rare and endangered species endemic to China. The low rates of reproductive success and infectious disease resistance have severely hampered the development of captive and wild populations of the giant panda. The major histocompatibility complex (MHC plays important roles in immune response and reproductive system such as mate choice and mother-fetus bio-compatibility. It is thus essential to understand genetic details of the giant panda MHC. Construction of a bacterial artificial chromosome (BAC library will provide a new tool for panda genome physical mapping and thus facilitate understanding of panda MHC genes. Results A giant panda BAC library consisting of 205,800 clones has been constructed. The average insert size was calculated to be 97 kb based on the examination of 174 randomly selected clones, indicating that the giant panda library contained 6.8-fold genome equivalents. Screening of the library with 16 giant panda PCR primer pairs revealed 6.4 positive clones per locus, in good agreement with an expected 6.8-fold genomic coverage of the library. Based on this BAC library, we constructed a contig map of the giant panda MHC class II region from BTNL2 to DAXX spanning about 650 kb by a three-step method: (1 PCR-based screening of the BAC library with primers from homologous MHC class II gene loci, end sequences and BAC clone shotgun sequences, (2 DNA sequencing validation of positive clones, and (3 restriction digest fingerprinting verification of inter-clone overlapping. Conclusion The identifications of genes and genomic regions of interest are greatly favored by the availability of this giant panda BAC library. The giant panda BAC library thus provides a useful platform for physical mapping, genome sequencing or complex analysis of targeted genomic regions. The 650 kb sequence-ready BAC contig map of the giant panda MHC class II region from BTNL2 to DAXX, verified by the three-step method, offers a

Physical mapping and BAC-end sequence analysis provide initial insights into the flax (Linum usitatissimum L.) genome.

Science.gov (United States)

Ragupathy, Raja; Rathinavelu, Rajkumar; Cloutier, Sylvie

2011-05-09

Flax (Linum usitatissimum L.) is an important source of oil rich in omega-3 fatty acids, which have proven health benefits and utility as an industrial raw material. Flax seeds also contain lignans which are associated with reducing the risk of certain types of cancer. Its bast fibres have broad industrial applications. However, genomic tools needed for molecular breeding were non existent. Hence a project, Total Utilization Flax GENomics (TUFGEN) was initiated. We report here the first genome-wide physical map of flax and the generation and analysis of BAC-end sequences (BES) from 43,776 clones, providing initial insights into the genome. The physical map consists of 416 contigs spanning ~368 Mb, assembled from 32,025 fingerprints, representing roughly 54.5% to 99.4% of the estimated haploid genome (370-675 Mb). The N50 size of the contigs was estimated to be ~1,494 kb. The longest contig was ~5,562 kb comprising 437 clones. There were 96 contigs containing more than 100 clones. Approximately 54.6 Mb representing 8-14.8% of the genome was obtained from 80,337 BES. Annotation revealed that a large part of the genome consists of ribosomal DNA (~13.8%), followed by known transposable elements at 6.1%. Furthermore, ~7.4% of sequence was identified to harbour novel repeat elements. Homology searches against flax-ESTs and NCBI-ESTs suggested that ~5.6% of the transcriptome is unique to flax. A total of 4064 putative genomic SSRs were identified and are being developed as novel markers for their use in molecular breeding. The first genome-wide physical map of flax constructed with BAC clones provides a framework for accessing target loci with economic importance for marker development and positional cloning. Analysis of the BES has provided insights into the uniqueness of the flax genome. Compared to other plant genomes, the proportion of rDNA was found to be very high whereas the proportion of known transposable elements was low. The SSRs identified from BES will be

Genetic and physical maps around the sex-determining M-locus of the dioecious plant asparagus.

Science.gov (United States)

Telgmann-Rauber, Alexa; Jamsari, Ari; Kinney, Michael S; Pires, J Chris; Jung, Christian

2007-09-01

Asparagus officinalis L. is a dioecious plant. A region called the M-locus located on a pair of homomorphic sex chromosomes controls the sexual dimorphism in asparagus. The aim of this work was to clone the region determining sex in asparagus from its position in the genome. The structure of the region encompassing M should be investigated and compared to the sex-determining regions in other dioecious model species. To establish an improved basis for physical mapping, a high-resolution genetic map was enriched with AFLP markers closely linked to the target locus by carrying out a bulked segregant analysis. By screening a BAC library with AFLP- and STS-markers followed by chromosome walking, a physical map with eight contigs could be established. However, the gaps between the contigs could not be closed due to a plethora of repetitive elements. Surprisingly, two of the contigs on one side of the M-locus did not overlap although they have been established with two markers, which mapped in a distance as low as 0.25 cM flanking the sex locus. Thus, the clustering of the markers indicates a reduced recombination frequency within the M-region. On the opposite side of the M-locus, a contig was mapped in a distance of 0.38 cM. Four closely linked BAC clones were partially sequenced and 64 putative ORFs were identified. Interestingly, only 25% of the ORFs showed sequence similarity to known proteins and ESTs. In addition, an accumulation of repetitive sequences and a low gene density was revealed in the sex-determining region of asparagus. Molecular cytogenetic and sequence analysis of BACs flanking the M-locus indicate that the BACs contain highly repetitive sequences that localize to centromeric and pericentromeric locations on all asparagus chromosomes, which hindered the localization of the M-locus to the single pair of sex chromosomes. We speculate that dioecious Silene, papaya and Asparagus species may represent three stages in the evolution of XX, XY sex

Dicty_cDB: Contig-U14477-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

The binning of metagenomic contigs for microbial physiology of mixed cultures.

Science.gov (United States)

Strous, Marc; Kraft, Beate; Bisdorf, Regina; Tegetmeyer, Halina E

2012-01-01

So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population. In the present study eight metagenomic samples from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to existing algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a 100 times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt).

The binning of metagenomic contigs for microbial physiology of mixed cultures

Directory of Open Access Journals (Sweden)

Marc eStrous

2012-12-01

Full Text Available So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population.In the present study eight metagenomic samples originating from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to exisiting algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a hunderd times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt.

CSAR-web: a web server of contig scaffolding using algebraic rearrangements.

Science.gov (United States)

Chen, Kun-Tze; Lu, Chin Lung

2018-05-04

CSAR-web is a web-based tool that allows the users to efficiently and accurately scaffold (i.e. order and orient) the contigs of a target draft genome based on a complete or incomplete reference genome from a related organism. It takes as input a target genome in multi-FASTA format and a reference genome in FASTA or multi-FASTA format, depending on whether the reference genome is complete or incomplete, respectively. In addition, it requires the users to choose either 'NUCmer on nucleotides' or 'PROmer on translated amino acids' for CSAR-web to identify conserved genomic markers (i.e. matched sequence regions) between the target and reference genomes, which are used by the rearrangement-based scaffolding algorithm in CSAR-web to order and orient the contigs of the target genome based on the reference genome. In the output page, CSAR-web displays its scaffolding result in a graphical mode (i.e. scalable dotplot) allowing the users to visually validate the correctness of scaffolded contigs and in a tabular mode allowing the users to view the details of scaffolds. CSAR-web is available online at http://genome.cs.nthu.edu.tw/CSAR-web.

AAV-dominant negative tumor necrosis factor (DN-TNF gene transfer to the striatum does not rescue medium spiny neurons in the YAC128 mouse model of Huntington's disease.

Directory of Open Access Journals (Sweden)

Laura Taylor Alto

Full Text Available CNS inflammation is a hallmark of neurodegenerative disease, and recent studies suggest that the inflammatory response may contribute to neuronal demise. In particular, increased tumor necrosis factor (TNF signaling is implicated in the pathology of both Parkinson's disease (PD and Alzheimer's disease (AD. We have previously shown that localized gene delivery of dominant negative TNF to the degenerating brain region can limit pathology in animal models of PD and AD. TNF is upregulated in Huntington's disease (HD, like in PD and AD, but it is unknown whether TNF signaling contributes to neuronal degeneration in HD. We used in vivo gene delivery to test whether selective reduction of soluble TNF signaling could attenuate medium spiny neuron (MSN degeneration in the YAC128 transgenic (TG mouse model of Huntington's disease (HD. AAV vectors encoding cDNA for dominant-negative tumor necrosis factor (DN-TNF or GFP (control were injected into the striatum of young adult wild type WT and YAC128 TG mice and achieved 30-50% target coverage. Expression of dominant negative TNF protein was confirmed immunohistologically and biochemically and was maintained as mice aged to one year, but declined significantly over time. However, the extent of striatal DN-TNF gene transfer achieved in our studies was not sufficient to achieve robust effects on neuroinflammation, rescue degenerating MSNs or improve motor function in treated mice. Our findings suggest that alternative drug delivery strategies should be explored to determine whether greater target coverage by DN-TNF protein might afford some level of neuroprotection against HD-like pathology and/or that soluble TNF signaling may not be the primary driver of striatal neuroinflammation and MSN loss in YAC128 TG mice.

Human cDNA mapping using fluorescence in situ hybridization. Progress report, April 1, 1992--December 31, 1992

Energy Technology Data Exchange (ETDEWEB)

Korenberg, J.R.

1993-03-04

Genetic mapping is approached using the techniques of high resolution fluorescence in situ hybridization (FISH). This technology and the results of its application are designed to rapidly generate whole genome as tool box of expressed sequence to speed the identification of human disease genes. The results of this study are intended to dovetail with and to link the results of existing technologies for creating backbone YAC and genetic maps. In the first eight months, this approach generated 60--80% of the expressed sequence map, the remainder expected to be derived through more long-term, labor-intensive, regional chromosomal gene searches or sequencing. The laboratory has made significant progress in the set-up phase, in mapping fetal and adult brain and other cDNAs, in testing a model system for directly linking genetic and physical maps using FISH with small fragments, in setting up a database, and in establishing the validity and throughput of the system.

Human cDNA mapping using fluorescence in situ hybridization. Progress report, April 1--December 31, 1992

Energy Technology Data Exchange (ETDEWEB)

Korenberg, J.R.

1993-12-31

The ultimate goal of this proposal is to create a cDNA map of the human genome. Mapping is approached using the techniques of high resolution fluorescence in situ hybridization (FISH). This technology and the results of its application are designed to rapidly generate whole genome as tool box of expressed sequence to speed the identification of human disease genes. The results of this study are intended to dovetail with and to link the results of existing technologies for creating backbone YAC and genetic maps. In the first eight months, this approach will generate 60--80% of the expressed sequence map, the remainder expected to be derived through more long-term, labor-intensive, regional chromosomal gene searches or sequencing. The laboratory has made significant progress in the set-up phase, in mapping fetal and adult brain and other cDNAs, in testing a model system for directly linking genetic and physical maps using FISH with small fragments, in setting up a database, and in establishing the validity and throughput of the system.

Physical mapping and BAC-end sequence analysis provide initial insights into the flax (Linum usitatissimum L. genome

Directory of Open Access Journals (Sweden)

Cloutier Sylvie

2011-05-01

Full Text Available Abstract Background Flax (Linum usitatissimum L. is an important source of oil rich in omega-3 fatty acids, which have proven health benefits and utility as an industrial raw material. Flax seeds also contain lignans which are associated with reducing the risk of certain types of cancer. Its bast fibres have broad industrial applications. However, genomic tools needed for molecular breeding were non existent. Hence a project, Total Utilization Flax GENomics (TUFGEN was initiated. We report here the first genome-wide physical map of flax and the generation and analysis of BAC-end sequences (BES from 43,776 clones, providing initial insights into the genome. Results The physical map consists of 416 contigs spanning ~368 Mb, assembled from 32,025 fingerprints, representing roughly 54.5% to 99.4% of the estimated haploid genome (370-675 Mb. The N50 size of the contigs was estimated to be ~1,494 kb. The longest contig was ~5,562 kb comprising 437 clones. There were 96 contigs containing more than 100 clones. Approximately 54.6 Mb representing 8-14.8% of the genome was obtained from 80,337 BES. Annotation revealed that a large part of the genome consists of ribosomal DNA (~13.8%, followed by known transposable elements at 6.1%. Furthermore, ~7.4% of sequence was identified to harbour novel repeat elements. Homology searches against flax-ESTs and NCBI-ESTs suggested that ~5.6% of the transcriptome is unique to flax. A total of 4064 putative genomic SSRs were identified and are being developed as novel markers for their use in molecular breeding. Conclusion The first genome-wide physical map of flax constructed with BAC clones provides a framework for accessing target loci with economic importance for marker development and positional cloning. Analysis of the BES has provided insights into the uniqueness of the flax genome. Compared to other plant genomes, the proportion of rDNA was found to be very high whereas the proportion of known transposable

The European sea bass Dicentrarchus labrax genome puzzle: comparative BAC-mapping and low coverage shotgun sequencing

Directory of Open Access Journals (Sweden)

Volckaert Filip AM

2010-01-01

Full Text Available Abstract Background Food supply from the ocean is constrained by the shortage of domesticated and selected fish. Development of genomic models of economically important fishes should assist with the removal of this bottleneck. European sea bass Dicentrarchus labrax L. (Moronidae, Perciformes, Teleostei is one of the most important fishes in European marine aquaculture; growing genomic resources put it on its way to serve as an economic model. Results End sequencing of a sea bass genomic BAC-library enabled the comparative mapping of the sea bass genome using the three-spined stickleback Gasterosteus aculeatus genome as a reference. BAC-end sequences (102,690 were aligned to the stickleback genome. The number of mappable BACs was improved using a two-fold coverage WGS dataset of sea bass resulting in a comparative BAC-map covering 87% of stickleback chromosomes with 588 BAC-contigs. The minimum size of 83 contigs covering 50% of the reference was 1.2 Mbp; the largest BAC-contig comprised 8.86 Mbp. More than 22,000 BAC-clones aligned with both ends to the reference genome. Intra-chromosomal rearrangements between sea bass and stickleback were identified. Size distributions of mapped BACs were used to calculate that the genome of sea bass may be only 1.3 fold larger than the 460 Mbp stickleback genome. Conclusions The BAC map is used for sequencing single BACs or BAC-pools covering defined genomic entities by second generation sequencing technologies. Together with the WGS dataset it initiates a sea bass genome sequencing project. This will allow the quantification of polymorphisms through resequencing, which is important for selecting highly performing domesticated fish.

CBrowse: a SAM/BAM-based contig browser for transcriptome assembly visualization and analysis.

Science.gov (United States)

Li, Pei; Ji, Guoli; Dong, Min; Schmidt, Emily; Lenox, Douglas; Chen, Liangliang; Liu, Qi; Liu, Lin; Zhang, Jie; Liang, Chun

2012-09-15

To address the impending need for exploring rapidly increased transcriptomics data generated for non-model organisms, we developed CBrowse, an AJAX-based web browser for visualizing and analyzing transcriptome assemblies and contigs. Designed in a standard three-tier architecture with a data pre-processing pipeline, CBrowse is essentially a Rich Internet Application that offers many seamlessly integrated web interfaces and allows users to navigate, sort, filter, search and visualize data smoothly. The pre-processing pipeline takes the contig sequence file in FASTA format and its relevant SAM/BAM file as the input; detects putative polymorphisms, simple sequence repeats and sequencing errors in contigs and generates image, JSON and database-compatible CSV text files that are directly utilized by different web interfaces. CBowse is a generic visualization and analysis tool that facilitates close examination of assembly quality, genetic polymorphisms, sequence repeats and/or sequencing errors in transcriptome sequencing projects. CBrowse is distributed under the GNU General Public License, available at http://bioinfolab.muohio.edu/CBrowse/ liangc@muohio.edu or liangc.mu@gmail.com; glji@xmu.edu.cn Supplementary data are available at Bioinformatics online.

Dicty_cDB: Contig-U05126-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

Radiation hybrid mapping as one of the main methods of the creation of high resolution maps of human and animal genomes

International Nuclear Information System (INIS)

Sulimova, G.E.; Kompanijtsev, A.A.; Mojsyak, E.V.; Rakhmanaliev, Eh.R.; Klimov, E.A.; Udina, I.G.; Zakharov, I.A.

2000-01-01

Radiation hybrid mapping (RH mapping) is considered as one of the main method of constructing physical maps of mammalian genomes. In introduction, theoretical prerequisites of developing of the RH mapping and statistical methods of data analysis are discussed. Comparative characteristics of universal commercial panels of the radiation hybrid somatic cells (RH panels) are shown. In experimental part of the work, RH mapping is used to localize nucleotide sequences adjacent to Not I sites of human chromosome 3 with the aim to integrate contig map of Nor I clones to comprehensive maps of human genome. Five nucleotide sequences adjacent to the sites of integration of papilloma virus in human genome and expressed in the cells of cervical cancer involved localized. It is demonstrated that the region 13q14.3-q21.1 was enriched with nucleotide sequences involved in the processes of carcinogenesis. RH mapping can be considered as one of the most perspective applications of modern radiation biology in the field of molecular genetics, that is, in constructing physical maps of mammalian genomes with high resolution level [ru

Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles

Directory of Open Access Journals (Sweden)

Boussaha Mekki

2006-05-01

Full Text Available Abstract Background The Fragile Histidine Triad gene (FHIT is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. Results The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. Conclusion A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis

Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT) tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles.

Science.gov (United States)

Uboldi, Cristina; Guidi, Elena; Roperto, Sante; Russo, Valeria; Roperto, Franco; Di Meo, Giulia Pia; Iannuzzi, Leopoldo; Floriot, Sandrine; Boussaha, Mekki; Eggen, André; Ferretti, Luca

2006-05-23

The Fragile Histidine Triad gene (FHIT) is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis, especially of vesical papillomavirus-associated cancers of

Whole-genome shotgun optical mapping of rhodospirillumrubrum

Energy Technology Data Exchange (ETDEWEB)

Reslewic, Susan; Zhou, Shiguo; Place, Mike; Zhang, Yaoping; Briska, Adam; Goldstein, Steve; Churas, Chris; Runnheim, Rod; Forrest,Dan; Lim, Alex; Lapidus, Alla; Han, Cliff S.; Roberts, Gary P.; Schwartz,David C.

2004-07-01

Rhodospirillum rubrum is a phototrophic purple non-sulfur bacterium known for its unique and well-studied nitrogen fixation and carbon monoxide oxidation systems, and as a source of hydrogen and biodegradable plastics production. To better understand this organism and to facilitate assembly of its sequence, three whole-genome restriction maps (Xba I, Nhe I, and Hind III) of R. rubrum strain ATCC 11170 were created by optical mapping. Optical mapping is a system for creating whole-genome ordered restriction maps from randomly sheared genomic DNA molecules extracted directly from cells. During the sequence finishing process, all three optical maps confirmed a putative error in sequence assembly, while the Hind III map acted as a scaffold for high resolution alignment with sequence contigs spanning the whole genome. In addition to highlighting optical mapping's role in the assembly and validation of genome sequence, our work underscores the unique niche in resolution occupied by the optical mapping system. With a resolution ranging from 6.5 kb (previously published) to 45 kb (reported here), optical mapping advances a ''molecular cytogenetics'' approach to solving problems in genomic analysis.

Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

Directory of Open Access Journals (Sweden)

Silvina Maldonado

2008-06-01

Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se agregó benzoato de sodio, metabisulfito de sodio y ácido cítrico. Se desarrolló un dulce tipo pan. Se registró la evolución de temperatura durante la cocción. Se empacó y envasó el dulce en bandejas. Se analizaron parámetros de textura principales y secundarios. La formulación que alcanzó valores de textura similares a la referencia fue: 0,48% de agar-agar; 12% de sacarosa; 17% de glucosa; 23% de agua; 996,75 ppm de metabisulfito; 498,50 ppm de ácido cítrico y 1435,7 ppm de benzoato de sodio. Se realizó una prueba sensorial a través de la evaluación de los parámetros más representativos de la textura, utilizando para ello una escala hedónica, determinando la aceptación de la formulación seleccionada.O yacón (Smallanthus sonchifolius é um tubérculo andino cultivado nas encostas Dos Andes. É uma planta perene que chega a sua maduração entre 6 meses e 1 ano. Este trabalho propõe a formulação de um produto alimentício a partir do yacón agregando solutos: glicose, sacarose e combinação de barreiras de estresse. Estudou-se o efeito de gelificantes: ágar-ágar e arábica, em três concentrações 0.30, 0.41 e 0.48%. Agregou-se benzoato de sódio, metabisulfito de sódio, e ácido cítrico. Desenvolveu-se um doce tipo pão. Registrou-se a evolução da temperatura durate cozimento. Empacotou-se e envasou-se o doce em bandejas. Analisaram-se parâmetros de textura principais e secundários. A formulação que atingiu os

Dicty_cDB: Contig-U11311-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available A from... 58 6e-07 2 ( AM481444 ) Vitis vinifera contig VV78X144362.4, whole genome... 68 1e-06 1 ( AY604469 ) Prodonto...117 4e-27 AY604469_1( AY604469 |pid:none) Prodontorhabditis wirthi strain DF... 125 5e-27 ( P25202 ) RecName

Physical mapping of a large plant genome using global high-information-content-fingerprinting: the distal region of the wheat ancestor Aegilops tauschii chromosome 3DS

Directory of Open Access Journals (Sweden)

You Frank M

2010-06-01

Full Text Available Abstract Background Physical maps employing libraries of bacterial artificial chromosome (BAC clones are essential for comparative genomics and sequencing of large and repetitive genomes such as those of the hexaploid bread wheat. The diploid ancestor of the D-genome of hexaploid wheat (Triticum aestivum, Aegilops tauschii, is used as a resource for wheat genomics. The barley diploid genome also provides a good model for the Triticeae and T. aestivum since it is only slightly larger than the ancestor wheat D genome. Gene co-linearity between the grasses can be exploited by extrapolating from rice and Brachypodium distachyon to Ae. tauschii or barley, and then to wheat. Results We report the use of Ae. tauschii for the construction of the physical map of a large distal region of chromosome arm 3DS. A physical map of 25.4 Mb was constructed by anchoring BAC clones of Ae. tauschii with 85 EST on the Ae. tauschii and barley genetic maps. The 24 contigs were aligned to the rice and B. distachyon genomic sequences and a high density SNP genetic map of barley. As expected, the mapped region is highly collinear to the orthologous chromosome 1 in rice, chromosome 2 in B. distachyon and chromosome 3H in barley. However, the chromosome scale of the comparative maps presented provides new insights into grass genome organization. The disruptions of the Ae. tauschii-rice and Ae. tauschii-Brachypodium syntenies were identical. We observed chromosomal rearrangements between Ae. tauschii and barley. The comparison of Ae. tauschii physical and genetic maps showed that the recombination rate across the region dropped from 2.19 cM/Mb in the distal region to 0.09 cM/Mb in the proximal region. The size of the gaps between contigs was evaluated by comparing the recombination rate along the map with the local recombination rates calculated on single contigs. Conclusions The physical map reported here is the first physical map using fingerprinting of a complete

Mapping of Micro-Tom BAC-End Sequences to the Reference Tomato Genome Reveals Possible Genome Rearrangements and Polymorphisms

Science.gov (United States)

Asamizu, Erika; Shirasawa, Kenta; Hirakawa, Hideki; Sato, Shusei; Tabata, Satoshi; Yano, Kentaro; Ariizumi, Tohru; Shibata, Daisuke; Ezura, Hiroshi

2012-01-01

A total of 93,682 BAC-end sequences (BESs) were generated from a dwarf model tomato, cv. Micro-Tom. After removing repetitive sequences, the BESs were similarity searched against the reference tomato genome of a standard cultivar, “Heinz 1706.” By referring to the “Heinz 1706” physical map and by eliminating redundant or nonsignificant hits, 28,804 “unique pair ends” and 8,263 “unique ends” were selected to construct hypothetical BAC contigs. The total physical length of the BAC contigs was 495, 833, 423 bp, covering 65.3% of the entire genome. The average coverage of euchromatin and heterochromatin was 58.9% and 67.3%, respectively. From this analysis, two possible genome rearrangements were identified: one in chromosome 2 (inversion) and the other in chromosome 3 (inversion and translocation). Polymorphisms (SNPs and Indels) between the two cultivars were identified from the BLAST alignments. As a result, 171,792 polymorphisms were mapped on 12 chromosomes. Among these, 30,930 polymorphisms were found in euchromatin (1 per 3,565 bp) and 140,862 were found in heterochromatin (1 per 2,737 bp). The average polymorphism density in the genome was 1 polymorphism per 2,886 bp. To facilitate the use of these data in Micro-Tom research, the BAC contig and polymorphism information are available in the TOMATOMICS database. PMID:23227037

Whole-genome shotgun optical mapping of Rhodospirillum rubrum

Energy Technology Data Exchange (ETDEWEB)

Reslewic, S. [Univ. Wisc.-Madison; Zhou, S. [Univ. Wisc.-Madison; Place, M. [Univ. Wisc.-Madison; Zhang, Y. [Univ. Wisc.-Madison; Briska, A. [Univ. Wisc.-Madison; Goldstein, S. [Univ. Wisc.-Madison; Churas, C. [Univ. Wisc.-Madison; Runnheim, R. [Univ. Wisc.-Madison; Forrest, D. [Univ. Wisc.-Madison; Lim, A. [Univ. Wisc.-Madison; Lapidus, A. [Univ. Wisc.-Madison; Han, C. S. [Univ. Wisc.-Madison; Roberts, G. P. [Univ. Wisc.-Madison; Schwartz, D. C. [Univ. Wisc.-Madison

2005-09-01

Rhodospirillum rubrum is a phototrophic purple nonsulfur bacterium known for its unique and well-studied nitrogen fixation and carbon monoxide oxidation systems and as a source of hydrogen and biodegradable plastic production. To better understand this organism and to facilitate assembly of its sequence, three whole-genome restriction endonuclease maps (XbaI, NheI, and HindIII) of R. rubrum strain ATCC 11170 were created by optical mapping. Optical mapping is a system for creating whole-genome ordered restriction endonuclease maps from randomly sheared genomic DNA molecules extracted from cells. During the sequence finishing process, all three optical maps confirmed a putative error in sequence assembly, while the HindIII map acted as a scaffold for high-resolution alignment with sequence contigs spanning the whole genome. In addition to highlighting optical mapping's role in the assembly and confirmation of genome sequence, this work underscores the unique niche in resolution occupied by the optical mapping system. With a resolution ranging from 6.5 kb (previously published) to 45 kb (reported here), optical mapping advances a "molecular cytogenetics" approach to solving problems in genomic analysis.

Mapping analysis of scaffold/matrix attachment regions (s/MARs) from two different mammalian cell lines

Energy Technology Data Exchange (ETDEWEB)

Pilus, Nur Shazwani Mohd; Ahmad, Azrin; Yusof, Nurul Yuziana Mohd [School of Bioscience and Biotechnology, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia); Johari, Norazfa [Department of Chemical and Process Engineering, Faculty of Engineering and Built Environment, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)

2014-09-03

Scaffold/matrix attachment regions (S/MARs) are potential element that can be integrated into expression vector to increase expression of recombinant protein. Many studies on S/MAR have been done but none has revealed the distribution of S/MAR in a genome. In this study, we have isolated S/MAR sequences from HEK293 and Chinese hamster ovary cell lines (CHO DG44) using two different methods utilizing 2 M NaCl and lithium-3,5-diiodosalicylate (LIS). The isolated S/MARs were sequenced using Next Generation Sequencing (NGS) platform. Based on reference mapping analysis against human genome database, a total of 8,994,856 and 8,412,672 contigs of S/MAR sequences were retrieved from 2M NaCl and LIS extraction of HEK293 respectively. On the other hand, reference mapping analysis of S/MAR derived from CHO DG44 against our own CHO DG44 database have generated a total of 7,204,348 and 4,672,913 contigs from 2 M NaCl and LIS extraction method respectively.

Mapping analysis of scaffold/matrix attachment regions (s/MARs) from two different mammalian cell lines

International Nuclear Information System (INIS)

Pilus, Nur Shazwani Mohd; Ahmad, Azrin; Yusof, Nurul Yuziana Mohd; Johari, Norazfa

2014-01-01

Scaffold/matrix attachment regions (S/MARs) are potential element that can be integrated into expression vector to increase expression of recombinant protein. Many studies on S/MAR have been done but none has revealed the distribution of S/MAR in a genome. In this study, we have isolated S/MAR sequences from HEK293 and Chinese hamster ovary cell lines (CHO DG44) using two different methods utilizing 2 M NaCl and lithium-3,5-diiodosalicylate (LIS). The isolated S/MARs were sequenced using Next Generation Sequencing (NGS) platform. Based on reference mapping analysis against human genome database, a total of 8,994,856 and 8,412,672 contigs of S/MAR sequences were retrieved from 2M NaCl and LIS extraction of HEK293 respectively. On the other hand, reference mapping analysis of S/MAR derived from CHO DG44 against our own CHO DG44 database have generated a total of 7,204,348 and 4,672,913 contigs from 2 M NaCl and LIS extraction method respectively

Dicty_cDB: Contig-U16102-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

Radiation hybrid maps of the D-genome of Aegilops tauschii and their application in sequence assembly of large and complex plant genomes.

Science.gov (United States)

Kumar, Ajay; Seetan, Raed; Mergoum, Mohamed; Tiwari, Vijay K; Iqbal, Muhammad J; Wang, Yi; Al-Azzam, Omar; Šimková, Hana; Luo, Ming-Cheng; Dvorak, Jan; Gu, Yong Q; Denton, Anne; Kilian, Andrzej; Lazo, Gerard R; Kianian, Shahryar F

2015-10-16

The large and complex genome of bread wheat (Triticum aestivum L., ~17 Gb) requires high resolution genome maps with saturated marker scaffolds to anchor and orient BAC contigs/ sequence scaffolds for whole genome assembly. Radiation hybrid (RH) mapping has proven to be an excellent tool for the development of such maps for it offers much higher and more uniform marker resolution across the length of the chromosome compared to genetic mapping and does not require marker polymorphism per se, as it is based on presence (retention) vs. absence (deletion) marker assay. In this study, a 178 line RH panel was genotyped with SSRs and DArT markers to develop the first high resolution RH maps of the entire D-genome of Ae. tauschii accession AL8/78. To confirm map order accuracy, the AL8/78-RH maps were compared with:1) a DArT consensus genetic map constructed using more than 100 bi-parental populations, 2) a RH map of the D-genome of reference hexaploid wheat 'Chinese Spring', and 3) two SNP-based genetic maps, one with anchored D-genome BAC contigs and another with anchored D-genome sequence scaffolds. Using marker sequences, the RH maps were also anchored with a BAC contig based physical map and draft sequence of the D-genome of Ae. tauschii. A total of 609 markers were mapped to 503 unique positions on the seven D-genome chromosomes, with a total map length of 14,706.7 cR. The average distance between any two marker loci was 29.2 cR which corresponds to 2.1 cM or 9.8 Mb. The average mapping resolution across the D-genome was estimated to be 0.34 Mb (Mb/cR) or 0.07 cM (cM/cR). The RH maps showed almost perfect agreement with several published maps with regard to chromosome assignments of markers. The mean rank correlations between the position of markers on AL8/78 maps and the four published maps, ranged from 0.75 to 0.92, suggesting a good agreement in marker order. With 609 mapped markers, a total of 2481 deletions for the whole D-genome were detected with an average

A bacterial artificial chromosome-based physical map of Manihot esculenta ssp.flabellifolia

Institute of Scientific and Technical Information of China (English)

Yuhua FU; Zhiqiang XIA; Shujuan WANG; Xin CHEN; Cheng LU; Mingcheng LUO; Hongbin ZHANG; Wenquan WANG

2016-01-01

Cassava (Manihot esculenta) is known as the third most important food crop in the tropics and also used for industrial feedstock for biofuels.Two new bacterial artificial chromosome (BAC) libraries were constructed for W14 (M.Esculenta ssp.flabellifolia),a wild ancestor of domesticated cassava.The libraries were constructed with EcoRI and HindⅢ insertion vectors,respectively.The EcoRI library has 29952 clones with an average insert size of 115 kb,while the HindⅢ library consists of 29952 clones with an average insert of 129 kb.The combined libraries contain a total of 59904 clones with an average insert size of 125 kb,representing approximately 10×haploid genome equivalents.A total of 29952 clones were fingerprinted and resulted in a cassava physical map composed of 2485 contigs with an average physical length of 336 kb and 2909 singletons,representing approximately 762 Mb of the cassava genome.5000 clones located at the ends of BAC contigs were selected and sequenced.A total of 6077 SNPs and 231 indels were identified,that covered 459 gene sequences,of which 6 genes were associated with starch and sucrose metabolism.This BAC-based physical map provides valuable tools to understand the genetics and evolution of cassava.

A segment of the apospory-specific genomic region is highly microsyntenic not only between the apomicts Pennisetum squamulatum and buffelgrass, but also with a rice chromosome 11 centromeric-proximal genomic region.

Science.gov (United States)

Gualtieri, Gustavo; Conner, Joann A; Morishige, Daryl T; Moore, L David; Mullet, John E; Ozias-Akins, Peggy

2006-03-01

Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory.

A Segment of the Apospory-Specific Genomic Region Is Highly Microsyntenic Not Only between the Apomicts Pennisetum squamulatum and Buffelgrass, But Also with a Rice Chromosome 11 Centromeric-Proximal Genomic Region1[W

Science.gov (United States)

Gualtieri, Gustavo; Conner, Joann A.; Morishige, Daryl T.; Moore, L. David; Mullet, John E.; Ozias-Akins, Peggy

2006-01-01

Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory. PMID:16415213

Fine Mapping Suggests that the Goat Polled Intersex Syndrome and the Human Blepharophimosis Ptosis Epicanthus Syndrome Map to a 100-kb Homologous Region

OpenAIRE

Schibler, Laurent; Cribiu, Edmond P.; Oustry-Vaiman, Anne; Furet, Jean-Pierre; Vaiman, Daniel

2000-01-01

To clone the goat Polled Intersex Syndrome (PIS) gene(s), a chromosome walk was performed from six entry points at 1q43. This enabled 91 BACs to be recovered from a recently constructed goat BAC library. Six BAC contigs of goat chromosome 1q43 (ICC1–ICC6) were thus constructed covering altogether 4.5 Mb. A total of 37 microsatellite sequences were isolated from this 4.5-Mb region (16 in this study), of which 33 were genotyped and mapped. ICC3 (1500 kb) was shown by genetic analysis to encompa...

Leaf morphology in Cowpea [Vigna unguiculata (L.) Walp]: QTL analysis, physical mapping and identifying a candidate gene using synteny with model legume species.

Science.gov (United States)

Pottorff, Marti; Ehlers, Jeffrey D; Fatokun, Christian; Roberts, Philip A; Close, Timothy J

2012-06-12

Cowpea [Vigna unguiculata (L.) Walp] exhibits a considerable variation in leaf shape. Although cowpea is mostly utilized as a dry grain and animal fodder crop, cowpea leaves are also used as a high-protein pot herb in many countries of Africa. Leaf morphology was studied in the cowpea RIL population, Sanzi (sub-globose leaf shape) x Vita 7 (hastate leaf shape). A QTL for leaf shape, Hls (hastate leaf shape), was identified on the Sanzi x Vita 7 genetic map spanning from 56.54 cM to 67.54 cM distance on linkage group 15. SNP marker 1_0910 was the most significant over the two experiments, accounting for 74.7% phenotypic variance (LOD 33.82) in a greenhouse experiment and 71.5% phenotypic variance (LOD 30.89) in a field experiment. The corresponding Hls locus was positioned on the cowpea consensus genetic map on linkage group 4, spanning from 25.57 to 35.96 cM. A marker-trait association of the Hls region identified SNP marker 1_0349 alleles co-segregating with either the hastate or sub-globose leaf phenotype. High co-linearity was observed for the syntenic Hls region in Medicago truncatula and Glycine max. One syntenic locus for Hls was identified on Medicago chromosome 7 while syntenic regions for Hls were identified on two soybean chromosomes, 3 and 19. In all three syntenic loci, an ortholog for the EZA1/SWINGER (AT4G02020.1) gene was observed and is the candidate gene for the Hls locus. The Hls locus was identified on the cowpea physical map via SNP markers 1_0910, 1_1013 and 1_0992 which were identified in three BAC contigs; contig926, contig821 and contig25. This study has demonstrated how integrated genomic resources can be utilized for a candidate gene approach. Identification of genes which control leaf morphology may be utilized to improve the quality of cowpea leaves for vegetable and or forage markets as well as contribute to more fundamental research understanding the control of leaf shape in legumes.

Sequence analysis and transcript identification within 1.5 MB of DNA deleted together with the NDP and MAO genes in atypical Norrie disease patients presenting with a profound phenotype.

Science.gov (United States)

Suárez-Merino, B; Bye, J; McDowall, J; Ross, M; Craig, I W

2001-06-01

Mutations at the Norrie disease gene locus, NDP, manifest in a broad range of defects. These range from a relatively mild, late-onset, exudative vitreoretinopathy to congenital blindness and sensorineural deafness combined, in some cases, with mental retardation. In addition, extensive deletions involving the NDP locus, located at Xp11.3, the adjacent monoamine oxidadase genes MAOA and MAOB, and additional material, result in a more severe pattern of symptoms. The phenotypes include all or some of the following; mental retardation, involuntary movements, hypertensive crises and hypogonadism. We extended an existing YAC contig to embrace the boundaries of three of the largest deletions and converted this into four PAC contigs. Computer analysis and experimental data have resulted in the identification of several putative loci, including a phosphatase inhibitor 2-like gene (dJ154.1) and a 250-bp sequence which resembles a homeobox domain (dA113.3), 1.2 Mb and 400 kb respectively from the MAO/NDP cluster. The pattern of expression of dJ154.1 suggests that it may represent an important factor contributing to the complex phenotypes of these deletion patients. Hum Mutat 17:523, 2001. Copyright 2001 Wiley-Liss, Inc.

Integrated consensus genetic and physical maps of flax (Linum usitatissimum L.).

Science.gov (United States)

Cloutier, Sylvie; Ragupathy, Raja; Miranda, Evelyn; Radovanovic, Natasa; Reimer, Elsa; Walichnowski, Andrzej; Ward, Kerry; Rowland, Gordon; Duguid, Scott; Banik, Mitali

2012-12-01

Three linkage maps of flax (Linum usitatissimum L.) were constructed from populations CDC Bethune/Macbeth, E1747/Viking and SP2047/UGG5-5 containing between 385 and 469 mapped markers each. The first consensus map of flax was constructed incorporating 770 markers based on 371 shared markers including 114 that were shared by all three populations and 257 shared between any two populations. The 15 linkage group map corresponds to the haploid number of chromosomes of this species. The marker order of the consensus map was largely collinear in all three individual maps but a few local inversions and marker rearrangements spanning short intervals were observed. Segregation distortion was present in all linkage groups which contained 1-52 markers displaying non-Mendelian segregation. The total length of the consensus genetic map is 1,551 cM with a mean marker density of 2.0 cM. A total of 670 markers were anchored to 204 of the 416 fingerprinted contigs of the physical map corresponding to ~274 Mb or 74 % of the estimated flax genome size of 370 Mb. This high resolution consensus map will be a resource for comparative genomics, genome organization, evolution studies and anchoring of the whole genome shotgun sequence.

High-resolution physical map for chromosome 16q12.1-q13, the Blau syndrome locus

Directory of Open Access Journals (Sweden)

Bonavita Gina

2002-08-01

Full Text Available Abstract Background The Blau syndrome (MIM 186580, an autosomal dominant granulomatous disease, was previously mapped to chromosome 16p12-q21. However, inconsistent physical maps of the region and consequently an unknown order of microsatellite markers, hampered us from further refining the genetic locus for the Blau syndrome. To address this problem, we constructed our own high-resolution physical map for the Blau susceptibility region. Results We generated a high-resolution physical map that provides more than 90% coverage of a refined Blau susceptibility region. The map consists of four contigs of sequence tagged site-based bacterial artificial chromosomes with a total of 124 bacterial artificial chromosomes, and spans approximately 7.5 Mbp; however, three gaps still exist in this map with sizes of 425, 530 and 375 kbp, respectively, estimated from radiation hybrid mapping. Conclusions Our high-resolution map will assist genetic studies of loci in the interval from D16S3080, near D16S409, and D16S408 (16q12.1 to 16q13.

The development of a high density linkage map for black tiger shrimp (Penaeus monodon based on cSNPs.

Directory of Open Access Journals (Sweden)

Matthew Baranski

Full Text Available Transcriptome sequencing using Illumina RNA-seq was performed on populations of black tiger shrimp from India. Samples were collected from (i four landing centres around the east coastline (EC of India, (ii survivors of a severe WSSV infection during pond culture (SUR and (iii the Andaman Islands (AI in the Bay of Bengal. Equal quantities of purified total RNA from homogenates of hepatopancreas, muscle, nervous tissue, intestinal tract, heart, gonad, gills, pleopod and lymphoid organs were combined to create AI, EC and SUR pools for RNA sequencing. De novo transcriptome assembly resulted in 136,223 contigs (minimum size 100 base pairs, bp with a total length 61 Mb, an average length of 446 bp and an average coverage of 163× across all pools. Approximately 16% of contigs were annotated with BLAST hit information and gene ontology annotations. A total of 473,620 putative SNPs/indels were identified. An Illumina iSelect genotyping array containing 6,000 SNPs was developed and used to genotype 1024 offspring belonging to seven full-sibling families. A total of 3959 SNPs were mapped to 44 linkage groups. The linkage groups consisted of between 16-129 and 13-130 markers, of length between 139-10.8 and 109.1-10.5 cM and with intervals averaging between 1.2 and 0.9 cM for the female and male maps respectively. The female map was 28% longer than the male map (4060 and 2917 cM respectively with a 1.6 higher recombination rate observed for female compared to male meioses. This approach has substantially increased expressed sequence and DNA marker resources for tiger shrimp and is a useful resource for QTL mapping and association studies for evolutionarily and commercially important traits.

Isolation, characterization and mapping of genes differentially ...

Indian Academy of Sciences (India)

integral membrane subunit integral m embrane. [Spirochaetathermophila. DSM. 6578] subunit. Contig29. (GT228392,. 324 gb. |ACU24256.1. |unknown. [Glycine m ax]. C. U24256.1. Unknown. 7. 5. 124. 312. 4E–27. GT228361,. GT228362). Contig30. (GT228396,. 964 ref|YP_002544524.1. |peptidyl prolyl. YP_002544524.1.

Construction of an integrated genetic linkage map for the A genome of Brassica napus using SSR markers derived from sequenced BACs in B. rapa

Directory of Open Access Journals (Sweden)

King Graham J

2010-10-01

Full Text Available Abstract Background The Multinational Brassica rapa Genome Sequencing Project (BrGSP has developed valuable genomic resources, including BAC libraries, BAC-end sequences, genetic and physical maps, and seed BAC sequences for Brassica rapa. An integrated linkage map between the amphidiploid B. napus and diploid B. rapa will facilitate the rapid transfer of these valuable resources from B. rapa to B. napus (Oilseed rape, Canola. Results In this study, we identified over 23,000 simple sequence repeats (SSRs from 536 sequenced BACs. 890 SSR markers (designated as BrGMS were developed and used for the construction of an integrated linkage map for the A genome in B. rapa and B. napus. Two hundred and nineteen BrGMS markers were integrated to an existing B. napus linkage map (BnaNZDH. Among these mapped BrGMS markers, 168 were only distributed on the A genome linkage groups (LGs, 18 distrubuted both on the A and C genome LGs, and 33 only distributed on the C genome LGs. Most of the A genome LGs in B. napus were collinear with the homoeologous LGs in B. rapa, although minor inversions or rearrangements occurred on A2 and A9. The mapping of these BAC-specific SSR markers enabled assignment of 161 sequenced B. rapa BACs, as well as the associated BAC contigs to the A genome LGs of B. napus. Conclusion The genetic mapping of SSR markers derived from sequenced BACs in B. rapa enabled direct links to be established between the B. napus linkage map and a B. rapa physical map, and thus the assignment of B. rapa BACs and the associated BAC contigs to the B. napus linkage map. This integrated genetic linkage map will facilitate exploitation of the B. rapa annotated genomic resources for gene tagging and map-based cloning in B. napus, and for comparative analysis of the A genome within Brassica species.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum

454 sequencing of pooled BAC clones on chromosome 3H of barley

Directory of Open Access Journals (Sweden)

Yamaji Nami

2011-05-01

Full Text Available Abstract Background Genome sequencing of barley has been delayed due to its large genome size (ca. 5,000Mbp. Among the fast sequencing systems, 454 liquid phase pyrosequencing provides the longest reads and is the most promising method for BAC clones. Here we report the results of pooled sequencing of BAC clones selected with ESTs genetically mapped to chromosome 3H. Results We sequenced pooled barley BAC clones using a 454 parallel genome sequencer. A PCR screening system based on primer sets derived from genetically mapped ESTs on chromosome 3H was used for clone selection in a BAC library developed from cultivar "Haruna Nijo". The DNA samples of 10 or 20 BAC clones were pooled and used for shotgun library development. The homology between contig sequences generated in each pooled library and mapped EST sequences was studied. The number of contigs assigned on chromosome 3H was 372. Their lengths ranged from 1,230 bp to 58,322 bp with an average 14,891 bp. Of these contigs, 240 showed homology and colinearity with the genome sequence of rice chromosome 1. A contig annotation browser supplemented with query search by unique sequence or genetic map position was developed. The identified contigs can be annotated with barley cDNAs and reference sequences on the browser. Homology analysis of these contigs with rice genes indicated that 1,239 rice genes can be assigned to barley contigs by the simple comparison of sequence lengths in both species. Of these genes, 492 are assigned to rice chromosome 1. Conclusions We demonstrate the efficiency of sequencing gene rich regions from barley chromosome 3H, with special reference to syntenic relationships with rice chromosome 1.

Dicty_cDB: Contig-U01541-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

Dicty_cDB: CHD534 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple

Molecular cloning of the papillary renal cell carcinoma-associated translocation (X;1)(p11;q21) breakpoint

NARCIS (Netherlands)

Weterman, MAJ; Janssen, [No Value; Janssen, HAP; vandenBerg, E; Fisher, SE; Craig, [No Value; vanKessel, AG

1996-01-01

A combination of Southern blot analysis on a panel of tumor-derived somatic cell hybrids and fluorescence in situ hybridization techniques was used to map YACs, cosmids and DNA markers from the Xp11.2 region relative to the X chromosome breakpoint of the renal cell carcinoma-associated

A Fine Physical Map of the Rice Chromosome 4

Science.gov (United States)

Zhao, Qiang; Zhang, Yu; Cheng, Zhukuan; Chen, Mingsheng; Wang, Shengyue; Feng, Qi; Huang, Yucheng; Li, Ying; Tang, Yesheng; Zhou, Bo; Chen, Zhehua; Yu, Shuliang; Zhu, Jingjie; Hu, Xin; Mu, Jie; Ying, Kai; Hao, Pei; Zhang, Lei; Lu, Yiqi; Zhang, Lei S.; Liu, Yilei; Yu, Zhen; Fan, Danlin; Weng, Qijun; Chen, Ling; Lu, Tingting; Liu, Xiaohui; Jia, Peixin; Sun, Tongguo; Wu, Yongrui; Zhang, Yujun; Lu, Ying; Li, Can; Wang, Rong; Lei, Haiyan; Li, Tao; Hu, Hao; Wu, Mei; Zhang, Runquan; Guan, Jianping; Zhu, Jia; Fu, Gang; Gu, Minghong; Hong, Guofan; Xue, Yongbiao; Wing, Rod; Jiang, Jiming; Han, Bin

2002-01-01

As part of an international effort to completely sequence the rice genome, we have produced a fine bacterial artificial chromosome (BAC)-based physical map of the Oryza sativa japonica Nipponbare chromosome 4 through an integration of 114 sequenced BAC clones from a taxonomically related subspecies O. sativa indica Guangluai 4 and 182 RFLP and 407 expressed sequence tag (EST) markers with the fingerprinted data of the Nipponbare genome. The map consists of 11 contigs with a total length of 34.5 Mb covering 94% of the estimated chromosome size (36.8 Mb). BAC clones corresponding to telomeres, as well as to the centromere position, were determined by BAC-pachytene chromosome fluorescence in situ hybridization (FISH). This gave rise to an estimated length ratio of 5.13 for the long arm and 2.9 for the short arm (on the basis of the physical map), which indicates that the short arm is a highly condensed one. The FISH analysis and physical mapping also showed that the short arm and the pericentromeric region of the long arm are rich in heterochromatin, which occupied 45% of the chromosome, indicating that this chromosome is likely very difficult to sequence. To our knowledge, this map provides the first example of a rapid and reliable physical mapping on the basis of the integration of the data from two taxonomically related subspecies. [The following individuals and institutions kindly provided reagents, samples, or unpublished information as indicated in the paper: S. McCouch, T. Sasaki, and Monsanto.] PMID:11997348

The physical and genetic framework of the maize B73 genome.

Directory of Open Access Journals (Sweden)

Fusheng Wei

2009-11-01

Full Text Available Maize is a major cereal crop and an important model system for basic biological research. Knowledge gained from maize research can also be used to genetically improve its grass relatives such as sorghum, wheat, and rice. The primary objective of the Maize Genome Sequencing Consortium (MGSC was to generate a reference genome sequence that was integrated with both the physical and genetic maps. Using a previously published integrated genetic and physical map, combined with in-coming maize genomic sequence, new sequence-based genetic markers, and an optical map, we dynamically picked a minimum tiling path (MTP of 16,910 bacterial artificial chromosome (BAC and fosmid clones that were used by the MGSC to sequence the maize genome. The final MTP resulted in a significantly improved physical map that reduced the number of contigs from 721 to 435, incorporated a total of 8,315 mapped markers, and ordered and oriented the majority of FPC contigs. The new integrated physical and genetic map covered 2,120 Mb (93% of the 2,300-Mb genome, of which 405 contigs were anchored to the genetic map, totaling 2,103.4 Mb (99.2% of the 2,120 Mb physical map. More importantly, 336 contigs, comprising 94.0% of the physical map ( approximately 1,993 Mb, were ordered and oriented. Finally we used all available physical, sequence, genetic, and optical data to generate a golden path (AGP of chromosome-based pseudomolecules, herein referred to as the B73 Reference Genome Sequence version 1 (B73 RefGen_v1.

Identification and Mapping of Simple Sequence Repeat Markers from Common Bean (Phaseolus vulgaris L. Bacterial Artificial Chromosome End Sequences for Genome Characterization and Genetic–Physical Map Integration

Directory of Open Access Journals (Sweden)

Juana M. Córdoba

2010-11-01

Full Text Available Microsatellite markers or simple sequence repeat (SSR loci are useful for diversity characterization and genetic–physical mapping. Different in silico microsatellite search methods have been developed for mining bacterial artificial chromosome (BAC end sequences for SSRs. The overall goal of this study was genome characterization based on SSRs in 89,017 BAC end sequences (BESs from the G19833 common bean ( L. library. Another objective was to identify new SSR taking into account three tandem motif identification programs (Automated Microsatellite Marker Development [AMMD], Tandem Repeats Finder [TRF], and SSRLocator [SSRL]. Among the microsatellite search engines, SSRL identified the highest number of SSRs; however, when primer design was attempted, the number dropped due to poor primer design regions. Automated Microsatellite Marker Development software identified many SSRs with valuable AT/TA or AG/TC motifs, while TRF found fewer SSRs and produced no primers. A subgroup of 323 AT-rich, di-, and trinucleotide SSRs were selected from the AMMD results and used in a parental survey with DOR364 and G19833, of which 75 could be mapped in the corresponding population; these represented 4052 BAC clones. Together with 92 previously mapped BES- and 114 non-BES-derived markers, a total of 280 SSRs were included in the polymerase chain reaction (PCR-based map, integrating a total of 8232 BAC clones in 162 contigs from the physical map.

COCACOLA: binning metagenomic contigs using sequence COmposition, read CoverAge, CO-alignment and paired-end read LinkAge.

Science.gov (United States)

Lu, Yang Young; Chen, Ting; Fuhrman, Jed A; Sun, Fengzhu

2017-03-15

The advent of next-generation sequencing technologies enables researchers to sequence complex microbial communities directly from the environment. Because assembly typically produces only genome fragments, also known as contigs, instead of an entire genome, it is crucial to group them into operational taxonomic units (OTUs) for further taxonomic profiling and down-streaming functional analysis. OTU clustering is also referred to as binning. We present COCACOLA, a general framework automatically bin contigs into OTUs based on sequence composition and coverage across multiple samples. The effectiveness of COCACOLA is demonstrated in both simulated and real datasets in comparison with state-of-art binning approaches such as CONCOCT, GroopM, MaxBin and MetaBAT. The superior performance of COCACOLA relies on two aspects. One is using L 1 distance instead of Euclidean distance for better taxonomic identification during initialization. More importantly, COCACOLA takes advantage of both hard clustering and soft clustering by sparsity regularization. In addition, the COCACOLA framework seamlessly embraces customized knowledge to facilitate binning accuracy. In our study, we have investigated two types of additional knowledge, the co-alignment to reference genomes and linkage of contigs provided by paired-end reads, as well as the ensemble of both. We find that both co-alignment and linkage information further improve binning in the majority of cases. COCACOLA is scalable and faster than CONCOCT, GroopM, MaxBin and MetaBAT. The software is available at https://github.com/younglululu/COCACOLA . fsun@usc.edu. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB770 (Link to dictyBase) - - - Contig-U16382-1 VFB770E (Link...) Clone ID VFB770 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyosteliu...m discoideum gene for actin A8. 2230 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 16...deum actin 15 gene, complete cds. 2030 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map

Identification and characterization of a new multigene family in the human MHC: A candidate autoimmune disease susceptibility element (3.8-1)

Energy Technology Data Exchange (ETDEWEB)

Harris, J.M.; Venditti, C.P.; Chorney, M.J. [Pennsylvania State Univ. College of Medicine, Hershey, PA (United States)

1994-09-01

An association between idiopathic hemochromatosis (HFE) and the HLA-A3 locus has been previously well-established. In an attempt to identify potential HFE candidate genes, a genomic DNA fragment distal to the HLA-A9 breakpoint was used to screen a B cell cDNA library; a member (3.8-1) of a new multigene family, composed of five distinct genomic cross-reactive fragments, was identified. Clone 3.8-1 represents the 3{prime} end of 9.6 kb transcript which is expressed in multiple tissues including the spleen, thymus, lung and kidney. Sequencing and genome database analysis indicate that 3.8-1 is unique, with no homology to any known entries. The genomic residence of 3-8.1, defined by polymorphism analysis and physical mapping using YAC clones, appears to be absent from the genomes of higher primates, although four other cross-reactivities are maintained. The absence of this gene as well as other probes which map in the TNF to HLA-B interval, suggest that this portion of the human HMC, located between the Class I and Class III regions, arose in humans as the result of a post-speciation insertional event. The large size of the 3.8-1 gene and the possible categorization of 3.8-1 as a human-specific gene are significant given the genetic data that place an autoimmune susceptibility element for IDDM and myasthenia gravis in the precise region where this gene resides. In an attempt to isolate the 5{prime} end of this large transcript, we have constructed a cosmid contig which encompasses the genomic locus of this gene and are progressively isolating coding sequences by exon trapping.

Isolation of a candidate gene for Norrie disease by positional cloning

NARCIS (Netherlands)

Berger, W.; Meindl, A.; van de Pol, T. J.; Cremers, F. P.; Ropers, H. H.; Döerner, C.; Monaco, A.; Bergen, A. A.; Lebo, R.; Warburg, M.

1992-01-01

The gene for Norrie disease, an X-linked disorder characterized by progressive atrophy of the eyes, mental disturbances and deafness, has been mapped to chromosome Xp11.4 close to DXS7 and the monoamine oxidase (MAO) genes. By subcloning a YAC with a 640 kilobases (kb) insert which spans the

Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barley (¤Hordeum vulgare¤ L.)

DEFF Research Database (Denmark)

Schwarz, G.; Michalek, W.; Jahoor, A.

2002-01-01

homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...... gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...

Dicty_cDB: CFG115 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

Precise localization of multiple epiphyseal dysplasia and pseudoachondroplasia mutations by genetic and physical mapping of chromosome 19

Energy Technology Data Exchange (ETDEWEB)

Knowlton, R.G.; Cekleniak, J.A. [Jefferson Medical College, Philadelphia, PA (United States); Cohn, D.H. [Cedars-Sinai Medical Center, Los Angeles, CA (United States)] [and others

1994-09-01

Multiple epiphyseal dysplasia (EDM1), a dominantly inherited chondrodysplasia resulting in peripheral joint deformities and premature osteoarthritis, and pseudoachondroplasia (PSACH), a more severe disorder associated with short-limbed dwarfism, have recently been mapped to the pericentromeric region of chromosome 19. Chondrocytes from some PSACH patients accumulate lamellar deposits in the endoplasmic reticulum that are immunologically cross-reactive with aggrecan. However, neither aggrecan nor any known candidate gene maps to the EDM1/PSACH region of chromosome 19. Genetic linkage mapping in two lage families had placed the disease locus between D19S215 (19p12) and D19S212 (19p13.1), an interval of about 3.5 Mb. With at least five potentially informative cross-overs within this interval, recombination mapping at greater resolution was undertaken. From cosmids assigned to the region by fluorescence in situ hybridization and contig assembly, dinucleotide repeat tracts were identified for use as polymorphic genetic markers. Linkage data from three new dinucleotide repeat markers from cosmids mapped between D19S212 and D19S215 limit the EDM1/PSACH locus to an interval spanning approximately 2 Mb.

The human homologue of unc-93 maps to chromosome 6q27 – characterisation and analysis in sporadic epithelial ovarian cancer

Directory of Open Access Journals (Sweden)

Charnock F Mark L

2002-10-01

Full Text Available Abstract Background In sporadic ovarian cancer, we have previously reported allele loss at D6S193 (62% on chromosome 6q27, which suggested the presence of a putative tumour suppressor gene. Based on our data and that from another group, the minimal region of allele loss was between D6S264 and D6S149 (7.4 cM. To identify the putative tumour suppressor gene, we established a physical map initially with YACs and subsequently with PACs/BACs from D6S264 to D6S149. To accelerate the identification of genes, we sequenced the entire contig of approximately 1.1 Mb. Seven genes were identified within the region of allele loss between D6S264 and D6S149. Results The human homologue of unc-93 (UNC93A in C. elegans was identified to be within the interval of allele loss centromeric to D6S149. This gene is 24.5 kb and comprises of 8 exons. There are two transcripts with the shorter one due to splicing out of exon 4. It is expressed in testis, small intestine, spleen, prostate, and ovary. In a panel of 8 ovarian cancer cell lines, UNC93A expression was detected by RT-PCR which identified the two transcripts in 2/8 cell lines. The entire coding sequence was examined for mutations in a panel of ovarian tumours and ovarian cancer cell lines. Mutations were identified in exons 1, 3, 4, 5, 6 and 8. Only 3 mutations were identified specifically in the tumour. These included a c.452G>A (W151X mutation in exon 3, c.676C>T (R226X in exon 5 and c.1225G>A(V409I mutation in exon 8. However, the mutations in exon 3 and 5 were also present in 6% and 2% of the normal population respectively. The UNC93A cDNA was shown to express at the cell membrane and encodes for a protein of 60 kDa. Conclusions These results suggest that no evidence for UNC93A as a tumour suppressor gene in sporadic ovarian cancer has been identified and further research is required to evaluate its normal function and role in the pathogenesis of ovarian cancer.

The Amaranth Genome: Genome, Transcriptome, and Physical Map Assembly

Directory of Open Access Journals (Sweden)

J. W. Clouse

2016-03-01

Full Text Available Amaranth ( L. is an emerging pseudocereal native to the New World that has garnered increased attention in recent years because of its nutritional quality, in particular its seed protein and more specifically its high levels of the essential amino acid lysine. It belongs to the Amaranthaceae family, is an ancient paleopolyploid that shows disomic inheritance (2 = 32, and has an estimated genome size of 466 Mb. Here we present a high-quality draft genome sequence of the grain amaranth. The genome assembly consisted of 377 Mb in 3518 scaffolds with an N of 371 kb. Repetitive element analysis predicted that 48% of the genome is comprised of repeat sequences, of which -like elements were the most commonly classified retrotransposon. A de novo transcriptome consisting of 66,370 contigs was assembled from eight different amaranth tissue and abiotic stress libraries. Annotation of the genome identified 23,059 protein-coding genes. Seven grain amaranths (, , and and their putative progenitor ( were resequenced. A single nucleotide polymorphism (SNP phylogeny supported the classification of as the progenitor species of the grain amaranths. Lastly, we generated a de novo physical map for using the BioNano Genomics’ Genome Mapping platform. The physical map spanned 340 Mb and a hybrid assembly using the BioNano physical maps nearly doubled the N of the assembly to 697 kb. Moreover, we analyzed synteny between amaranth and sugar beet ( L. and estimated, using analysis, the age of the most recent polyploidization event in amaranth.

Dicty_cDB: CHD405 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHD405 (Link to dictyBase) - - - Contig-U15984-1 CHD405E (Link... Clone ID CHD405 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15984-1 Original site URL http://dict...ts) Value N AC115599 |AC115599.2 Dictyostelium discoideum chromosome 2 map 422909...8-4354721 strain AX4, complete sequence. 42 3e-11 9 AC115598 |AC115598.2 Dictyostelium discoideum chromosome... 2 map 581427-735498 strain AX4, complete sequence. 50 4e-11 11 CK417372 |CK417372.1 AUF_IpInt_56_d19 Intestine cDNA library Ict

Chromosome region-specific libraries for human genome analysis. Final progress report, 1 March 1991--28 February 1994

Energy Technology Data Exchange (ETDEWEB)

Kao, F.T.

1994-04-01

The objectives of this grant proposal include (1) development of a chromosome microdissection and PCR-mediated microcloning technology, (2) application of this microtechnology to the construction of region-specific libraries for human genome analysis. During this grant period, the authors have successfully developed this microtechnology and have applied it to the construction of microdissection libraries for the following chromosome regions: a whole chromosome 21 (21E), 2 region-specific libraries for the long arm of chromosome 2, 2q35-q37 (2Q1) and 2q33-q35 (2Q2), and 4 region-specific libraries for the entire short arm of chromosome 2, 2p23-p25 (2P1), 2p21-p23 (2P2), 2p14-p16 (wP3) and 2p11-p13 (2P4). In addition, 20--40 unique sequence microclones have been isolated and characterized for genomic studies. These region-specific libraries and the single-copy microclones from the library have been used as valuable resources for (1) isolating microsatellite probes in linkage analysis to further refine the disease locus; (2) isolating corresponding clones with large inserts, e.g. YAC, BAC, P1, cosmid and phage, to facilitate construction of contigs for high resolution physical mapping; and (3) isolating region-specific cDNA clones for use as candidate genes. These libraries are being deposited in the American Type Culture Collection (ATCC) for general distribution.

Development of a SNP resource and a genetic linkage map for Atlantic cod (Gadus morhua

Directory of Open Access Journals (Sweden)

Higgins Brent

2010-03-01

Full Text Available Abstract Background Atlantic cod (Gadus morhua is a species with increasing economic significance for the aquaculture industry. The genetic improvement of cod will play a critical role in achieving successful large-scale aquaculture. While many microsatellite markers have been developed in cod, the number of single nucleotide polymorphisms (SNPs is currently limited. Here we report the identification of SNPs from sequence data generated by a large-scale expressed sequence tag (EST program, focusing on fish originating from Canadian waters. Results A total of 97976 ESTs were assembled to generate 13448 contigs. We detected 4753 SNPs that met our selection criteria (depth of coverage ≥ 4 reads; minor allele frequency > 25%. 3072 SNPs were selected for testing. The percentage of successful assays was 75%, with 2291 SNPs amplifying correctly. Of these, 607 (26% SNPs were monomorphic for all populations tested. In total, 64 (4% of SNPs are likely to represent duplicated genes or highly similar members of gene families, rather than alternative alleles of the same gene, since they showed a high frequency of heterozygosity. The remaining polymorphic SNPs (1620 were categorised as validated SNPs. The mean minor allele frequency of the validated loci was 0.258 (± 0.141. Of the 1514 contigs from which validated SNPs were selected, 31% have a significant blast hit. For the SNPs predicted to occur in coding regions (141, we determined that 36% (51 are non-synonymous. Many loci (1033 SNPs; 64% are polymorphic in all populations tested. However a small number of SNPs (184 that are polymorphic in the Western Atlantic were monomorphic in fish tested from three European populations. A preliminary linkage map has been constructed with 23 major linkage groups and 924 mapped SNPs. Conclusions These SNPs represent powerful tools to accelerate the genetic improvement of cod aquaculture. They have been used to build a genetic linkage map that can be applied to

Dicty_cDB: SHF448 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

Use of arbitrary DNA primers, polyacrylamide gel electrophoresis and silver staining for identity testing, gene discovery and analysis of gene expression

International Nuclear Information System (INIS)

Gresshoff, P.

1998-01-01

To understand chemically-induced genomic differences in soybean mutants differing in their ability to enter the nitrogen-fixing symbiosis involving Bradyrhizobium japonicum, molecular techniques were developed to aid the map-based, or positional, cloning. DNA marker technology involving single arbitrary primers was used to enrich regional RFLP linkage data. Molecular techniques, including two-dimensional pulse field gel electrophoresis, were developed to ascertain the first physical mapping in soybean, leading to the conclusion that in the region of marker pA-36 on linkage group H, 1 cM equals about 500 cM. High molecular weight DNA was isolated and cloned into yeast or bacterial artificial chromosomes (YACs/ BACs). YACs were used to analyze soybean genome structure, revealing that over half of the genome contains repetitive DNA. Genetic and molecular tools are now available to facilitate the isolation of plant genes directly involved in symbiosis. The further characterization of these genes, along with the determination of the mechanisms that lead to the mutation, will be of value to other plants and induced mutation research. (author)

L’Anaphore associative: contigüité métonymique

Directory of Open Access Journals (Sweden)

Gemma Peña Martínez

2008-04-01

Full Text Available Cet article porte sur les rapports de contigüité exigés lors de la résolution des anaphores associatives. Il s’agit en général de relations métonymiques, car les différents rapports, à caractère notamment socioculturel, entre référent et marque anaphorique convergent dans un même cadre conceptuel, se faisant écho d’éléments ou caractéristiques du même domaine cognitif. L’anaphore associative reprenant ainsi un attribut concret du référent, nous envisageons donc une classification de ces marques anaphoriques d’après des rapports métonymiques, tels que partie à tout, objet à matière et caractéristique ou propriété à objet.

Gene content and organization of a 281-kbp contig from the genome of the extremely thermophilic archaeon, Sulfolobus solfataricus P2

NARCIS (Netherlands)

Charlebois, R.; Confalonieri, F.; Curtis, B.; Doolittle, W.F.; Duguet, M.; Erauso, G.; Faguy, D.; Gaasterland, T.; Garrett, R.A.; Gordon, P.; Kozera, C.; Medina, N.; Oost, van der J.; Peng, X.; Ragan, M.; She, Q.; Singh, R.K.

2000-01-01

The sequence of a 281-kbp contig from the crenarchaeote Sulfolobus solfataricus P2 was determined and analysed. Notable features in this region include 29 ribosomal protein genes, 12 tRNA genes (four of which contain archaeal-type introns), operons encoding enzymes of histidine biosynthesis,

Primary proton and helium spectra at energy range from 50 TeV to 1015 eV observed with the new Tibet AS core detector array

Directory of Open Access Journals (Sweden)

Huang Jing

2013-06-01

Full Text Available A new EAS hybrid experiment has been designed by constructing a YAC (Yangbajing Air shower Core detector array inside the existing Tibet-III air shower array. The first step of YAC, called “YAC-I” has been successfully carried out in 2009–2010 together with Tibet-III air-shower array. YAC-II has also been operated from 2011. Preliminary results of YAC-I and performance of YAC-II are presented in this paper. The primary proton and helium spectra at energy range from50 TeV to 1015 eV derived from YAC-I data based on QGSJET2 and SIBYLL2.1 are reported. The obtained P+He spectrum is smoothly connected with directobservation data below 100 TeV and also with our previously reported results at higher energies within statistical error s. Based on these results and the sharp kneeof all-particle energy spectrum observed by our experiment, the possible origin of the sharp knee is discussed. See the published papers.

Full-length huntingtin levels modulate body weight by influencing insulin-like growth factor 1 expression

DEFF Research Database (Denmark)

Pouladi, Mahmoud A; Xie, Yuanyun; Skotte, Niels Henning

2010-01-01

of the IGF-1 pathway in mediating the effect of htt on body weight. IGF-1 expression was examined in transgenic mouse lines expressing different levels of FL wild-type (WT) htt (YAC18 mice), FL mutant htt (YAC128 and BACHD mice) and truncated mutant htt (shortstop mice). We demonstrate that htt influences...... body weight by modulating the IGF-1 pathway. Plasma IGF-1 levels correlate with body weight and htt levels in the transgenic YAC mice expressing human htt. The effect of htt on IGF-1 expression is independent of CAG size. No effect on body weight is observed in transgenic YAC mice expressing...... and decreases the body weight of YAC128 animals to WT levels. Furthermore, given the ubiquitous expression of IGF-1 within the central nervous system, we also examined the impact of FL htt levels on IGF-1 expression in different regions of the brain, including the striatum, cerebellum of YAC18, YAC128...

Re-annotation of the physical map of Glycine max for polyploid-like regions by BAC end sequence driven whole genome shotgun read assembly

Directory of Open Access Journals (Sweden)

Shultz Jeffry

2008-07-01

Full Text Available Abstract Background Many of the world's most important food crops have either polyploid genomes or homeologous regions derived from segmental shuffling following polyploid formation. The soybean (Glycine max genome has been shown to be composed of approximately four thousand short interspersed homeologous regions with 1, 2 or 4 copies per haploid genome by RFLP analysis, microsatellite anchors to BACs and by contigs formed from BAC fingerprints. Despite these similar regions,, the genome has been sequenced by whole genome shotgun sequence (WGS. Here the aim was to use BAC end sequences (BES derived from three minimum tile paths (MTP to examine the extent and homogeneity of polyploid-like regions within contigs and the extent of correlation between the polyploid-like regions inferred from fingerprinting and the polyploid-like sequences inferred from WGS matches. Results Results show that when sequence divergence was 1–10%, the copy number of homeologous regions could be identified from sequence variation in WGS reads overlapping BES. Homeolog sequence variants (HSVs were single nucleotide polymorphisms (SNPs; 89% and single nucleotide indels (SNIs 10%. Larger indels were rare but present (1%. Simulations that had predicted fingerprints of homeologous regions could be separated when divergence exceeded 2% were shown to be false. We show that a 5–10% sequence divergence is necessary to separate homeologs by fingerprinting. BES compared to WGS traces showed polyploid-like regions with less than 1% sequence divergence exist at 2.3% of the locations assayed. Conclusion The use of HSVs like SNPs and SNIs to characterize BACs wil improve contig building methods. The implications for bioinformatic and functional annotation of polyploid and paleopolyploid genomes show that a combined approach of BAC fingerprint based physical maps, WGS sequence and HSV-based partitioning of BAC clones from homeologous regions to separate contigs will allow reliable de

Using Growing Self-Organising Maps to Improve the Binning Process in Environmental Whole-Genome Shotgun Sequencing

Science.gov (United States)

Chan, Chon-Kit Kenneth; Hsu, Arthur L.; Tang, Sen-Lin; Halgamuge, Saman K.

2008-01-01

Metagenomic projects using whole-genome shotgun (WGS) sequencing produces many unassembled DNA sequences and small contigs. The step of clustering these sequences, based on biological and molecular features, is called binning. A reported strategy for binning that combines oligonucleotide frequency and self-organising maps (SOM) shows high potential. We improve this strategy by identifying suitable training features, implementing a better clustering algorithm, and defining quantitative measures for assessing results. We investigated the suitability of each of di-, tri-, tetra-, and pentanucleotide frequencies. The results show that dinucleotide frequency is not a sufficiently strong signature for binning 10 kb long DNA sequences, compared to the other three. Furthermore, we observed that increased order of oligonucleotide frequency may deteriorate the assignment result in some cases, which indicates the possible existence of optimal species-specific oligonucleotide frequency. We replaced SOM with growing self-organising map (GSOM) where comparable results are obtained while gaining 7%–15% speed improvement. PMID:18288261

Fine mapping of the sunflower resistance locus Pl(ARG) introduced from the wild species Helianthus argophyllus.

Science.gov (United States)

Wieckhorst, S; Bachlava, E; Dussle, C M; Tang, S; Gao, W; Saski, C; Knapp, S J; Schön, C-C; Hahn, V; Bauer, E

2010-11-01

Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus Pl(ARG) originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped Pl(ARG) on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F(2) individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with Pl(ARG) as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOS(sel) × KWS04, a population consisting of 2,780 F(2) individuals that does not segregate for Pl(ARG). A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with Pl(ARG). Two RGC-containing BAC contigs were anchored to the Pl(ARG) region on LG 1.

Empowering Youth to Take Charge of School Wellness

Science.gov (United States)

Hughes, Luanne J.; Savoca, LeeAnne; Grenci, Alexandra

2015-01-01

Youth Advisory Councils (YACs) ensure that students are represented in school wellness discussions. YACs empower students to present ideas, insights, and input on nutrition and physical activity; work alongside peers to assess wellness needs; and develop recommendations for enhancing/expanding the school wellness environment. YACs provide a…

Construction and characterization of a yeast artificial chromosome library containing seven haploid human genome equivalents

International Nuclear Information System (INIS)

Albertsen, H.M.; Abderrahim, H.; Cann, H.M.; Dausset, J.; Le Paslier, D.; Cohen, D.

1990-01-01

Prior to constructing a library of yeast artificial chromosomes (YACs) containing very large human DNA fragments, the authors performed a series of preliminary experiments aimed at developing a suitable protocol. They found an inverse relationship between YAC insert size and transformation efficiency. Evidence of occasional rearrangement within YAC inserts was found resulting in clonally stable internal deletions or clonally unstable size variations. A protocol was developed for preparative electrophoretic enrichment of high molecular mass human DNA fragments from partial restriction digests and ligation with the YAC vector in agarose. A YAC library has been constructed from large fragments of DNA from an Epstein-Barr virus-transformed human lymphoblastoid cell line. The library presently contains 50,000 clones, 95% of which are greater than 250 kilobase pairs in size. The mean YAC size of the library, calculated from 132 randomly isolated clones, is 430 kilobase pairs. The library thus contains the equivalent of approximately seven haploid human genomes

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB644 (Link to dictyBase) - - - Contig-U10683-1 VFB644F (Link... to Original site) VFB644F 519 - - - - - - Show VFB644 Library VF (Link to library) Clone ID VFB644 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10683-1 Original site URL http://dict...7 9 AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-407176... %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> predict

Área foliar del yacón (Smallanthus sonchifolius (Poep. & Endl. H. Rob. estimada mediante método indirecto.

Directory of Open Access Journals (Sweden)

Juan Francisco Seminario-Cunya

2016-12-01

Full Text Available El objetivo de este trabajo fue estimar el área foliar de ocho morfotipos de yacón mediante análisis de regresión lineal simple. La investigación se realizó entre los años 2014 y 2015, en el Programa de Raíces y Tubérculos Andinos de la Universidad Nacional de Cajamarca, Perú (7° 10’ 00’’ S, 78° 30’00’’ W, 2650 msnm. Se tomaron cien hojas de cada morfotipo, incluyendo hojas de los estratos basal, medio y terminal de plantas en plena oración. Las siluetas de las hojas frescas se dibujaron en papel y se midió el largo (L y ancho mayor de la lámina (W. El área medida (o real de la lámina se determinó con planímetro digital. Con el área medida (variable dependiente y los valores de largo, ancho, largo al cuadrado, ancho al cuadrado, largo x ancho y largo/ancho (como variables independientes, se realizó el análisis de regresión para cada morfotipo. En todos los morfotipos, excepto en dos, las mejores ecuaciones para estimar el área foliar, fueron aquellas en donde intervino el producto de L x W. La ecuación A= 20,41 + 0,4167 (L x W (r2 = 0,89 permitió estimar el área foliar de los ocho morfotipos en conjunto. El área del peciolo de los morfotipos en estudio signi có 15%, respecto del área total de la hoja.

A gene-based high-resolution comparative radiation hybrid map as a framework for genome sequence assembly of a bovine chromosome 6 region associated with QTL for growth, body composition, and milk performance traits

Directory of Open Access Journals (Sweden)

Laurent Pascal

2006-03-01

Full Text Available Abstract Background A number of different quantitative trait loci (QTL for various phenotypic traits, including milk production, functional, and conformation traits in dairy cattle as well as growth and body composition traits in meat cattle, have been mapped consistently in the middle region of bovine chromosome 6 (BTA6. Dense genetic and physical maps and, ultimately, a fully annotated genome sequence as well as their mutual connections are required to efficiently identify genes and gene variants responsible for genetic variation of phenotypic traits. A comprehensive high-resolution gene-rich map linking densely spaced bovine markers and genes to the annotated human genome sequence is required as a framework to facilitate this approach for the region on BTA6 carrying the QTL. Results Therefore, we constructed a high-resolution radiation hybrid (RH map for the QTL containing chromosomal region of BTA6. This new RH map with a total of 234 loci including 115 genes and ESTs displays a substantial increase in loci density compared to existing physical BTA6 maps. Screening the available bovine genome sequence resources, a total of 73 loci could be assigned to sequence contigs, which were already identified as specific for BTA6. For 43 loci, corresponding sequence contigs, which were not yet placed on the bovine genome assembly, were identified. In addition, the improved potential of this high-resolution RH map for BTA6 with respect to comparative mapping was demonstrated. Mapping a large number of genes on BTA6 and cross-referencing them with map locations in corresponding syntenic multi-species chromosome segments (human, mouse, rat, dog, chicken achieved a refined accurate alignment of conserved segments and evolutionary breakpoints across the species included. Conclusion The gene-anchored high-resolution RH map (1 locus/300 kb for the targeted region of BTA6 presented here will provide a valuable platform to guide high-quality assembling and

Utilization of deletion bins to anchor and order sequences along the wheat 7B chromosome.

Science.gov (United States)

Belova, Tatiana; Grønvold, Lars; Kumar, Ajay; Kianian, Shahryar; He, Xinyao; Lillemo, Morten; Springer, Nathan M; Lien, Sigbjørn; Olsen, Odd-Arne; Sandve, Simen R

2014-09-01

A total of 3,671 sequence contigs and scaffolds were mapped to deletion bins on wheat chromosome 7B providing a foundation for developing high-resolution integrated physical map for this chromosome. Bread wheat (Triticum aestivum L.) has a large, complex and highly repetitive genome which is challenging to assemble into high quality pseudo-chromosomes. As part of the international effort to sequence the hexaploid bread wheat genome by the international wheat genome sequencing consortium (IWGSC) we are focused on assembling a reference sequence for chromosome 7B. The successful completion of the reference chromosome sequence is highly dependent on the integration of genetic and physical maps. To aid the integration of these two types of maps, we have constructed a high-density deletion bin map of chromosome 7B. Using the 270 K Nimblegen comparative genomic hybridization (CGH) array on a set of cv. Chinese spring deletion lines, a total of 3,671 sequence contigs and scaffolds (~7.8 % of chromosome 7B physical length) were mapped into nine deletion bins. Our method of genotyping deletions on chromosome 7B relied on a model-based clustering algorithm (Mclust) to accurately predict the presence or absence of a given genomic sequence in a deletion line. The bin mapping results were validated using three different approaches, viz. (a) PCR-based amplification of randomly selected bin mapped sequences (b) comparison with previously mapped ESTs and (c) comparison with a 7B genetic map developed in the present study. Validation of the bin mapping results suggested a high accuracy of the assignment of 7B sequence contigs and scaffolds to the 7B deletion bins.

Adaptation of the MapMan ontology to biotic stress responses: application in solanaceous species

Directory of Open Access Journals (Sweden)

Stitt Mark

2007-09-01

Full Text Available Abstract Background The results of transcriptome microarray analysis are usually presented as a list of differentially expressed genes. As these lists can be long, it is hard to interpret the desired experimental treatment effect on the physiology of analysed tissue, e.g. via selected metabolic or other pathways. For some organisms, gene ontologies and data visualization software have been implemented to overcome this problem, whereas for others, software adaptation is yet to be done. Results We present the classification of tentative potato contigs from the potato gene index (StGI available from Dana-Farber Cancer Institute (DFCI into the MapMan ontology to enable the application of the MapMan family of tools to potato microarrays. Special attention has been focused on mapping genes that could not be annotated based on similarity to Arabidopsis genes alone, thus possibly representing genes unique for potato. 97 such genes were classified into functional BINs (i.e. functional classes after manual annotation. A new pathway, focusing on biotic stress responses, has been added and can be used for all other organisms for which mappings have been done. The BIN representation on the potato 10 k cDNA microarray, in comparison with all putative potato gene sequences, has been tested. The functionality of the prepared potato mapping was validated with experimental data on plant response to viral infection. In total 43,408 unigenes were mapped into 35 corresponding BINs. Conclusion The potato mappings can be used to visualize up-to-date, publicly available, expressed sequence tags (ESTs and other sequences from GenBank, in combination with metabolic pathways. Further expert work on potato annotations will be needed with the ongoing EST and genome sequencing of potato. The current MapMan application for potato is directly applicable for analysis of data obtained on potato 10 k cDNA microarray by TIGR (The Institute for Genomic Research but can also be used

Dicty_cDB: CFE213 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

Dicty_cDB: SSB373 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

Dicty_cDB: CFH668 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

Dicty_cDB: SFD117 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

Dicty_cDB: SLF689 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB632 (Link to dictyBase) - - - Contig-U16585-1 VFB632Z (Link... to Original site) - - VFB632Z 181 - - - - Show VFB632 Library VF (Link to library) Clone ID VFB632 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16585-1 Original site URL http://dict...g significant alignments: (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657...%: cytoplasmic 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for VFB632 is nuc

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

ScaffoldScaffolder: solving contig orientation via bidirected to directed graph reduction.

Science.gov (United States)

Bodily, Paul M; Fujimoto, M Stanley; Snell, Quinn; Ventura, Dan; Clement, Mark J

2016-01-01

The contig orientation problem, which we formally define as the MAX-DIR problem, has at times been addressed cursorily and at times using various heuristics. In setting forth a linear-time reduction from the MAX-CUT problem to the MAX-DIR problem, we prove the latter is NP-complete. We compare the relative performance of a novel greedy approach with several other heuristic solutions. Our results suggest that our greedy heuristic algorithm not only works well but also outperforms the other algorithms due to the nature of scaffold graphs. Our results also demonstrate a novel method for identifying inverted repeats and inversion variants, both of which contradict the basic single-orientation assumption. Such inversions have previously been noted as being difficult to detect and are directly involved in the genetic mechanisms of several diseases. http://bioresearch.byu.edu/scaffoldscaffolder. paulmbodily@gmail.com Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

Enhanced Store-Operated Calcium Entry Leads to Striatal Synaptic Loss in a Huntington's Disease Mouse Model.

Science.gov (United States)

Wu, Jun; Ryskamp, Daniel A; Liang, Xia; Egorova, Polina; Zakharova, Olga; Hung, Gene; Bezprozvanny, Ilya

2016-01-06

In Huntington's disease (HD), mutant Huntingtin (mHtt) protein causes striatal neuron dysfunction, synaptic loss, and eventual neurodegeneration. To understand the mechanisms responsible for synaptic loss in HD, we developed a corticostriatal coculture model that features age-dependent dendritic spine loss in striatal medium spiny neurons (MSNs) from YAC128 transgenic HD mice. Age-dependent spine loss was also observed in vivo in YAC128 MSNs. To understand the causes of spine loss in YAC128 MSNs, we performed a series of mechanistic studies. We previously discovered that mHtt protein binds to type 1 inositol (1,4,5)-trisphosphate receptor (InsP3R1) and increases its sensitivity to activation by InsP3. We now report that the resulting increase in steady-state InsP3R1 activity reduces endoplasmic reticulum (ER) Ca(2+) levels. Depletion of ER Ca(2+) leads to overactivation of the neuronal store-operated Ca(2+) entry (nSOC) pathway in YAC128 MSN spines. The synaptic nSOC pathway is controlled by the ER resident protein STIM2. We discovered that STIM2 expression is elevated in aged YAC128 striatal cultures and in YAC128 mouse striatum. Knock-down of InsP3R1 expression by antisense oligonucleotides or knock-down or knock-out of STIM2 resulted in normalization of nSOC and rescue of spine loss in YAC128 MSNs. The selective nSOC inhibitor EVP4593 was identified in our previous studies. We now demonstrate that EVP4593 reduces synaptic nSOC and rescues spine loss in YAC128 MSNs. Intraventricular delivery of EVP4593 in YAC128 mice rescued age-dependent striatal spine loss in vivo. Our results suggest EVP4593 and other inhibitors of the STIM2-dependent nSOC pathway as promising leads for HD therapeutic development. In Huntington's disease (HD) mutant Huntingtin (mHtt) causes early corticostriatal synaptic dysfunction and eventual neurodegeneration of medium spine neurons (MSNs) through poorly understood mechanisms. We report here that corticostriatal cocultures prepared from

SNP identification from RNA sequencing and linkage map construction of rubber tree for anchoring the draft genome.

Science.gov (United States)

Shearman, Jeremy R; Sangsrakru, Duangjai; Jomchai, Nukoon; Ruang-Areerate, Panthita; Sonthirod, Chutima; Naktang, Chaiwat; Theerawattanasuk, Kanikar; Tragoonrung, Somvong; Tangphatsornruang, Sithichoke

2015-01-01

Hevea brasiliensis, or rubber tree, is an important crop species that accounts for the majority of natural latex production. The rubber tree nuclear genome consists of 18 chromosomes and is roughly 2.15 Gb. The current rubber tree reference genome assembly consists of 1,150,326 scaffolds ranging from 200 to 531,465 bp and totalling 1.1 Gb. Only 143 scaffolds, totalling 7.6 Mb, have been placed into linkage groups. We have performed RNA-seq on 6 varieties of rubber tree to identify SNPs and InDels and used this information to perform target sequence enrichment and high throughput sequencing to genotype a set of SNPs in 149 rubber tree offspring from a cross between RRIM 600 and RRII 105 rubber tree varieties. We used this information to generate a linkage map allowing for the anchoring of 24,424 contigs from 3,009 scaffolds, totalling 115 Mb or 10.4% of the published sequence, into 18 linkage groups. Each linkage group contains between 319 and 1367 SNPs, or 60 to 194 non-redundant marker positions, and ranges from 156 to 336 cM in length. This linkage map includes 20,143 of the 69,300 predicted genes from rubber tree and will be useful for mapping studies and improving the reference genome assembly.

Dicty_cDB: AFJ817 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available AF (Link to library) AFJ817 (Link to dictyBase) - - - Contig-U15574-1 AFJ817F (Link... to Original site) AFJ817F 172 - - - - - - Show AFJ817 Library AF (Link to library) Clone ID AFJ817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...alue N AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-4071762 strain AX4, complete s...es. 42 1.1 2 BE213059 |BE213059.1 IpBrn01690 Brain cDNA library Ictalurus punctatus cDNA 5', mRNA sequence.

Dicty_cDB: CHP827 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Or...iginal site) CHP827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15898-1 Original site URL http://dictycdb.b...ments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain ...18q21 clone:RP11-866E20, WORKING DRAFT SEQUENCE, 18 unordered pieces. 42 0.073 4 CK406764 |CK406764.1 AUF_IfLvr_212_c09 Ict

Dicty_cDB: SSI468 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

Dicty_cDB: VSH207 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB788 (Link to dictyBase) - - - Contig-U14924-1 VFB788P (Link... to Original site) VFB788F 158 VFB788Z 768 VFB788P 926 - - Show VFB788 Library VF (Link to library) Clone ID VFB788 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14924-1 Original site URL http://dict... (bits) Value N AC115592 |AC115592.2 Dictyostelium discoideum chromosome 2 map 1-...2_6( AC115592 |pid:none) Dictyostelium discoideum chromosom... 520 e-146 CU459003_2449( CU459003 |pid:none)

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB895 (Link to dictyBase) - - - Contig-U10164-1 VFB895P (Link... to Original site) VFB895F 578 VFB895Z 699 VFB895P 1277 - - Show VFB895 Library VF (Link to library) Clone ID VFB895 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10164-1 Original site URL http://dict...ore E Sequences producing significant alignments: (bits) Value N AC115604 |AC115604.2 Dictyostelium discoide...um chromosome 2 map 4354771-4414991 strain AX4, complete sequence. 42 5e-06 9 M18106 |M18106.1 Dictyostelium

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB645 (Link to dictyBase) - - - Contig-U16382-1 VFB645P (Link... to Original site) VFB645F 619 VFB645Z 413 VFB645P 1032 - - Show VFB645 Library VF (Link to library) Clone ID VFB645 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostel...ium discoideum gene for actin A8. 1174 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB741 (Link to dictyBase) - - - Contig-U16382-1 VFB741P (Link... to Original site) VFB741F 545 VFB741Z 675 VFB741P 1220 - - Show VFB741 Library VF (Link to library) Clone ID VFB741 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 1166 0....0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2090751 strain AX4, complete seq

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB710 (Link to dictyBase) - - - Contig-U16382-1 VFB710P (Link... to Original site) VFB710F 123 VFB710Z 689 VFB710P 812 - - Show VFB710 Library VF (Link to library) Clone ID VFB710 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict... significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum... gene for actin A8. 1308 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-209075

Scaffold filling, contig fusion and comparative gene order inference

Directory of Open Access Journals (Sweden)

Rounsley Steve

2010-06-01

Full Text Available Abstract Background There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Results Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. Conclusions The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

Scaffold filling, contig fusion and comparative gene order inference.

Science.gov (United States)

Muñoz, Adriana; Zheng, Chunfang; Zhu, Qian; Albert, Victor A; Rounsley, Steve; Sankoff, David

2010-06-04

There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

High-resolution linkage map of mouse chromosome 13 in the vicinity of the host resistance locus Lgn1

Energy Technology Data Exchange (ETDEWEB)

Beckers, M.C.; Ernst, E.; Diez, E. [McGill Univ., Quebec (Canada)] [and others

1997-02-01

Natural resistance of inbred mouse strains to infection with Legionella pneumophila is controlled by the expression of a single dominant gene on chromosome 13, designated Lgn1. The genetic difference at Lgn1 is phenotypically expressed as the presence or absence of intracellular replication of L. pneumophila in host macrophages. In our effort to identify the Lgn1 gene by positional cloning, we have generated a high-resolution linkage map of the Lgn1 chromosomal region. For this, we have carried out extensive segregation analysis in a total of 1270 (A/J x C57BL/6J) X A/J informative backcross mice segregating the resistance allele of C57BL/6J and the susceptibility allele of A/J. Additional segregation analyses were carried out in three preexisting panels of C57BL/6J X Mus spretus interspecific backcross mice. A total of 39 DNA markers were mapped within an interval of approximately 30 cM overlapping the Lgn1 region. Combined pedigree analyses for the 5.4-cM segment overlapping Lgn1 indicated the locus order and the interlocus distances (in cM): D13Mit128-(1.4)-D13Mit194-(0.1)-D13Mit147-(0.9)-Dl3Mit36-(0.9)-D13Mit146-(0.2)-Lgn1/D 13Mit37-(1.0)-D13Mit70. Additional genetic linkage studies of markers not informative in the A/J X C57BL/6J cross positioned D13Mit30, -72, -195, and -203, D13Gor4, D13Hun35, and Mtap5 in the immediate vicinity of the Lgn1 locus. The marker density and resolution of this genetic linkage map should allow the construction of a physical map of the region and the isolation of YAC clones overlapping the gene. 60 refs., 2 figs., 2 tabs.

Physical mapping of a pollen modifier locus controlling self-incompatibility in apricot and synteny analysis within the Rosaceae.

Science.gov (United States)

Zuriaga, Elena; Molina, Laura; Badenes, María Luisa; Romero, Carlos

2012-06-01

S-locus products (S-RNase and F-box proteins) are essential for the gametophytic self-incompatibility (GSI) specific recognition in Prunus. However, accumulated genetic evidence suggests that other S-locus unlinked factors are also required for GSI. For instance, GSI breakdown was associated with a pollen-part mutation unlinked to the S-locus in the apricot (Prunus armeniaca L.) cv. 'Canino'. Fine-mapping of this mutated modifier gene (M-locus) and the synteny analysis of the M-locus within the Rosaceae are here reported. A segregation distortion loci mapping strategy, based on a selectively genotyped population, was used to map the M-locus. In addition, a bacterial artificial chromosome (BAC) contig was constructed for this region using overlapping oligonucleotides probes, and BAC-end sequences (BES) were blasted against Rosaceae genomes to perform micro-synteny analysis. The M-locus was mapped to the distal part of chr.3 flanked by two SSR markers within an interval of 1.8 cM corresponding to ~364 Kb in the peach (Prunus persica L. Batsch) genome. In the integrated genetic-physical map of this region, BES were mapped against the peach scaffold_3 and BACs were anchored to the apricot map. Micro-syntenic blocks were detected in apple (Malus × domestica Borkh.) LG17/9 and strawberry (Fragaria vesca L.) FG6 chromosomes. The M-locus fine-scale mapping provides a solid basis for self-compatibility marker-assisted selection and for positional cloning of the underlying gene, a necessary goal to elucidate the pollen rejection mechanism in Prunus. In a wider context, the syntenic regions identified in peach, apple and strawberry might be useful to interpret GSI evolution in Rosaceae.

Fine mapping of the sunflower resistance locus PlARG introduced from the wild species Helianthus argophyllus

Science.gov (United States)

Wieckhorst, S.; Bachlava, E.; Dußle, C. M.; Tang, S.; Gao, W.; Saski, C.; Knapp, S. J.; Schön, C.-C.; Hahn, V.

2010-01-01

Downy mildew, caused by Plasmopara halstedii, is one of the most destructive diseases in cultivated sunflower (Helianthus annuus L.). The dominant resistance locus PlARG originates from silverleaf sunflower (H. argophyllus Torrey and Gray) and confers resistance to all known races of P. halstedii. We mapped PlARG on linkage group (LG) 1 of (cms)HA342 × ARG1575-2, a population consisting of 2,145 F2 individuals. Further, we identified resistance gene candidates (RGCs) that cosegregated with PlARG as well as closely linked flanking markers. Markers from the target region were mapped with higher resolution in NDBLOSsel × KWS04, a population consisting of 2,780 F2 individuals that does not segregate for PlARG. A large-insert sunflower bacterial artificial chromosome (BAC) library was screened with overgo probes designed for markers RGC52 and RGC151, which cosegregated with PlARG. Two RGC-containing BAC contigs were anchored to the PlARG region on LG 1. Electronic supplementary material The online version of this article (doi:10.1007/s00122-010-1416-4) contains supplementary material, which is available to authorized users. PMID:20700574

Dicty_cDB: SFF154 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFF154 (Link to dictyBase) - - - Contig-U15074-1 SFF154P (Link... to Original site) SFF154F 132 SFF154Z 514 SFF154P 646 - - Show SFF154 Library SF (Link to library) Clone ID SFF154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15074-1 Original site URL http://dict...22, genomic survey sequence. 48 3e-09 3 AC116921 |AC116921.2 Dictyostelium discoi...deum chromosome 2 map 4624505-4657775 strain AX4, complete sequence. 44 4e-09 7 BQ096682 |BQ096682.1 IfHdk00151 Ict

Dicty_cDB: CFH244 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CF (Link to library) CFH244 (Link to dictyBase) - - - Contig-U16381-1 CFH244F (Link... to Original site) CFH244F 124 - - - - - - Show CFH244 Library CF (Link to library) Clone ID CFH244 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...ts) Value N AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, compl...ete sequence. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB886 (Link to dictyBase) - - - Contig-U16382-1 VFB886E (Link...) Clone ID VFB886 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...t alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 2234 0.0 1 AC116957 |AC116957.2 Dict...4, complete sequence. 2107 0.0 3 M14146 |M14146.1 D.discoideum actin 15 gene, complete cds. 2034 0.0 1 AC115579 |AC115579.2 Dict...4 0.0 2 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFC196 (Link to dictyBase) - - - Contig-U13856-1 VFC196P (Link... to Original site) VFC196F 487 VFC196Z 556 VFC196P 1043 - - Show VFC196 Library VF (Link to library) Clone ID VFC196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13856-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U72746 |U72746.1 Dict...13. 36 0.053 5 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4, co

A post-assembly genome-improvement toolkit (PAGIT) to obtain annotated genomes from contigs.

Science.gov (United States)

Swain, Martin T; Tsai, Isheng J; Assefa, Samual A; Newbold, Chris; Berriman, Matthew; Otto, Thomas D

2012-06-07

Genome projects now produce draft assemblies within weeks owing to advanced high-throughput sequencing technologies. For milestone projects such as Escherichia coli or Homo sapiens, teams of scientists were employed to manually curate and finish these genomes to a high standard. Nowadays, this is not feasible for most projects, and the quality of genomes is generally of a much lower standard. This protocol describes software (PAGIT) that is used to improve the quality of draft genomes. It offers flexible functionality to close gaps in scaffolds, correct base errors in the consensus sequence and exploit reference genomes (if available) in order to improve scaffolding and generating annotations. The protocol is most accessible for bacterial and small eukaryotic genomes (up to 300 Mb), such as pathogenic bacteria, malaria and parasitic worms. Applying PAGIT to an E. coli assembly takes ∼24 h: it doubles the average contig size and annotates over 4,300 gene models.

Disease-toxicant interactions in manganese exposed Huntington disease mice: early changes in striatal neuron morphology and dopamine metabolism.

Directory of Open Access Journals (Sweden)

Jennifer L Madison

Full Text Available YAC128 Huntington's disease (HD transgenic mice accumulate less manganese (Mn in the striatum relative to wild-type (WT littermates. We hypothesized that Mn and mutant Huntingtin (HTT would exhibit gene-environment interactions at the level of neurochemistry and neuronal morphology. Twelve-week-old WT and YAC128 mice were exposed to MnCl(2-4H(2O (50 mg/kg on days 0, 3 and 6. Striatal medium spiny neuron (MSN morphology, as well as levels of dopamine (DA and its metabolites (which are known to be sensitive to Mn-exposure, were analyzed at 13 weeks (7 days from initial exposure and 16 weeks (28 days from initial exposure. No genotype-dependent differences in MSN morphology were apparent at 13 weeks. But at 16 weeks, a genotype effect was observed in YAC128 mice, manifested by an absence of the wild-type age-dependent increase in dendritic length and branching complexity. In addition, genotype-exposure interaction effects were observed for dendritic complexity measures as a function of distance from the soma, where only YAC128 mice were sensitive to Mn exposure. Furthermore, striatal DA levels were unaltered at 13 weeks by genotype or Mn exposure, but at 16 weeks, both Mn exposure and the HD genotype were associated with quantitatively similar reductions in DA and its metabolites. Interestingly, Mn exposure of YAC128 mice did not further decrease DA or its metabolites versus YAC128 vehicle exposed or Mn exposed WT mice. Taken together, these results demonstrate Mn-HD disease-toxicant interactions at the onset of striatal dendritic neuropathology in YAC128 mice. Our results identify the earliest pathological change in striatum of YAC128 mice as being between 13 to 16 weeks. Finally, we show that mutant HTT suppresses some Mn-dependent changes, such as decreased DA levels, while it exacerbates others, such as dendritic pathology.

Genomic Anatomy of a Premier Major Histocompatibility Complex Paralogous Region on Chromosome 1q21–q22

Science.gov (United States)

Shiina, Takashi; Ando, Asako; Suto, Yumiko; Kasai, Fumio; Shigenari, Atsuko; Takishima, Nobusada; Kikkawa, Eri; Iwata, Kyoko; Kuwano, Yuko; Kitamura, Yuka; Matsuzawa, Yumiko; Sano, Kazumi; Nogami, Masahiro; Kawata, Hisako; Li, Suyun; Fukuzumi, Yasuhito; Yamazaki, Masaaki; Tashiro, Hiroyuki; Tamiya, Gen; Kohda, Atsushi; Okumura, Katsuzumi; Ikemura, Toshimichi; Soeda, Eiichi; Mizuki, Nobuhisa; Kimura, Minoru; Bahram, Seiamak; Inoko, Hidetoshi

2001-01-01

Human chromosomes 1q21–q25, 6p21.3–22.2, 9q33–q34, and 19p13.1–p13.4 carry clusters of paralogous loci, to date best defined by the flagship 6p MHC region. They have presumably been created by two rounds of large-scale genomic duplications around the time of vertebrate emergence. Phylogenetically, the 1q21–25 region seems most closely related to the 6p21.3 MHC region, as it is only the MHC paralogous region that includes bona fide MHC class I genes, the CD1 and MR1 loci. Here, to clarify the genomic structure of this model MHC paralogous region as well as to gain insight into the evolutionary dynamics of the entire quadriplication process, a detailed analysis of a critical 1.7 megabase (Mb) region was performed. To this end, a composite, deep, YAC, BAC, and PAC contig encompassing all five CD1 genes and linking the centromeric +P5 locus to the telomeric KRTC7 locus was constructed. Within this contig a 1.1-Mb BAC and PAC core segment joining CD1D to FCER1A was fully sequenced and thoroughly analyzed. This led to the mapping of a total of 41 genes (12 expressed genes, 12 possibly expressed genes, and 17 pseudogenes), among which 31 were novel. The latter include 20 olfactory receptor (OR) genes, 9 of which are potentially expressed. Importantly, CD1, SPTA1, OR, and FCERIA belong to multigene families, which have paralogues in the other three regions. Furthermore, it is noteworthy that 12 of the 13 expressed genes in the 1q21–q22 region around the CD1 loci are immunologically relevant. In addition to CD1A-E, these include SPTA1, MNDA, IFI-16, AIM2, BL1A, FY and FCERIA. This functional convergence of structurally unrelated genes is reminiscent of the 6p MHC region, and perhaps represents the emergence of yet another antigen presentation gene cluster, in this case dedicated to lipid/glycolipid antigens rather than antigen-derived peptides. [The nucleotide sequence data reported in this paper have been submitted to the DDBJ, EMBL, and GenBank databases under

Toward an Integrated BAC Library Resource for Genome Sequencing and Analysis; FINAL

International Nuclear Information System (INIS)

Simon, M. I.; Kim, U.-J.

2002-01-01

We developed a great deal of expertise in building large BAC libraries from a variety of DNA sources including humans, mice, corn, microorganisms, worms, and Arabidopsis. We greatly improved the technology for screening these libraries rapidly and for selecting appropriate BACs and mapping BACs to develop large overlapping contigs. We became involved in supplying BACs and BAC contigs to a variety of sequencing and mapping projects and we began to collaborate with Drs. Adams and Venter at TIGR and with Dr. Leroy Hood and his group at University of Washington to provide BACs for end sequencing and for mapping and sequencing of large fragments of chromosome 16. Together with Dr. Ian Dunham and his co-workers at the Sanger Center we completed the mapping and they completed the sequencing of the first human chromosome, chromosome 22. This was published in Nature in 1999 and our BAC contigs made a major contribution to this sequencing effort. Drs. Shizuya and Ding invented an automated highly accurate BAC mapping technique. We also developed long-term collaborations with Dr. Uli Weier at UCSF in the design of BAC probes for characterization of human tumors and specific chromosome deletions and breakpoints. Finally the contribution of our work to the human genome project has been recognized in the publication both by the international consortium and the NIH of a draft sequence of the human genome in Nature last year. Dr. Shizuya was acknowledged in the authorship of that landmark paper. Dr. Simon was also an author on the Venter/Adams Celera project sequencing the human genome that was published in Science last year

Easy and accurate reconstruction of whole HIV genomes from short-read sequence data with shiver

Science.gov (United States)

Blanquart, François; Golubchik, Tanya; Gall, Astrid; Bakker, Margreet; Bezemer, Daniela; Croucher, Nicholas J; Hall, Matthew; Hillebregt, Mariska; Ratmann, Oliver; Albert, Jan; Bannert, Norbert; Fellay, Jacques; Fransen, Katrien; Gourlay, Annabelle; Grabowski, M Kate; Gunsenheimer-Bartmeyer, Barbara; Günthard, Huldrych F; Kivelä, Pia; Kouyos, Roger; Laeyendecker, Oliver; Liitsola, Kirsi; Meyer, Laurence; Porter, Kholoud; Ristola, Matti; van Sighem, Ard; Cornelissen, Marion; Kellam, Paul; Reiss, Peter

2018-01-01

Abstract Studying the evolution of viruses and their molecular epidemiology relies on accurate viral sequence data, so that small differences between similar viruses can be meaningfully interpreted. Despite its higher throughput and more detailed minority variant data, next-generation sequencing has yet to be widely adopted for HIV. The difficulty of accurately reconstructing the consensus sequence of a quasispecies from reads (short fragments of DNA) in the presence of large between- and within-host diversity, including frequent indels, may have presented a barrier. In particular, mapping (aligning) reads to a reference sequence leads to biased loss of information; this bias can distort epidemiological and evolutionary conclusions. De novo assembly avoids this bias by aligning the reads to themselves, producing a set of sequences called contigs. However contigs provide only a partial summary of the reads, misassembly may result in their having an incorrect structure, and no information is available at parts of the genome where contigs could not be assembled. To address these problems we developed the tool shiver to pre-process reads for quality and contamination, then map them to a reference tailored to the sample using corrected contigs supplemented with the user’s choice of existing reference sequences. Run with two commands per sample, it can easily be used for large heterogeneous data sets. We used shiver to reconstruct the consensus sequence and minority variant information from paired-end short-read whole-genome data produced with the Illumina platform, for sixty-five existing publicly available samples and fifty new samples. We show the systematic superiority of mapping to shiver’s constructed reference compared with mapping the same reads to the closest of 3,249 real references: median values of 13 bases called differently and more accurately, 0 bases called differently and less accurately, and 205 bases of missing sequence recovered. We also

A clone-free, single molecule map of the domestic cow (Bos taurus) genome.

Science.gov (United States)

Zhou, Shiguo; Goldstein, Steve; Place, Michael; Bechner, Michael; Patino, Diego; Potamousis, Konstantinos; Ravindran, Prabu; Pape, Louise; Rincon, Gonzalo; Hernandez-Ortiz, Juan; Medrano, Juan F; Schwartz, David C

2015-08-28

The cattle (Bos taurus) genome was originally selected for sequencing due to its economic importance and unique biology as a model organism for understanding other ruminants, or mammals. Currently, there are two cattle genome sequence assemblies (UMD3.1 and Btau4.6) from groups using dissimilar assembly algorithms, which were complemented by genetic and physical map resources. However, past comparisons between these assemblies revealed substantial differences. Consequently, such discordances have engendered ambiguities when using reference sequence data, impacting genomic studies in cattle and motivating construction of a new optical map resource--BtOM1.0--to guide comparisons and improvements to the current sequence builds. Accordingly, our comprehensive comparisons of BtOM1.0 against the UMD3.1 and Btau4.6 sequence builds tabulate large-to-immediate scale discordances requiring mediation. The optical map, BtOM1.0, spanning the B. taurus genome (Hereford breed, L1 Dominette 01449) was assembled from an optical map dataset consisting of 2,973,315 (439 X; raw dataset size before assembly) single molecule optical maps (Rmaps; 1 Rmap = 1 restriction mapped DNA molecule) generated by the Optical Mapping System. The BamHI map spans 2,575.30 Mb and comprises 78 optical contigs assembled by a combination of iterative (using the reference sequence: UMD3.1) and de novo assembly techniques. BtOM1.0 is a high-resolution physical map featuring an average restriction fragment size of 8.91 Kb. Comparisons of BtOM1.0 vs. UMD3.1, or Btau4.6, revealed that Btau4.6 presented far more discordances (7,463) vs. UMD3.1 (4,754). Overall, we found that Btau4.6 presented almost double the number of discordances than UMD3.1 across most of the 6 categories of sequence vs. map discrepancies, which are: COMPLEX (misassembly), DELs (extraneous sequences), INSs (missing sequences), ITs (Inverted/Translocated sequences), ECs (extra restriction cuts) and MCs (missing restriction cuts

Physical mapping of chromosome 17p13.3 in the region of a putative tumor suppressor gene important in medulloblastoma

Energy Technology Data Exchange (ETDEWEB)

McDonald, J.D.; Daneshvar, L.; Willert, J.R. [Univ. of California, San Franciso, CA (United States)] [and others

1994-09-01

Deletion mapping of a medulloblastoma tumor panel revealed loss of distal chromosome 17p13.3 sequences in tumors from 14 of 32 patients (44%). Of the 14 tumors showing loss of heterozygosity by restriction fragment length polymorphism analysis, 14 of 14 (100%) displayed loss of the telomeric marker p144-D6 (D17S34), while a probe for the ABR gene on 17p13.3 was lost in 7 of 8 (88%) informative cases. Using pulsed-field gel electrophoresis, we localized the polymorphic marker (VNTR-A) of the ABR gene locus to within 220 kb of the p144-D6 locus. A cosmid contig constructed in this region was used to demonstrate by fluorescence in situ hybridization that the ABR gene is oriented transcriptionally 5{prime} to 3{prime} toward the telomere. This report provides new physical mapping data for the ABR gene, which has not been previously shown to be deleted in medulloblastoma. These results provide further evidence for the existence of a second tumor suppressor gene distinct from p53 on distal chromosome 17p. 12 refs., 3 figs.

Study on bystander effect and associated mechanism mediated through culture medium

International Nuclear Information System (INIS)

Tu Xumin; Lei Suwen; Zhang Zhixing; Lv Huimin

2005-01-01

Objective: To study the bystander effect and associated mechanism mediated through the irradiated cell culture medium. Methods: Splenic natural killer (NK) cells were obtained from healthy male ICR strain mice. Culture medium irradiated with different doses of 60 Co γ-rays was used for culturing Yac-I lymphoma cells. The degree of injury of the latter by activated NK cells was observed. A part of the culture media were pretreated with 1% DMSO, a scavenger of reactive oxygen species (ROS), in order to investigate the possible mechanism of a radiation-induced bystander response. Results: Severer injury was induced in Yac-I cells cultured in the media pre-irradiated with different doses of γ-rays than that in Yac-I cells cultured in unirradiated medium, as shown by increased sensitivity to murine splenic NK cells (P<0.01). Culturing Yac-I cells in DMSO-pretreated medium considerably reduced the activation of NK cells, especially in 0.25 Gy and 0.5 Gy γ-irradiated media. Therefore, it can be expected that DMSO can partly suppress ROS-induced bystander effect. Conclusion: The irradiated culture medium of Yac-I cells can trigger bystander effect. ROS likely plays an important role in radiation-induced bystander effect that can be partly suppressed by pretreatment with DMSO. (authors)

Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

DEFF Research Database (Denmark)

Basse, P; Hokland, P; Heron, I

1988-01-01

The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...... extent, the bone, skin, and muscle. The only organs that could arrest the LV-injected tumor cells were the lungs and the liver. In the lungs clearance of YAC-1 cells began immediately after the cells were arrested. However, the rate of clearance could be almost abrogated by pretreatment of the recipients...... with anti-asialo GM1 antiserum, which destroys most of the NK cells in vivo and strongly depresses the in vitro NK cell activity. In contrast, YAC-1 cells arrested in the liver were not cleared from this organ during the first 1-2 hours after arrest. After this delay clearance of the cells commenced...

Dantrolene is neuroprotective in Huntington's disease transgenic mouse model

Directory of Open Access Journals (Sweden)

Chen Xi

2011-11-01

Full Text Available Abstract Background Huntington's disease (HD is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs. Our group has previously demonstrated that calcium (Ca2+ signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128. Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2 and spinocerebellar ataxia 3 (SCA3 mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. Results The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Conclusions Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that Ryan

Dantrolene is neuroprotective in Huntington's disease transgenic mouse model.

Science.gov (United States)

Chen, Xi; Wu, Jun; Lvovskaya, Svetlana; Herndon, Emily; Supnet, Charlene; Bezprozvanny, Ilya

2011-11-25

Huntington's disease (HD) is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs). Our group has previously demonstrated that calcium (Ca2+) signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128). Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT) MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2) and spinocerebellar ataxia 3 (SCA3) mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg) twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that RyanR inhibitors and Ca2+ signaling stabilizers such as

Lawyers' delights and geneticists' nightmares: at forty, the double helix shows some wrinkles.

Science.gov (United States)

Sgaramella, V

1993-12-15

The National Institutes of Health (NIH) request to patent the base sequences of incomplete and uncharacterized fragments of DNA copied on messenger RNAs (cDNAs) extracted from human tissues, the refusal by the patent office, and the appeal placed by NIH, have incited a violent controversy, fueled by rational, as well as emotional elements. In a compromising mode between liberalism and protectionism, I propose that legal protection be considered only for those RNA/DNA sequences, either natural or artificial, which can generate practical applications per se, and not through their expression products. Another controversy is developing around a popular tool for genomic research: the fidelity of yeast artificial chromosome (YAC) libraries being distributed worldwide for physical mapping is being questioned. Some of these libraries have been shown to be affected by surprisingly high levels of co-cloning, in addition to more common gene reshuffling instances. Also in this case, scientific as well as non-scientific components have to be considered. Possible remedies for the underlying problems may be found in the proper use of kinetic, enzymatic and microbiological variables in the production of YACs. Here too, a sharper distinction between the secular and scientific gratifications of research could help.

Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

DEFF Research Database (Denmark)

Basse, P; Hokland, P; Heron, I

1988-01-01

The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...

Fine physical and genetic mapping of powdery mildew resistance gene MlIW172 originating from wild emmer (Triticum dicoccoides.

Directory of Open Access Journals (Sweden)

Shuhong Ouyang

Full Text Available Powdery mildew, caused by Blumeria graminis f. sp. tritici, is one of the most important wheat diseases in the world. In this study, a single dominant powdery mildew resistance gene MlIW172 was identified in the IW172 wild emmer accession and mapped to the distal region of chromosome arm 7AL (bin7AL-16-0.86-0.90 via molecular marker analysis. MlIW172 was closely linked with the RFLP probe Xpsr680-derived STS marker Xmag2185 and the EST markers BE405531 and BE637476. This suggested that MlIW172 might be allelic to the Pm1 locus or a new locus closely linked to Pm1. By screening genomic BAC library of durum wheat cv. Langdon and 7AL-specific BAC library of hexaploid wheat cv. Chinese Spring, and after analyzing genome scaffolds of Triticum urartu containing the marker sequences, additional markers were developed to construct a fine genetic linkage map on the MlIW172 locus region and to delineate the resistance gene within a 0.48 cM interval. Comparative genetics analyses using ESTs and RFLP probe sequences flanking the MlIW172 region against other grass species revealed a general co-linearity in this region with the orthologous genomic regions of rice chromosome 6, Brachypodium chromosome 1, and sorghum chromosome 10. However, orthologous resistance gene-like RGA sequences were only present in wheat and Brachypodium. The BAC contigs and sequence scaffolds that we have developed provide a framework for the physical mapping and map-based cloning of MlIW172.

Detection of a Usp-like gene in Calotropis procera plant from the de novo assembled genome contigs of the high-throughput sequencing dataset

KAUST Repository

Shokry, Ahmed M.

2014-02-01

The wild plant species Calotropis procera (C. procera) has many potential applications and beneficial uses in medicine, industry and ornamental field. It also represents an excellent source of genes for drought and salt tolerance. Genes encoding proteins that contain the conserved universal stress protein (USP) domain are known to provide organisms like bacteria, archaea, fungi, protozoa and plants with the ability to respond to a plethora of environmental stresses. However, information on the possible occurrence of Usp in C. procera is not available. In this study, we uncovered and characterized a one-class A Usp-like (UspA-like, NCBI accession No. KC954274) gene in this medicinal plant from the de novo assembled genome contigs of the high-throughput sequencing dataset. A number of GenBank accessions for Usp sequences were blasted with the recovered de novo assembled contigs. Homology modelling of the deduced amino acids (NCBI accession No. AGT02387) was further carried out using Swiss-Model, accessible via the EXPASY. Superimposition of C. procera USPA-like full sequence model on Thermus thermophilus USP UniProt protein (PDB accession No. Q5SJV7) was constructed using RasMol and Deep-View programs. The functional domains of the novel USPA-like amino acids sequence were identified from the NCBI conserved domain database (CDD) that provide insights into sequence structure/function relationships, as well as domain models imported from a number of external source databases (Pfam, SMART, COG, PRK, TIGRFAM). © 2014 Académie des sciences.

Development of a dense SNP-based linkage map of an apple rootstock progeny using the Malus Infinium whole genome genotyping array.

Science.gov (United States)

Antanaviciute, Laima; Fernández-Fernández, Felicidad; Jansen, Johannes; Banchi, Elisa; Evans, Katherine M; Viola, Roberto; Velasco, Riccardo; Dunwell, Jim M; Troggio, Michela; Sargent, Daniel J

2012-05-25

A whole-genome genotyping array has previously been developed for Malus using SNP data from 28 Malus genotypes. This array offers the prospect of high throughput genotyping and linkage map development for any given Malus progeny. To test the applicability of the array for mapping in diverse Malus genotypes, we applied the array to the construction of a SNP-based linkage map of an apple rootstock progeny. Of the 7,867 Malus SNP markers on the array, 1,823 (23.2%) were heterozygous in one of the two parents of the progeny, 1,007 (12.8%) were heterozygous in both parental genotypes, whilst just 2.8% of the 921 Pyrus SNPs were heterozygous. A linkage map spanning 1,282.2 cM was produced comprising 2,272 SNP markers, 306 SSR markers and the S-locus. The length of the M432 linkage map was increased by 52.7 cM with the addition of the SNP markers, whilst marker density increased from 3.8 cM/marker to 0.5 cM/marker. Just three regions in excess of 10 cM remain where no markers were mapped. We compared the positions of the mapped SNP markers on the M432 map with their predicted positions on the 'Golden Delicious' genome sequence. A total of 311 markers (13.7% of all mapped markers) mapped to positions that conflicted with their predicted positions on the 'Golden Delicious' pseudo-chromosomes, indicating the presence of paralogous genomic regions or mis-assignments of genome sequence contigs during the assembly and anchoring of the genome sequence. We incorporated data for the 2,272 SNP markers onto the map of the M432 progeny and have presented the most complete and saturated map of the full 17 linkage groups of M. pumila to date. The data were generated rapidly in a high-throughput semi-automated pipeline, permitting significant savings in time and cost over linkage map construction using microsatellites. The application of the array will permit linkage maps to be developed for QTL analyses in a cost-effective manner, and the identification of SNPs that have been

SIS: a program to generate draft genome sequence scaffolds for prokaryotes

Directory of Open Access Journals (Sweden)

Dias Zanoni

2012-05-01

Full Text Available Abstract Background Decreasing costs of DNA sequencing have made prokaryotic draft genome sequences increasingly common. A contig scaffold is an ordering of contigs in the correct orientation. A scaffold can help genome comparisons and guide gap closure efforts. One popular technique for obtaining contig scaffolds is to map contigs onto a reference genome. However, rearrangements that may exist between the query and reference genomes may result in incorrect scaffolds, if these rearrangements are not taken into account. Large-scale inversions are common rearrangement events in prokaryotic genomes. Even in draft genomes it is possible to detect the presence of inversions given sufficient sequencing coverage and a sufficiently close reference genome. Results We present a linear-time algorithm that can generate a set of contig scaffolds for a draft genome sequence represented in contigs given a reference genome. The algorithm is aimed at prokaryotic genomes and relies on the presence of matching sequence patterns between the query and reference genomes that can be interpreted as the result of large-scale inversions; we call these patterns inversion signatures. Our algorithm is capable of correctly generating a scaffold if at least one member of every inversion signature pair is present in contigs and no inversion signatures have been overwritten in evolution. The algorithm is also capable of generating scaffolds in the presence of any kind of inversion, even though in this general case there is no guarantee that all scaffolds in the scaffold set will be correct. We compare the performance of sis, the program that implements the algorithm, to seven other scaffold-generating programs. The results of our tests show that sis has overall better performance. Conclusions sis is a new easy-to-use tool to generate contig scaffolds, available both as stand-alone and as a web server. The good performance of sis in our tests adds evidence that large

Comparison of the chromosome maps around a resistance hot spot on chromosome 5 of potato and tomato using BAC-FISH painting.

Science.gov (United States)

Achenbach, Ute C; Tang, Xiaomin; Ballvora, Agim; de Jong, Hans; Gebhardt, Christiane

2010-02-01

Potato chromosome 5 harbours numerous genes for important qualitative and quantitative traits, such as resistance to the root cyst nematode Globodera pallida and the late blight fungus, Phytophthora infestans. The genes make up part of a "hot spot" for resistances to various pathogens covering a genetic map length of 3 cM between markers GP21 and GP179. We established the physical size and position of this region on chromosome 5 in potato and tomato using fluorescence in situ hybridization (FISH) on pachytene chromosomes. Five potato bacterial artificial chromosome (BAC) clones with the genetically anchored markers GP21, R1-contig (proximal end), CosA, GP179, and StPto were selected, labeled with different fluorophores, and hybridized in a five-colour FISH experiment. Our results showed the location of the BAC clones in the middle of the long arm of chromosome 5 in both potato and tomato. Based on chromosome measurements, we estimate the physical size of the GP21-GP179 interval at 0.85 Mb and 1.2 Mb in potato and tomato, respectively. The GP21-GP179 interval is part of a genome segment known to have inverted map positions between potato and tomato.

Improvement of the Threespine Stickleback Genome Using a Hi-C-Based Proximity-Guided Assembly.

Science.gov (United States)

Peichel, Catherine L; Sullivan, Shawn T; Liachko, Ivan; White, Michael A

2017-09-01

Scaffolding genomes into complete chromosome assemblies remains challenging even with the rapidly increasing sequence coverage generated by current next-generation sequence technologies. Even with scaffolding information, many genome assemblies remain incomplete. The genome of the threespine stickleback (Gasterosteus aculeatus), a fish model system in evolutionary genetics and genomics, is not completely assembled despite scaffolding with high-density linkage maps. Here, we first test the ability of a Hi-C based proximity-guided assembly (PGA) to perform a de novo genome assembly from relatively short contigs. Using Hi-C based PGA, we generated complete chromosome assemblies from a distribution of short contigs (20-100 kb). We found that 96.40% of contigs were correctly assigned to linkage groups (LGs), with ordering nearly identical to the previous genome assembly. Using available bacterial artificial chromosome (BAC) end sequences, we provide evidence that some of the few discrepancies between the Hi-C assembly and the existing assembly are due to structural variation between the populations used for the 2 assemblies or errors in the existing assembly. This Hi-C assembly also allowed us to improve the existing assembly, assigning over 60% (13.35 Mb) of the previously unassigned (~21.7 Mb) contigs to LGs. Together, our results highlight the potential of the Hi-C based PGA method to be used in combination with short read data to perform relatively inexpensive de novo genome assemblies. This approach will be particularly useful in organisms in which it is difficult to perform linkage mapping or to obtain high molecular weight DNA required for other scaffolding methods. © The American Genetic Association 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

An origin-deficient yeast artificial chromosome triggers a cell cycle checkpoint.

Science.gov (United States)

van Brabant, A J; Buchanan, C D; Charboneau, E; Fangman, W L; Brewer, B J

2001-04-01

Checkpoint controls coordinate entry into mitosis with the completion of DNA replication. Depletion of nucleotide precursors by treatment with the drug hydroxyurea triggers such a checkpoint response. However, it is not clear whether the signal for this hydroxyurea-induced checkpoint pathway is the presence of unreplicated DNA, or rather the persistence of single-stranded or damaged DNA. In a yeast artificial chromosome (YAC) we have engineered an approximately 170 kb region lacking efficient replication origins that allows us to explore the specific effects of unreplicated DNA on cell cycle progression. Replication of this YAC extends the length of S phase and causes cells to engage an S/M checkpoint. In the absence of Rad9 the YAC becomes unstable, undergoing deletions within the origin-free region.

Genome sequencing of bacteria: sequencing, de novo assembly and rapid analysis using open source tools.

Science.gov (United States)

Kisand, Veljo; Lettieri, Teresa

2013-04-01

De novo genome sequencing of previously uncharacterized microorganisms has the potential to open up new frontiers in microbial genomics by providing insight into both functional capabilities and biodiversity. Until recently, Roche 454 pyrosequencing was the NGS method of choice for de novo assembly because it generates hundreds of thousands of long reads (tools for processing NGS data are increasingly free and open source and are often adopted for both their high quality and role in promoting academic freedom. The error rate of pyrosequencing the Alcanivorax borkumensis genome was such that thousands of insertions and deletions were artificially introduced into the finished genome. Despite a high coverage (~30 fold), it did not allow the reference genome to be fully mapped. Reads from regions with errors had low quality, low coverage, or were missing. The main defect of the reference mapping was the introduction of artificial indels into contigs through lower than 100% consensus and distracting gene calling due to artificial stop codons. No assembler was able to perform de novo assembly comparable to reference mapping. Automated annotation tools performed similarly on reference mapped and de novo draft genomes, and annotated most CDSs in the de novo assembled draft genomes. Free and open source software (FOSS) tools for assembly and annotation of NGS data are being developed rapidly to provide accurate results with less computational effort. Usability is not high priority and these tools currently do not allow the data to be processed without manual intervention. Despite this, genome assemblers now readily assemble medium short reads into long contigs (>97-98% genome coverage). A notable gap in pyrosequencing technology is the quality of base pair calling and conflicting base pairs between single reads at the same nucleotide position. Regardless, using draft whole genomes that are not finished and remain fragmented into tens of contigs allows one to characterize

Data set for diet specific differential gene expression analysis in three Spodoptera moths

Directory of Open Access Journals (Sweden)

A. Roy

2016-09-01

Full Text Available Examination of closely related species pairs is suggested for evolutionary comparisons of different degrees of polyphagy, which we did here with three taxa of lepidopteran herbivores, Spodoptera spp (S. littoralis, S. frugiperda maize (C and rice (R strains for a RNAseq analysis of the midguts from the 3rd instar insect larvae for differential metabolic responses after feeding on pinto bean based artificial diet vs maize leaves. Paired-end (2×100 bp Illumina HiSeq2500 sequencing resulted in a total of 24, 23, 24, and 21 million reads for the SF-C-Maize, SF-C-Pinto, SF-R-Maize, SF-R Pinto, and a total of 35 and 36 million reads for the SL-Maize and SL-Pinto samples, respectively. After quality control measures, a total of 62.2 million reads from SL and 71.7 million reads from SF were used for transcriptome assembly (TA. The resulting final de novo reference TA (backbone for the SF taxa contained 37,985 contigs with a N50 contig size of 1030 bp and a maximum contig length of 17,093 bp, while for SL, 28,329 contigs were generated with a N50 contig size of 1980 bp and a maximum contig length of 18,267 bp. The data presented herein contains supporting information related to our research article Roy et al. (2016 http://dx.doi.org/10.1016/j.ibmb.2016.02.006 [1]. Keywords: Differential expression analysis (DGE, Transcriptomics, Spodoptera, Adaptation, Generalist, Specialist, RPKM (reads per kilo base of transcript per million mapped reads, RNA seq

Anhidrotic ectodermal dysplasia gene region cloned in yeast artificial chromosomes

Energy Technology Data Exchange (ETDEWEB)

Kere, J. [Washington Univ. School of Medicine, St. Louis, MO (United States)]|[Univ. of Helsinki (Finland); Grzeschik, K.H. [Univ. of Marburg (Germany); Limon, J. [Medical Academy, Gdansk (Poland); Gremaud, M.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); De La Chapelle, A. [Univ. of Helsinki (Finland)

1993-05-01

Anhidrotic ectodermal dysplasia (EDA), an X-chromosomal recessive disorder, is expressed in a few females with chromosomal translocations involving bands Xq12-q13. Using available DNA markers from the region and somatic cell hybrids the authors mapped the X-chromosomal breakpoints in two such translocations. The breakpoints were further mapped within a yeast artificial chromosome contig constructed by chromosome walking techniques. Genomic DNA markers that map between the two translocation breakpoints were recovered representing putative portions of the EDA gene. 32 refs., 3 figs., 1 tab.

Comparative mapping in intraspecific populations uncovers a high degree of macrosynteny between A- and B-genome diploid species of peanut

Directory of Open Access Journals (Sweden)

Guo Yufang

2012-11-01

Full Text Available Abstract Background Cultivated peanut or groundnut (Arachis hypogaea L. is an important oilseed crop with an allotetraploid genome (AABB, 2n = 4x = 40. Both the low level of genetic variation within the cultivated gene pool and its polyploid nature limit the utilization of molecular markers to explore genome structure and facilitate genetic improvement. Nevertheless, a wealth of genetic diversity exists in diploid Arachis species (2n = 2x = 20, which represent a valuable gene pool for cultivated peanut improvement. Interspecific populations have been used widely for genetic mapping in diploid species of Arachis. However, an intraspecific mapping strategy was essential to detect chromosomal rearrangements among species that could be obscured by mapping in interspecific populations. To develop intraspecific reference linkage maps and gain insights into karyotypic evolution within the genus, we comparatively mapped the A- and B-genome diploid species using intraspecific F2 populations. Exploring genome organization among diploid peanut species by comparative mapping will enhance our understanding of the cultivated tetraploid peanut genome. Moreover, new sources of molecular markers that are highly transferable between species and developed from expressed genes will be required to construct saturated genetic maps for peanut. Results A total of 2,138 EST-SSR (expressed sequence tag-simple sequence repeat markers were developed by mining a tetraploid peanut EST assembly including 101,132 unigenes (37,916 contigs and 63,216 singletons derived from 70,771 long-read (Sanger and 270,957 short-read (454 sequences. A set of 97 SSR markers were also developed by mining 9,517 genomic survey sequences of Arachis. An SSR-based intraspecific linkage map was constructed using an F2 population derived from a cross between K 9484 (PI 298639 and GKBSPSc 30081 (PI 468327 in the B-genome species A. batizocoi. A high degree of macrosynteny was observed

De novo assembly of a cotyledon-enriched transcriptome map of Vicia faba (L. for transfer cell research

Directory of Open Access Journals (Sweden)

Kiruba Shankari eArun Chinnappa

2015-04-01

Full Text Available Vicia faba (L. is an important cool-season grain legume species used widely in agriculture but also in plant physiology research, particularly as an experimental model to study transfer cell (TC development. Adaxial epidermal cells of isolated cotyledons can be induced to form functional TCs, thus providing a valuable experimental system to investigate genetic regulation of TC development. The genome of V. faba is exceedingly large (ca. 13 Gb, however, and limited genomic information is available for this species. To provide a resource for transcript profiling of epidermal TC development, we have undertaken de novo assembly of a cotyledon-enriched transcriptome map for V. faba. Illumina paired-end sequencing of total RNA pooled from different tissues and different stages, including isolated cotyledons induced to form TCs, generated 69.5M reads, of which 65.8M were used for assembly following trimming and quality control. Assembly using a De-Bruijn graph-based approach within CLC Genomics Workbench v6.1 generated 21,297 contigs, of which 80.6% were successfully annotated against GO terms. The assembly was validated against known V. faba cDNAs held in GenBank, including transcripts previously identified as being specifically expressed in epidermal cells across TC trans-differentiation. This cotyledon-enriched transcriptome map therefore provides a valuable tool for future transcript profiling of epidermal TC development, and also enriches the genetic resources available for this important legume crop species.

A brain-specific gene cluster isolated from the region of the mouse obesity locus is expressed in the adult hypothalamus and during mouse development

Energy Technology Data Exchange (ETDEWEB)

Laig-Webster, M.; Lim, M.E.; Chehab, F.F. [Univ. of California, San Francisco, CA (United States)

1994-09-01

The molecular defect underlying an autosomal recessive form of genetic obesity in a classical mouse model C57 BL/6J-ob/ob has not yet been elucidated. Whereas metabolic and physiological disturbances such as diabetes and hypertension are associated with obesity, the site of expression and the nature of the primary lesion responsible for this cascade of events remains elusive. Our efforts aimed at the positional cloning of the ob gene by YAC contig mapping and gene identification have resulted in the cloning of a brain-specific gene cluster from the ob critical region. The expression of this gene cluster is remarkably complex owing to the multitude of brain-specific mRNA transcripts detected on Northern blots. cDNA cloning of these transcripts suggests that they are expressed from different genes as well as by alternate splicing mechanisms. Furthermore, the genomic organization of the cluster appears to consist of at least two identical promoters displaying CpG islands characteristic of housekeeping genes, yet clearly involving tissue-specific expression. Sense and anti-sense synthetic RNA probes were derived from a common DNA sequence on 3 cDNA clones and hybridized to 8-16 days mouse embryonic stages and mouse adult brain sections. Expression in development was noticeable as of the 11th day of gestation and confined to the central nervous system mainly in the telencephalon and spinal cord. Coronal and sagittal sections of the adult mouse brain showed expression only in 3 different regions of the brain stem. In situ hybridization to mouse hypothalamus sections revealed the presence of a localized and specialized group of cells expressing high levels of mRNA, suggesting that this gene cluster may also be involved in the regulation of hypothalamic activities. The hypothalamus has long been hypothesized as a primary candidate tissue for the expression of the obesity gene mainly because of its well-established role in the regulation of energy metabolism and food intake.

Mapping out Map Libraries

Directory of Open Access Journals (Sweden)

Ferjan Ormeling

2008-09-01

Full Text Available Discussing the requirements for map data quality, map users and their library/archives environment, the paper focuses on the metadata the user would need for a correct and efficient interpretation of the map data. For such a correct interpretation, knowledge of the rules and guidelines according to which the topographers/cartographers work (such as the kind of data categories to be collected, and the degree to which these rules and guidelines were indeed followed are essential. This is not only valid for the old maps stored in our libraries and archives, but perhaps even more so for the new digital files as the format in which we now have to access our geospatial data. As this would be too much to ask from map librarians/curators, some sort of web 2.0 environment is sought where comments about data quality, completeness and up-to-dateness from knowledgeable map users regarding the specific maps or map series studied can be collected and tagged to scanned versions of these maps on the web. In order not to be subject to the same disadvantages as Wikipedia, where the ‘communis opinio’ rather than scholarship, seems to be decisive, some checking by map curators of this tagged map use information would still be needed. Cooperation between map curators and the International Cartographic Association ( ICA map and spatial data use commission to this end is suggested.

Dicty_cDB: SSA260 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available RP11-626A3 map 2, WORKING DRAFT SEQUENCE, 29 unordered pieces. 42 6.4 1 AE014305 |AE014305.1 Homo sapiens chromosome 13q34 schizophre...nia region contig 1 section 2 of 11 of the complete sequence. 42 6.4 1 BZ851208 |BZ

Cis-Acting Determinants Affecting Centromere Function, Sister-Chromatid Cohesion and Reciprocal Recombination during Meiosis in Saccharomyces Cerevisiae

OpenAIRE

Sears, D. D.; Hegemann, J. H.; Shero, J. H.; Hieter, P.

1995-01-01

We have employed a system that utilizes homologous pairs of human DNA-derived yeast artificial chromosomes (YACs) as marker chromosomes to assess the specific role (s) of conserved centromere DNA elements (CDEI, CDEII and CDEIII) in meiotic chromosome disjunction fidelity. Thirteen different centromere (CEN) mutations were tested for their effects on meiotic centromere function. YACs containing a wild-type CEN DNA sequence segregate with high fidelity in meiosis I (99% normal segregation) and...

Myeloid- and lymphoid-specific breakpoint cluster regions in chromosome band 13q14 in acute leukemia.

Science.gov (United States)

Coignet, L J; Lima, C S; Min, T; Streubel, B; Swansbury, J; Telford, N; Swanton, S; Bowen, A; Nagai, M; Catovsky, D; Fonatsch, C; Dyer, M J

1999-07-01

Abnormalities of chromosome band 13q14 occur in hematologic malignancies of all lineages and at all stages of differentiation. Unlike other chromosomal translocations, which are usually specific for a given lineage, the chromosomal translocation t(12;13)(p12;q14) has been observed in both B-cell and T-cell precursor acute lymphoblastic leukemia (BCP-, TCP-ALL), in differentiated and undifferentiated acute myeloblastic leukemia (AML), and in chronic myeloid leukemia (CML) at progression to blast crisis. The nature of these translocations and their pathologic consequences remain unknown. To begin to define the gene(s) involved on chromosome 13, we have performed fluorescence in situ hybridization (FISH) using a panel of YACs from the region, on a series of 10 cases of acute leukemia with t(12;13)(p12;q14) and 1 case each with "variant" translocations including t(12;13)(q21;q14), t(10;13)(q24;q14) and t(9;13)(p21;q14). In 8/13 cases/cell lines, the 13q14 break fell within a single 1.4 Mb CEPH MegaYAC. This YAC fell immediately telomeric of the forkhead (FKHR) gene, which is disrupted in the t(2;13)(q35;q14) seen in pediatric alveolar rhabdomyosarcoma. Seven of the 8 cases with breaks in this YAC were AML. In 4/13 cases, the 13q14 break fell within a 1.7-Mb YAC located about 3 Mb telomeric of the retinoblastoma (RB1) gene: all 4 cases were ALL. One case of myelodysplastic syndrome exhibited a break within 13q12, adjacent to the BRCA2 gene. These data indicate the presence of myeloid- and lymphoid-specific breakpoint cluster regions within chromosome band 13q14 in acute leukemia.

Collinearity Analysis and High-Density Genetic Mapping of the Wheat Powdery Mildew Resistance Gene Pm40 in PI 672538

Science.gov (United States)

Fatima, Syeda Akash; Yang, Jiezhi; Chen, Wanquan; Liu, Taiguo; Hu, Yuting; Li, Qing; Guo, Jingwei; Zhang, Min; Lei, Li; Li, Xin; Tang, Shengwen; Luo, Peigao

2016-01-01

The wheat powdery mildew resistance gene Pm40, which is located on chromosomal arm 7BS, is effective against nearly all prevalent races of Blumeria graminis f. sp tritici (Bgt) in China and is carried by the common wheat germplasm PI 672538. A set of the F1, F2 and F2:3 populations from the cross of the resistant PI 672538 with the susceptible line L1034 were used to conduct genetic analysis of powdery mildew resistance and construct a high-density linkage map of the Pm40 gene. We constructed a high-density linkage genetic map with a total length of 6.18 cM and average spacing between markers of 0.48 cM.Pm40 is flanked by Xwmc335 and BF291338 at genetic distances of 0.58 cM and 0.26 cM, respectively, in deletion bin C-7BS-1-0.27. Comparative genomic analysis based on EST-STS markers established a high level of collinearity of the Pm40 genomic region with a 1.09-Mbp genomic region on Brachypodium chromosome 3, a 1.16-Mbp genomic region on rice chromosome 8, and a 1.62-Mbp genomic region on sorghum chromosome 7. We further anchored the Pm40 target intervals to the wheat genome sequence. A putative linear index of 85 wheat contigs containing 97 genes on 7BS was constructed. In total, 9 genes could be considered as candidates for the resistances to powdery mildew in the target genomic regions, which encoded proteins that were involved in the plant defense and response to pathogen attack. These results will facilitate the development of new markers for map-based cloning and marker-assisted selection of Pm40 in wheat breeding programs. PMID:27755575

Fine mapping and identification of a candidate gene for the barley Un8 true loose smut resistance gene.

Science.gov (United States)

Zang, Wen; Eckstein, Peter E; Colin, Mark; Voth, Doug; Himmelbach, Axel; Beier, Sebastian; Stein, Nils; Scoles, Graham J; Beattie, Aaron D

2015-07-01

The candidate gene for the barley Un8 true loose smut resistance gene encodes a deduced protein containing two tandem protein kinase domains. In North America, durable resistance against all known isolates of barley true loose smut, caused by the basidiomycete pathogen Ustilago nuda (Jens.) Rostr. (U. nuda), is under the control of the Un8 resistance gene. Previous genetic studies mapped Un8 to the long arm of chromosome 5 (1HL). Here, a population of 4625 lines segregating for Un8 was used to delimit the Un8 gene to a 0.108 cM interval on chromosome arm 1HL, and assign it to fingerprinted contig 546 of the barley physical map. The minimal tilling path was identified for the Un8 locus using two flanking markers and consisted of two overlapping bacterial artificial chromosomes. One gene located close to a marker co-segregating with Un8 showed high sequence identity to a disease resistance gene containing two kinase domains. Sequence of the candidate gene from the parents of the segregating population, and in an additional 19 barley lines representing a broader spectrum of diversity, showed there was no intron in alleles present in either resistant or susceptible lines, and fifteen amino acid variations unique to the deduced protein sequence in resistant lines differentiated it from the deduced protein sequences in susceptible lines. Some of these variations were present within putative functional domains which may cause a loss of function in the deduced protein sequences within susceptible lines.

Active role of a human genomic insert in replication of a yeast artificial chromosome.

Science.gov (United States)

van Brabant, A J; Fangman, W L; Brewer, B J

1999-06-01

Yeast artificial chromosomes (YACs) are a common tool for cloning eukaryotic DNA. The manner by which large pieces of foreign DNA are assimilated by yeast cells into a functional chromosome is poorly understood, as is the reason why some of them are stably maintained and some are not. We examined the replication of a stable YAC containing a 240-kb insert of DNA from the human T-cell receptor beta locus. The human insert contains multiple sites that serve as origins of replication. The activity of these origins appears to require the yeast ARS consensus sequence and, as with yeast origins, additional flanking sequences. In addition, the origins in the human insert exhibit a spacing, a range of activation efficiencies, and a variation in times of activation during S phase similar to those found for normal yeast chromosomes. We propose that an appropriate combination of replication origin density, activation times, and initiation efficiencies is necessary for the successful maintenance of YAC inserts.

Single-copy genes define a conserved order between rice and wheat for understanding differences caused by duplication, deletion, and transposition of genes.

Science.gov (United States)

Singh, Nagendra K; Dalal, Vivek; Batra, Kamlesh; Singh, Binay K; Chitra, G; Singh, Archana; Ghazi, Irfan A; Yadav, Mahavir; Pandit, Awadhesh; Dixit, Rekha; Singh, Pradeep K; Singh, Harvinder; Koundal, Kirpa R; Gaikwad, Kishor; Mohapatra, Trilochan; Sharma, Tilak R

2007-01-01

The high-quality rice genome sequence is serving as a reference for comparative genome analysis in crop plants, especially cereals. However, early comparisons with bread wheat showed complex patterns of conserved synteny (gene content) and colinearity (gene order). Here, we show the presence of ancient duplicated segments in the progenitor of wheat, which were first identified in the rice genome. We also show that single-copy (SC) rice genes, those representing unique matches with wheat expressed sequence tag (EST) unigene contigs in the whole rice genome, show more than twice the proportion of genes mapping to syntenic wheat chromosome as compared to the multicopy (MC) or duplicated rice genes. While 58.7% of the 1,244 mapped SC rice genes were located in single syntenic wheat chromosome groups, the remaining 41.3% were distributed randomly to the other six non-syntenic wheat groups. This could only be explained by a background dispersal of genes in the genome through transposition or other unknown mechanism. The breakdown of rice-wheat synteny due to such transpositions was much greater near the wheat centromeres. Furthermore, the SC rice genes revealed a conserved primordial gene order that gives clues to the origin of rice and wheat chromosomes from a common ancestor through polyploidy, aneuploidy, centromeric fusions, and translocations. Apart from the bin-mapped wheat EST contigs, we also compared 56,298 predicted rice genes with 39,813 wheat EST contigs assembled from 409,765 EST sequences and identified 7,241 SC rice gene homologs of wheat. Based on the conserved colinearity of 1,063 mapped SC rice genes across the bins of individual wheat chromosomes, we predicted the wheat bin location of 6,178 unmapped SC rice gene homologs and validated the location of 213 of these in the telomeric bins of 21 wheat chromosomes with 35.4% initial success. This opens up the possibility of directed mapping of a large number of conserved SC rice gene homologs in wheat

elPrep: High-Performance Preparation of Sequence Alignment/Map Files for Variant Calling.

Directory of Open Access Journals (Sweden)

Charlotte Herzeel

Full Text Available elPrep is a high-performance tool for preparing sequence alignment/map files for variant calling in sequencing pipelines. It can be used as a replacement for SAMtools and Picard for preparation steps such as filtering, sorting, marking duplicates, reordering contigs, and so on, while producing identical results. What sets elPrep apart is its software architecture that allows executing preparation pipelines by making only a single pass through the data, no matter how many preparation steps are used in the pipeline. elPrep is designed as a multithreaded application that runs entirely in memory, avoids repeated file I/O, and merges the computation of several preparation steps to significantly speed up the execution time. For example, for a preparation pipeline of five steps on a whole-exome BAM file (NA12878, we reduce the execution time from about 1:40 hours, when using a combination of SAMtools and Picard, to about 15 minutes when using elPrep, while utilising the same server resources, here 48 threads and 23GB of RAM. For the same pipeline on whole-genome data (NA12878, elPrep reduces the runtime from 24 hours to less than 5 hours. As a typical clinical study may contain sequencing data for hundreds of patients, elPrep can remove several hundreds of hours of computing time, and thus substantially reduce analysis time and cost.

Whole-genome profiling and shotgun sequencing delivers an anchored, gene-decorated, physical map assembly of bread wheat chromosome 6A

Czech Academy of Sciences Publication Activity Database

Poursarebani, N.; Nussbaumer, T.; Šimková, Hana; Šafář, Jan; Witsenboer, H.; van Oeveren, J.; Doležel, Jaroslav; Mayer, K. F. X.; Stein, N.; Schnurbusch, T.

2014-01-01

Roč. 79, č. 2 (2014), s. 334-347 ISSN 0960-7412 Institutional support: RVO:61389030 Keywords : bread wheat chromosome 6A * whole-genome profiling * LINEAR TOPOLOGICAL CONTIGS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.972, year: 2014

Evaluation of stress tolerance and fermentative behavior of indigenous Saccharomyces cerevisiae

Directory of Open Access Journals (Sweden)

Cíntia Lacerda Ramos

2013-09-01

Full Text Available Sixty six indigenous Saccharomyces cerevisiae strains were evaluated in stressful conditions (temperature, osmolarity, sulphite and ethanol tolerance and also ability to flocculate. Eighteen strains showed tolerant characteristics to these stressful conditions, growing at 42 ºC, in 0.04% sulphite, 1 mol L-1 NaCl and 12% ethanol. No flocculent characteristics were observed. These strains were evaluated according to their fermentative performance in sugar cane juice. The conversion factors of substrates into ethanol (Yp/s, glycerol (Yg/s and acetic acid (Yac/s, were calculated. The highest values of Yp/s in sugar cane juice fermentation were obtained by four strains, one isolated from fruit (0.46 and the others from sugar cane (0.45, 0.44 and 0.43. These values were higher than the value obtained using traditional yeast (0.38 currently employed in the Brazilian bioethanol industry. The parameters Yg/s and Yac/s were low for all strains. The UFLA FW221 presented the higher values for parameter related to bioethanol production. Thus, it was tested in co-culture with Lactobacillus fermentum. Besides this, a 20-L vessel for five consecutive batches of fermentation was performed. This strain was genetically stable and remained viable during all batches, producing high amounts of ethanol. The UFLA FW221 isolated from fruit was suitable to produce bioethanol in sugar cane juice. Therefore, the study of the biodiversity of yeasts from different environmental can reveal strains with desired characteristics to industrial applications.

Transcriptome resources for the perennial sunflower Helianthus maximiliani obtained from ecologically divergent populations.

Science.gov (United States)

Kawakami, Takeshi; Darby, Brian J; Ungerer, Mark C

2014-07-01

Next-generation sequencing (NGS) technologies provide a rapid means to generate genomic resources for species exhibiting interesting ecological and evolutionary variation but for which such resources are scant or nonexistent. In the current report, we utilize 454 pyrosequencing to obtain transcriptome information for multiple individuals and tissue types from geographically disparate and ecologically differentiated populations of the perennial sunflower species Helianthus maximiliani. A total of 850 275 raw reads were obtained averaging 355 bp in length. Reads were assembled, postprocessing, into 16 681 unique contigs with an N50 of 898 bp and a total length of 13.6 Mb. A majority (67%) of these contigs were annotated based on comparison with the Arabidopsis thaliana genome (TAIR10). Contigs were identified that exhibit high similarity to genes associated with natural variation in flowering time and freezing tolerance in other plant species and will facilitate future studies aimed at elucidating the molecular basis of clinal life history variation and adaptive differentiation in H. maximiliani. Large numbers of gene-associated simple sequence repeats (SSRs) and single-nucleotide polymorphisms (SNPs) also were identified that can be deployed in mapping and population genomic analyses. © 2014 John Wiley & Sons Ltd.

A contig-based strategy for the genome-wide discovery of microRNAs without complete genome resources.

Directory of Open Access Journals (Sweden)

Jun-Zhi Wen

Full Text Available MicroRNAs (miRNAs are important regulators of many cellular processes and exist in a wide range of eukaryotes. High-throughput sequencing is a mainstream method of miRNA identification through which it is possible to obtain the complete small RNA profile of an organism. Currently, most approaches to miRNA identification rely on a reference genome for the prediction of hairpin structures. However, many species of economic and phylogenetic importance are non-model organisms without complete genome sequences, and this limits miRNA discovery. Here, to overcome this limitation, we have developed a contig-based miRNA identification strategy. We applied this method to a triploid species of edible banana (GCTCV-119, Musa spp. AAA group and identified 180 pre-miRNAs and 314 mature miRNAs, which is three times more than those were predicted by the available dataset-based methods (represented by EST+GSS. Based on the recently published miRNA data set of Musa acuminate, the recall rate and precision of our strategy are estimated to be 70.6% and 92.2%, respectively, significantly better than those of EST+GSS-based strategy (10.2% and 50.0%, respectively. Our novel, efficient and cost-effective strategy facilitates the study of the functional and evolutionary role of miRNAs, as well as miRNA-based molecular breeding, in non-model species of economic or evolutionary interest.

Dicty_cDB: Contig-U14882-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available stelium discoideum chromosome 2 map 1685067... 34 6.1 10 ( AY843333 ) Human rotavirus G10 isolate 86 VP7 gen...e, complete... 34 6.3 2 ( AY843332 ) Human rotavirus G10 isolate 402 VP7 gene, co

Constraining eye movement in individuals with Parkinson's disease during walking turns.

Science.gov (United States)

Ambati, V N Pradeep; Saucedo, Fabricio; Murray, Nicholas G; Powell, Douglas W; Reed-Jones, Rebecca J

2016-10-01

Walking and turning is a movement that places individuals with Parkinson's disease (PD) at increased risk for fall-related injury. However, turning is an essential movement in activities of daily living, making up to 45 % of the total steps taken in a given day. Hypotheses regarding how turning is controlled suggest an essential role of anticipatory eye movements to provide feedforward information for body coordination. However, little research has investigated control of turning in individuals with PD with specific consideration for eye movements. The purpose of this study was to examine eye movement behavior and body segment coordination in individuals with PD during walking turns. Three experimental groups, a group of individuals with PD, a group of healthy young adults (YAC), and a group of healthy older adults (OAC), performed walking and turning tasks under two visual conditions: free gaze and fixed gaze. Whole-body motion capture and eye tracking characterized body segment coordination and eye movement behavior during walking trials. Statistical analysis revealed significant main effects of group (PD, YAC, and OAC) and visual condition (free and fixed gaze) on timing of segment rotation and horizontal eye movement. Within group comparisons, revealed timing of eye and head movement was significantly different between the free and fixed gaze conditions for YAC (p  0.05). In addition, while intersegment timings (reflecting segment coordination) were significantly different for YAC and OAC during free gaze (p training programs for those with PD, possibly promoting better coordination during turning and potentially reducing the risk of falls.

A highly redundant BAC library of Atlantic salmon (Salmo salar: an important tool for salmon projects

Directory of Open Access Journals (Sweden)

Koop Ben F

2005-04-01

Full Text Available Abstract Background As farming of Atlantic salmon is growing as an aquaculture enterprise, the need to identify the genomic mechanisms for specific traits is becoming more important in breeding and management of the animal. Traits of importance might be related to growth, disease resistance, food conversion efficiency, color or taste. To identify genomic regions responsible for specific traits, genomic large insert libraries have previously proven to be of crucial importance. These large insert libraries can be screened using gene or genetic markers in order to identify and map regions of interest. Furthermore, large-scale mapping can utilize highly redundant libraries in genome projects, and hence provide valuable data on the genome structure. Results Here we report the construction and characterization of a highly redundant bacterial artificial chromosome (BAC library constructed from a Norwegian aquaculture strain male of Atlantic salmon (Salmo salar. The library consists of a total number of 305 557 clones, in which approximately 299 000 are recombinants. The average insert size of the library is 188 kbp, representing 18-fold genome coverage. High-density filters each consisting of 18 432 clones spotted in duplicates have been produced for hybridization screening, and are publicly available 1. To characterize the library, 15 expressed sequence tags (ESTs derived overgos and 12 oligo sequences derived from microsatellite markers were used in hybridization screening of the complete BAC library. Secondary hybridizations with individual probes were performed for the clones detected. The BACs positive for the EST probes were fingerprinted and mapped into contigs, yielding an average of 3 contigs for each probe. Clones identified using genomic probes were PCR verified using microsatellite specific primers. Conclusion Identification of genes and genomic regions of interest is greatly aided by the availability of the CHORI-214 Atlantic salmon BAC

Maps & minds : mapping through the ages

Science.gov (United States)

,

1984-01-01

Throughout time, maps have expressed our understanding of our world. Human affairs have been influenced strongly by the quality of maps available to us at the major turning points in our history. "Maps & Minds" traces the ebb and flow of a few central ideas in the mainstream of mapping. Our expanding knowledge of our cosmic neighborhood stems largely from a small number of simple but grand ideas, vigorously pursued.

A simple strategy for subcloning and amplifying random multimegabase subchromosomal acentric DNA fragments as double minute chromosomes

International Nuclear Information System (INIS)

Hahn, P.J.; Giddings, L.; Lane, M.J.

1989-01-01

Restriction mapping of relatively large genomes (e.g. human) utilizing randomly generated DNA segments requires high mapping redundancy to successfully organize 'contigs' to represent the entire genome. The number of independent DNA segment maps required is dependent on the average size of a mapping segment; the larger the segment, the fewer required. The authors have developed a strategy for subcloning intact multimegabase subchromosomal fragments as double minute chromosomes. Such fragments could serve as primary mapping elements or as adjunct (linking) fragments to rapidly connect already existent contigs generated using yeast artificial chromosomes or cosmids. They present several lines of evidence supporting the viability of this approach. (1) X-ray treated EMT-6 mouse cells (7.5 Gr.) which are selected over several months with increasing levels of methotrexate (MTX) contain highly amplified circular DNA molecules (double minutes) which include the dihydrofolate reductase (DHFR) gene in a size range between 1,000 and 3,500 kilobases as determined by pulsed-field gel electrophoresis and these acentric chromosomal fragments have been stably maintained in culture for at least a year. (2) Preliminary data based on experiments involving fusion of X-irradiated Chinese Hamster Ovary (CH0 DG44) cells containing randomly inserted cotransfected Neomycin resistance and DHFR genes to mouse EMT-6 cells shows that the linked genes can be readily cotransferred as acentric subchromosomal fragment(s) suitable for gene amplification. (3) The studies of CHO cells with cell fusion transferred X-ray induced chromosomal fragments containing the natural CHO DHFR gene suggest that transferred chromosome fragments undergo gene amplification much more readily than nonfragmented endogenous DHFR genes

Structure, expression profile and phylogenetic inference of chalcone isomerase-like genes from the narrow-leafed lupin (Lupinus angustifolius L. genome

Directory of Open Access Journals (Sweden)

Łucja ePrzysiecka

2015-04-01

Full Text Available Lupins, like other legumes, have a unique biosynthesis scheme of 5-deoxy-type flavonoids and isoflavonoids. A key enzyme in this pathway is chalcone isomerase (CHI, a member of CHI-fold protein family, encompassing subfamilies of CHI1, CHI2, CHI-like (CHIL, and fatty acid-binding (FAP proteins. Here, two Lupinus angustifolius (narrow-leafed lupin CHILs, LangCHIL1 and LangCHIL2, were identified and characterized using DNA fingerprinting, cytogenetic and linkage mapping, sequencing and expression profiling. Clones carrying CHIL sequences were assembled into two contigs. Full gene sequences were obtained from these contigs, and mapped in two L. angustifolius linkage groups by gene-specific markers. Bacterial artificial chromosome fluorescence in situ hybridization approach confirmed the localization of two LangCHIL genes in distinct chromosomes. The expression profiles of both LangCHIL isoforms were very similar. The highest level of transcription was in the roots of the third week of plant growth; thereafter, expression declined. The expression of both LangCHIL genes in leaves and stems was similar and low. Comparative mapping to reference legume genome sequences revealed strong syntenic links; however, LangCHIL2 contig had a much more conserved structure than LangCHIL1. LangCHIL2 is assumed to be an ancestor gene, whereas LangCHIL1 probably appeared as a result of duplication. As both copies are transcriptionally active, questions arise concerning their hypothetical functional divergence. Screening of the narrow-leafed lupin genome and transcriptome with CHI-fold protein sequences, followed by Bayesian inference of phylogeny and cross-genera synteny survey, identified representatives of all but one (CHI1 main subfamilies. They are as follows: two copies of CHI2, FAPa2 and CHIL, and single copies of FAPb and FAPa1. Duplicated genes are remnants of whole genome duplication which is assumed to have occurred after the divergence of Lupinus, Arachis

Differential maps, difference maps, interpolated maps, and long term prediction

International Nuclear Information System (INIS)

Talman, R.

1988-06-01

Mapping techniques may be thought to be attractive for the long term prediction of motion in accelerators, especially because a simple map can approximately represent an arbitrarily complicated lattice. The intention of this paper is to develop prejudices as to the validity of such methods by applying them to a simple, exactly solveable, example. It is shown that a numerical interpolation map, such as can be generated in the accelerator tracking program TEAPOT, predicts the evolution more accurately than an analytically derived differential map of the same order. Even so, in the presence of ''appreciable'' nonlinearity, it is shown to be impractical to achieve ''accurate'' prediction beyond some hundreds of cycles of oscillation. This suggests that the value of nonlinear maps is restricted to the parameterization of only the ''leading'' deviation from linearity. 41 refs., 6 figs

AcEST: [AcEST

Lifescience Database Archive (English)

Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95

Polyploidization altered gene functions in cotton (Gossypium spp.).

Science.gov (United States)

Xu, Zhanyou; Yu, John Z; Cho, Jaemin; Yu, Jing; Kohel, Russell J; Percy, Richard G

2010-12-16

Cotton (Gossypium spp.) is an important crop plant that is widely grown to produce both natural textile fibers and cottonseed oil. Cotton fibers, the economically more important product of the cotton plant, are seed trichomes derived from individual cells of the epidermal layer of the seed coat. It has been known for a long time that large numbers of genes determine the development of cotton fiber, and more recently it has been determined that these genes are distributed across At and Dt subgenomes of tetraploid AD cottons. In the present study, the organization and evolution of the fiber development genes were investigated through the construction of an integrated genetic and physical map of fiber development genes whose functions have been verified and confirmed. A total of 535 cotton fiber development genes, including 103 fiber transcription factors, 259 fiber development genes, and 173 SSR-contained fiber ESTs, were analyzed at the subgenome level. A total of 499 fiber related contigs were selected and assembled. Together these contigs covered about 151 Mb in physical length, or about 6.7% of the tetraploid cotton genome. Among the 499 contigs, 397 were anchored onto individual chromosomes. Results from our studies on the distribution patterns of the fiber development genes and transcription factors between the At and Dt subgenomes showed that more transcription factors were from Dt subgenome than At, whereas more fiber development genes were from At subgenome than Dt. Combining our mapping results with previous reports that more fiber QTLs were mapped in Dt subgenome than At subgenome, the results suggested a new functional hypothesis for tetraploid cotton. After the merging of the two diploid Gossypium genomes, the At subgenome has provided most of the genes for fiber development, because it continues to function similar to its fiber producing diploid A genome ancestor. On the other hand, the Dt subgenome, with its non-fiber producing D genome ancestor

Dicty_cDB: Contig-U04715-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available chromosome 2 map complem... 519 e-143 1 ( EW965373 ) BRHL_03_N23_T7 Headlice composite...0 1 ( EW965972 ) BRHL_05_O18_T7 Headlice composite library with al... 48 0.30 1 ( EW965952 ) BRHL_05_N17_T7 Headlice composite

Refined localization of the Escherichia coli F4ab/F4ac receptor locus on pig chromosome 13

DEFF Research Database (Denmark)

Joller, D.; Jørgensen, Claus Bøttcher; Bertschinger, H.U.

2009-01-01

Diarrhoea in newborn and weaned pigs caused by enterotoxigenic Escherichia coli (ETEC) expressing F4 fimbriae leads to considerable losses in pig production. In this study, we refined the mapping of the receptor locus for ETEC F4ab/F4ac adhesion (F4bcR) by joint analysis of Nordic and Swiss data...... (MUC4-8227) were used to create the linkage map. The region for F4bcR was refined to the interval SW207-S0075 on pig chromosome 13. The most probable position of F4bcR was in the SW207-MUC4 region. The order of six markers was supported by physical mapping on the BAC fingerprint contig from...

Meso(topoclimatic maps and mapping

Directory of Open Access Journals (Sweden)

Ladislav Plánka

2007-06-01

Full Text Available The atmospheric characteristics can be studied from many points of view, most often we talk about time and spatial standpoint. Application of time standpoint leads either to different kinds of the synoptic and prognostic maps production, which presents actual state of atmosphere in short time section in the past or in the near future or to the climatic maps production which presents longterm weather regime. Spatial standpoint then differs map works according to natural phenomenon proportions, whereas the scale of their graphic presentation can be different. It depends on production purpose of each work.In the paper there are analysed methods of mapping and climatic maps production, which display longterm regime of chosen atmospheric features. These athmosphere features are formed in interaction with land surface and also have direct influence on people and their activities throughout the country. At the same time they’re influenced by anthropogenic intervention to the landscape.

Dicty_cDB: Contig-U01715-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 0 2 ( AC116924 ) Dictyostelium discoideum chromosome 2 map 6357117... 50 0.17 1 ( FG297596 ) 1108793288766 New World... Screwworm Larvae 9387 EST... 42 0.20 2 ( FG295480 ) 1108770732782 New World...57227 Global-Ocean-Sampling_GS-27-01-01-1... 38 0.71 2 ( FG297390 ) 1108793286096 New World

YouGenMap: a web platform for dynamic multi-comparative mapping and visualization of genetic maps

Science.gov (United States)

Keith Batesole; Kokulapalan Wimalanathan; Lin Liu; Fan Zhang; Craig S. Echt; Chun Liang

2014-01-01

Comparative genetic maps are used in examination of genome organization, detection of conserved gene order, and exploration of marker order variations. YouGenMap is an open-source web tool that offers dynamic comparative mapping capability of users' own genetic mapping between 2 or more map sets. Users' genetic map data and optional gene annotations are...

TriMEDB: A database to integrate transcribed markers and facilitate genetic studies of the tribe Triticeae

Directory of Open Access Journals (Sweden)

Yoshida Takuhiro

2008-06-01

assembled to form 2737 unique marker groups as contigs. These contigs were applied for pairwise comparison among linkage maps obtained from different EST map resources. Conclusion TriMEDB provides information regarding transcribed genetic markers and functions as a semantic knowledgebase offering an informatics facility for the acceleration of QTL analysis and for population genetics studies of Triticeae.

Generalized Smooth Transition Map Between Tent and Logistic Maps

Science.gov (United States)

Sayed, Wafaa S.; Fahmy, Hossam A. H.; Rezk, Ahmed A.; Radwan, Ahmed G.

There is a continuous demand on novel chaotic generators to be employed in various modeling and pseudo-random number generation applications. This paper proposes a new chaotic map which is a general form for one-dimensional discrete-time maps employing the power function with the tent and logistic maps as special cases. The proposed map uses extra parameters to provide responses that fit multiple applications for which conventional maps were not enough. The proposed generalization covers also maps whose iterative relations are not based on polynomials, i.e. with fractional powers. We introduce a framework for analyzing the proposed map mathematically and predicting its behavior for various combinations of its parameters. In addition, we present and explain the transition map which results in intermediate responses as the parameters vary from their values corresponding to tent map to those corresponding to logistic map case. We study the properties of the proposed map including graph of the map equation, general bifurcation diagram and its key-points, output sequences, and maximum Lyapunov exponent. We present further explorations such as effects of scaling, system response with respect to the new parameters, and operating ranges other than transition region. Finally, a stream cipher system based on the generalized transition map validates its utility for image encryption applications. The system allows the construction of more efficient encryption keys which enhances its sensitivity and other cryptographic properties.

The genome of the extremophile crucifer Thellungiella parvula

KAUST Repository

Dassanayake, Maheshi; Oh, Dongha; Haas, Jeffrey S.; Herná ndez, Á lvaro Gonzalez; Hong, Hyewon; Ali, Shahjahan; Yun, Daejin; Bressan, Ray Anthony; Zhu, Jian-Kang; Bohnert, Hans Jü rgen; Cheeseman, John McP

2011-01-01

Thellungiella parvula is related to Arabidopsis thaliana and is endemic to saline, resource-poor habitats, making it a model for the evolution of plant adaptation to extreme environments. Here we present the draft genome for this extremophile species. Exclusively by next generation sequencing, we obtained the de novo assembled genome in 1,496 gap-free contigs, closely approximating the estimated genome size of 140 Mb. We anchored these contigs to seven pseudo chromosomes without the use of maps. We show that short reads can be assembled to a near-complete chromosome level for a eukaryotic species lacking prior genetic information. The sequence identifies a number of tandem duplications that, by the nature of the duplicated genes, suggest a possible basis for T. parvula's extremophile lifestyle. Our results provide essential background for developing genomically influenced testable hypotheses for the evolution of environmental stress tolerance. © 2011 Nature America, Inc. All rights reserved.

Dicty_cDB: Contig-U05153-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available inalis hermaphrodit... 46 1.5 1 ( EY498541 ) CBBP4184.rev CBBP Hirudo medicinalis h...ermaphrodit... 46 1.5 1 ( EY488990 ) CBBP16769.rev CBBP Hirudo medicinalis hermaphrodi... 46 1.5 1 ( AP00806... Homo sapiens chromosome 19 clone RP11-330I7 map 1... 46 1.5 1 ( EY498542 ) CBBP4184.fwd CBBP Hirudo medic

Physical mapping of the major early-onset familial Alzheimer`s disease locus on chromosome 14 and analysis of candidate gene sequences

Energy Technology Data Exchange (ETDEWEB)

Tanzi, R.E.; Romano, D.M.; Crowley, A.C. [Harvard Medical School, Charlestown, MA (United States)] [and others

1994-09-01

Genetic studies of kindreds displaying evidence for familial AD (FAD) have led to the localization of gene defects responsible for this disorder on chromosomes 14, 19, and 21. A minor early-onset FAD gene on chromosome 21 has been identified to enode the amyloid precursor protein (APP), and the late-onset FAD susceptibility locus on chromosome 19 has been shown to be in linkage disequilibrium with the E4 allele of the APOE gene. Meanwhile, the locus responsible for the major form of early-onset FAD on chromosome 14q24 has not yet been identified. By recombinational analysis, we have refined the minimal candidate region containing the gene defect to approximately 3 megabases in 14q24. We will describe our laboratory`s progress on attempts to finely localize this locus, as well as test known candidate genes from this region for either inclusion in the minimal candidate region or the presence of pathogenic mutations. Candidate genes that have been tested so far include cFOS, heat shock protein 70 member (HSF2A), transforming growth factor beta (TGFB3), the trifunctional protein C1-THF synthase (MTHFD), bradykinin receptor (BR), and the E2k component of a-ketoglutarate dehydrogenase. HSP2A, E2k, MTHFD, and BR do not map to the current defined minimal candidate region; however, sequence analysis must be performed to confirm exclusion of these genes as true candidates. Meanwhile, no pathogenic mutations have yet been found in cFOS or TGFB3. We have also isolated a large number of novel transcribed sequences from the minimal candidate region in the form of {open_quotes}trapped exons{close_quotes} from cosmids identified by hybridization to select YAC clones; we are currently in the process of searching for pathogenic mutations in these exons in affected individuals from FAD families.

Dicty_cDB: CHA362 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

Candidate genes that have facilitated freshwater adaptation by palaemonid prawns in the genus Macrobrachium: identification and expression validation in a model species (M. koombooloomba).

Science.gov (United States)

Rahi, Md Lifat; Amin, Shorash; Mather, Peter B; Hurwood, David A

2017-01-01

The endemic Australian freshwater prawn, Macrobrachium koombooloomba , provides a model for exploring genes involved with freshwater adaptation because it is one of the relatively few Macrobrachium species that can complete its entire life cycle in freshwater. The present study was conducted to identify potential candidate genes that are likely to contribute to effective freshwater adaptation by M. koombooloomba using a transcriptomics approach. De novo assembly of 75 bp paired end 227,564,643 high quality Illumina raw reads from 6 different cDNA libraries revealed 125,917 contigs of variable lengths (200-18,050 bp) with an N50 value of 1597. In total, 31,272 (24.83%) of the assembled contigs received significant blast hits, of which 27,686 and 22,560 contigs were mapped and functionally annotated, respectively. CEGMA (Core Eukaryotic Genes Mapping Approach) based transcriptome quality assessment revealed 96.37% completeness. We identified 43 different potential genes that are likely to be involved with freshwater adaptation in M. koombooloomba . Identified candidate genes included: 25 genes for osmoregulation, five for cell volume regulation, seven for stress tolerance, three for body fluid (haemolymph) maintenance, eight for epithelial permeability and water channel regulation, nine for egg size control and three for larval development. RSEM (RNA-Seq Expectation Maximization) based abundance estimation revealed that 6,253, 5,753 and 3,795 transcripts were expressed (at TPM value ≥10) in post larvae, juveniles and adults, respectively. Differential gene expression (DGE) analysis showed that 15 genes were expressed differentially in different individuals but these genes apparently were not involved with freshwater adaptation but rather were involved in growth, development and reproductive maturation. The genomic resources developed here will be useful for better understanding the molecular basis of freshwater adaptation in Macrobrachium prawns and other

Topographic mapping

Science.gov (United States)

,

2008-01-01

The U.S. Geological Survey (USGS) produced its first topographic map in 1879, the same year it was established. Today, more than 100 years and millions of map copies later, topographic mapping is still a central activity for the USGS. The topographic map remains an indispensable tool for government, science, industry, and leisure. Much has changed since early topographers traveled the unsettled West and carefully plotted the first USGS maps by hand. Advances in survey techniques, instrumentation, and design and printing technologies, as well as the use of aerial photography and satellite data, have dramatically improved mapping coverage, accuracy, and efficiency. Yet cartography, the art and science of mapping, may never before have undergone change more profound than today.

Dicty_cDB: Contig-U03788-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available e RP24-231O24 map ... 52 0.026 1 ( FG300143 ) 1108793359387 New World Screwworm L...arvae 9387 EST... 36 0.078 2 ( FG286554 ) 1108770721481 New World Screwworm Egg 9261 ESTs C... 36 0.078 2 ( ...FG287767 ) 1108770753655 New World Screwworm Egg 9261 ESTs C... 36 0.079 2 ( EY203968 ) PRAG-aaa88e08.g1 San

Dicty_cDB: Contig-U14237-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available romosome 2 map 5515173... 48 0.10 8 ( AY502546 ) HIV-1 isolate woman_116 clone 10... from Central Afr... 50 0.11 1 ( AY502311 ) HIV-1 isolate woman_116 clone 5 from Central Afri... 50 0.11 1 (... AY502192 ) HIV-1 isolate woman_116 clone 8 from Central Afri... 50 0.11 1 ( AY502180 ) HIV-1 isolate woman_

Dicty_cDB: CHR241 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

USGS Topo Base Map from The National Map

Data.gov (United States)

U.S. Geological Survey, Department of the Interior — The USGS Topographic Base Map from The National Map. This tile cached web map service combines the most current data services (Boundaries, Names, Transportation,...

USGS Map Indices Overlay Map Service from The National Map

Data.gov (United States)

U.S. Geological Survey, Department of the Interior — The USGS Map Indices service from The National Map (TNM) consists of 1x1 Degree, 30x60 Minute (100K), 15 Minute (63K), 7.5 Minute (24K), and 3.75 Minute grid...

Genetic and physical mapping of candidate genes for resistance to Fusarium oxysporum f.sp. tracheiphilum race 3 in cowpea [Vigna unguiculata (L.) Walp].

Science.gov (United States)

Pottorff, Marti; Wanamaker, Steve; Ma, Yaqin Q; Ehlers, Jeffrey D; Roberts, Philip A; Close, Timothy J

2012-01-01

Fusarium oxysporum f.sp. tracheiphilum (Fot) is a soil-borne fungal pathogen that causes vascular wilt disease in cowpea. Fot race 3 is one of the major pathogens affecting cowpea production in California. Identification of Fot race 3 resistance determinants will expedite delivery of improved cultivars by replacing time-consuming phenotypic screening with selection based on perfect markers, thereby generating successful cultivars in a shorter time period. Resistance to Fot race 3 was studied in the RIL population California Blackeye 27 (resistant) x 24-125B-1 (susceptible). Biparental mapping identified a Fot race 3 resistance locus, Fot3-1, which spanned 3.56 cM on linkage group one of the CB27 x 24-125B-1 genetic map. A marker-trait association narrowed the resistance locus to a 1.2 cM region and identified SNP marker 1_1107 as co-segregating with Fot3-1 resistance. Macro and microsynteny was observed for the Fot3-1 locus region in Glycine max where six disease resistance genes were observed in the two syntenic regions of soybean chromosomes 9 and 15. Fot3-1 was identified on the cowpea physical map on BAC clone CH093L18, spanning approximately 208,868 bp on BAC contig250. The Fot3-1 locus was narrowed to 0.5 cM distance on the cowpea genetic map linkage group 6, flanked by SNP markers 1_0860 and 1_1107. BAC clone CH093L18 was sequenced and four cowpea sequences with similarity to leucine-rich repeat serine/threonine protein kinases were identified and are cowpea candidate genes for the Fot3-1 locus. This study has shown how readily candidate genes can be identified for simply inherited agronomic traits when appropriate genetic stocks and integrated genomic resources are available. High co-linearity between cowpea and soybean genomes illustrated that utilizing synteny can transfer knowledge from a reference legume to legumes with less complete genomic resources. Identification of Fot race 3 resistance genes will enable transfer into high yielding cowpea varieties

ReactionMap: an efficient atom-mapping algorithm for chemical reactions.

Science.gov (United States)

Fooshee, David; Andronico, Alessio; Baldi, Pierre

2013-11-25

Large databases of chemical reactions provide new data-mining opportunities and challenges. Key challenges result from the imperfect quality of the data and the fact that many of these reactions are not properly balanced or atom-mapped. Here, we describe ReactionMap, an efficient atom-mapping algorithm. Our approach uses a combination of maximum common chemical subgraph search and minimization of an assignment cost function derived empirically from training data. We use a set of over 259,000 balanced atom-mapped reactions from the SPRESI commercial database to train the system, and we validate it on random sets of 1000 and 17,996 reactions sampled from this pool. These large test sets represent a broad range of chemical reaction types, and ReactionMap correctly maps about 99% of the atoms and about 96% of the reactions, with a mean time per mapping of 2 s. Most correctly mapped reactions are mapped with high confidence. Mapping accuracy compares favorably with ChemAxon's AutoMapper, versions 5 and 6.1, and the DREAM Web tool. These approaches correctly map 60.7%, 86.5%, and 90.3% of the reactions, respectively, on the same data set. A ReactionMap server is available on the ChemDB Web portal at http://cdb.ics.uci.edu .

Dicty_cDB: Contig-U04940-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available iscoideum chromosome 2 map 3622643... 32 0.081 12 ( GE806545 ) EST_scau_evk_971547 scauevk mixed_tissue Sebaste...s... 40 0.092 2 ( EW978238 ) EST_sras_evg_777463 srasevg mixed_tissue Sebastes... 40 0.093 2 ( EW984986 )... EST_sras_evg_777879 srasevg mixed_tissue Sebastes... 40 0.095 2 ( EW985351 ) EST..._sras_evg_778065 srasevg mixed_tissue Sebastes... 40 0.096 2 ( AC116305 ) Dictyostelium discoideum chromosom

A Scaffold Analysis Tool Using Mate-Pair Information in Genome Sequencing

Directory of Open Access Journals (Sweden)

Pan-Gyu Kim

2008-01-01

Full Text Available We have developed a Windows-based program, ConPath, as a scaffold analyzer. ConPath constructs scaffolds by ordering and orienting separate sequence contigs by exploiting the mate-pair information between contig-pairs. Our algorithm builds directed graphs from link information and traverses them to find the longest acyclic graphs. Using end read pairs of fixed-sized mate-pair libraries, ConPath determines relative orientations of all contigs, estimates the gap size of each adjacent contig pair, and reports wrong assembly information by validating orientations and gap sizes. We have utilized ConPath in more than 10 microbial genome projects, including Mannheimia succiniciproducens and Vibro vulnificus, where we verified contig assembly and identified several erroneous contigs using the four types of error defined in ConPath. Also, ConPath supports some convenient features and viewers that permit investigation of each contig in detail; these include contig viewer, scaffold viewer, edge information list, mate-pair list, and the printing of complex scaffold structures.

A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6.

Science.gov (United States)

Saski, Christopher A; Feltus, Frank A; Staton, Margaret E; Blackmon, Barbara P; Ficklin, Stephen P; Kuhn, David N; Schnell, Raymond J; Shapiro, Howard; Motamayor, Juan Carlos

2011-08-16

The fermented dried seeds of Theobroma cacao (cacao tree) are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS) II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105) span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map assembly. A comparison between the two T. cacao

A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6

Directory of Open Access Journals (Sweden)

Kuhn David N

2011-08-01

Full Text Available Abstract Background The fermented dried seeds of Theobroma cacao (cacao tree are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Results Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105 span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map

The genome of the extremophile crucifer Thellungiella parvula

KAUST Repository

Dassanayake, Maheshi

2011-08-07

Thellungiella parvula is related to Arabidopsis thaliana and is endemic to saline, resource-poor habitats, making it a model for the evolution of plant adaptation to extreme environments. Here we present the draft genome for this extremophile species. Exclusively by next generation sequencing, we obtained the de novo assembled genome in 1,496 gap-free contigs, closely approximating the estimated genome size of 140 Mb. We anchored these contigs to seven pseudo chromosomes without the use of maps. We show that short reads can be assembled to a near-complete chromosome level for a eukaryotic species lacking prior genetic information. The sequence identifies a number of tandem duplications that, by the nature of the duplicated genes, suggest a possible basis for T. parvula\\'s extremophile lifestyle. Our results provide essential background for developing genomically influenced testable hypotheses for the evolution of environmental stress tolerance. © 2011 Nature America, Inc. All rights reserved.

An overview of the human genome project

Energy Technology Data Exchange (ETDEWEB)

Batzer, M.A.

1994-01-01

The human genome project is one of the most ambitious scientific projects to date, with the ultimate goal being a nucleotide sequence for all four billion bases of human DNA. In the process of determining the nucleotide sequence for each base, the location, function, and regulatory regions from the estimated 100,000 human genes will be identified. The genome project itself relies upon maps of the human genetic code derived from several different levels of resolution. Genetic linkage analysis provides a low resolution genome map. The information for genetic linkage maps is derived from the analysis of chromosome specific markers such as Sequence Tagged Sites (STSs), Variable Number of Tandem Repeats (VNTRs) or other polymorphic (highly informative) loci in a number of different-families. Using this information the location of an unknown disease gene can be limited to a region comprised of one million base pairs of DNA or less. After this point, one must construct or have access to a physical map of the region of interest. Physical mapping involves the construction of an ordered overlapping (contiguous) set of recombinant DNA clones. These clones may be derived from a number of different vectors including cosmids, Bacterial Artificial Chromosomes (BACs), P1 derived Artificial Chromosomes (PACs), somatic cell hybrids, or Yeast Artificial Chromosomes (YACs). The ultimate goal for physical mapping is to establish a completely overlapping (contiguous) set of clones for the entire genome. After a gene or region of interest has been localized using physical mapping the nucleotide sequence is determined. The overlap between genetic mapping, physical mapping and DNA sequencing has proven to be a powerful tool for the isolation of disease genes through positional cloning.

Methylation-sensitive linking libraries enhance gene-enriched sequencing of complex genomes and map DNA methylation domains

Directory of Open Access Journals (Sweden)

Bharti Arvind K

2008-12-01

Full Text Available Abstract Background Many plant genomes are resistant to whole-genome assembly due to an abundance of repetitive sequence, leading to the development of gene-rich sequencing techniques. Two such techniques are hypomethylated partial restriction (HMPR and methylation spanning linker libraries (MSLL. These libraries differ from other gene-rich datasets in having larger insert sizes, and the MSLL clones are designed to provide reads localized to "epigenetic boundaries" where methylation begins or ends. Results A large-scale study in maize generated 40,299 HMPR sequences and 80,723 MSLL sequences, including MSLL clones exceeding 100 kb. The paired end reads of MSLL and HMPR clones were shown to be effective in linking existing gene-rich sequences into scaffolds. In addition, it was shown that the MSLL clones can be used for anchoring these scaffolds to a BAC-based physical map. The MSLL end reads effectively identified epigenetic boundaries, as indicated by their preferential alignment to regions upstream and downstream from annotated genes. The ability to precisely map long stretches of fully methylated DNA sequence is a unique outcome of MSLL analysis, and was also shown to provide evidence for errors in gene identification. MSLL clones were observed to be significantly more repeat-rich in their interiors than in their end reads, confirming the correlation between methylation and retroelement content. Both MSLL and HMPR reads were found to be substantially gene-enriched, with the SalI MSLL libraries being the most highly enriched (31% align to an EST contig, while the HMPR clones exhibited exceptional depletion of repetitive DNA (to ~11%. These two techniques were compared with other gene-enrichment methods, and shown to be complementary. Conclusion MSLL technology provides an unparalleled approach for mapping the epigenetic status of repetitive blocks and for identifying sequences mis-identified as genes. Although the types and natures of

Expanding Thurston maps

CERN Document Server

Bonk, Mario

2017-01-01

This monograph is devoted to the study of the dynamics of expanding Thurston maps under iteration. A Thurston map is a branched covering map on a two-dimensional topological sphere such that each critical point of the map has a finite orbit under iteration. It is called expanding if, roughly speaking, preimages of a fine open cover of the underlying sphere under iterates of the map become finer and finer as the order of the iterate increases. Every expanding Thurston map gives rise to a fractal space, called its visual sphere. Many dynamical properties of the map are encoded in the geometry of this visual sphere. For example, an expanding Thurston map is topologically conjugate to a rational map if and only if its visual sphere is quasisymmetrically equivalent to the Riemann sphere. This relation between dynamics and fractal geometry is the main focus for the investigations in this work.

On palaeogeographic map

Directory of Open Access Journals (Sweden)

Zeng-Zhao Feng

2016-01-01

Full Text Available The palaeogeographic map is a graphic representation of physical geographical characteristics in geological history periods and human history periods. It is the most important result of palaeogeographic study. The author, as the Editor-in-Chief of Journal of Palaeogeography, Chinese Edition and English Edition, aimed at the problems of the articles submitted to and published in the Journal of Palaeogeography in recent years and the relevant papers and books of others, and integrated with his practice of palaeogeographic study and mapping, wrote this paper. The content mainly includes the data of palaeogeographic mapping, the problems of palaeogeographic mapping method, the “Single factor analysis and multifactor comprehensive mapping method —— Methodology of quantitative lithofacies palaeogeography”, i.e., the “4 steps mapping method”, the nomenclature of each palaeogeographic unit in palaeogeographic map, the explanation of each palaeogeographic unit in palaeogeographic map, the explanation of significance of palaeogeographic map and palaeogeographic article, the evaluative standards of palaeogeographic map and palaeogeographic article, and the self-evaluation. Criticisms and corrections are welcome.

NeatMap--non-clustering heat map alternatives in R.

Science.gov (United States)

Rajaram, Satwik; Oono, Yoshi

2010-01-22

The clustered heat map is the most popular means of visualizing genomic data. It compactly displays a large amount of data in an intuitive format that facilitates the detection of hidden structures and relations in the data. However, it is hampered by its use of cluster analysis which does not always respect the intrinsic relations in the data, often requiring non-standardized reordering of rows/columns to be performed post-clustering. This sometimes leads to uninformative and/or misleading conclusions. Often it is more informative to use dimension-reduction algorithms (such as Principal Component Analysis and Multi-Dimensional Scaling) which respect the topology inherent in the data. Yet, despite their proven utility in the analysis of biological data, they are not as widely used. This is at least partially due to the lack of user-friendly visualization methods with the visceral impact of the heat map. NeatMap is an R package designed to meet this need. NeatMap offers a variety of novel plots (in 2 and 3 dimensions) to be used in conjunction with these dimension-reduction techniques. Like the heat map, but unlike traditional displays of such results, it allows the entire dataset to be displayed while visualizing relations between elements. It also allows superimposition of cluster analysis results for mutual validation. NeatMap is shown to be more informative than the traditional heat map with the help of two well-known microarray datasets. NeatMap thus preserves many of the strengths of the clustered heat map while addressing some of its deficiencies. It is hoped that NeatMap will spur the adoption of non-clustering dimension-reduction algorithms.

Human Mind Maps

Science.gov (United States)

Glass, Tom

2016-01-01

When students generate mind maps, or concept maps, the maps are usually on paper, computer screens, or a blackboard. Human Mind Maps require few resources and little preparation. The main requirements are space where students can move around and a little creativity and imagination. Mind maps can be used for a variety of purposes, and Human Mind…

Unpacking the cognitive map: the parallel map theory of hippocampal function.

Science.gov (United States)

Jacobs, Lucia F; Schenk, Françoise

2003-04-01

In the parallel map theory, the hippocampus encodes space with 2 mapping systems. The bearing map is constructed primarily in the dentate gyrus from directional cues such as stimulus gradients. The sketch map is constructed within the hippocampus proper from positional cues. The integrated map emerges when data from the bearing and sketch maps are combined. Because the component maps work in parallel, the impairment of one can reveal residual learning by the other. Such parallel function may explain paradoxes of spatial learning, such as learning after partial hippocampal lesions, taxonomic and sex differences in spatial learning, and the function of hippocampal neurogenesis. By integrating evidence from physiology to phylogeny, the parallel map theory offers a unified explanation for hippocampal function.

CrowdMapping: A Crowdsourcing-Based Terminology Mapping Method for Medical Data Standardization.

Science.gov (United States)

Mao, Huajian; Chi, Chenyang; Huang, Boyu; Meng, Haibin; Yu, Jinghui; Zhao, Dongsheng

2017-01-01

Standardized terminology is the prerequisite of data exchange in analysis of clinical processes. However, data from different electronic health record systems are based on idiosyncratic terminology systems, especially when the data is from different hospitals and healthcare organizations. Terminology standardization is necessary for the medical data analysis. We propose a crowdsourcing-based terminology mapping method, CrowdMapping, to standardize the terminology in medical data. CrowdMapping uses a confidential model to determine how terminologies are mapped to a standard system, like ICD-10. The model uses mappings from different health care organizations and evaluates the diversity of the mapping to determine a more sophisticated mapping rule. Further, the CrowdMapping model enables users to rate the mapping result and interact with the model evaluation. CrowdMapping is a work-in-progress system, we present initial results mapping terminologies.

Participatory Maps

DEFF Research Database (Denmark)

Salovaara-Moring, Inka

2016-01-01

practice. In particular, mapping environmental damage, endangered species, and human-made disasters has become one focal point for environmental knowledge production. This type of digital map has been highlighted as a processual turn in critical cartography, whereas in related computational journalism...... of a geo-visualization within information mapping that enhances embodiment in the experience of the information. InfoAmazonia is defined as a digitally created map-space within which journalistic practice can be seen as dynamic, performative interactions between journalists, ecosystems, space, and species...

Genetic mapping and legume synteny of aphid resistance in African cowpea (Vigna unguiculata L. Walp.) grown in California.

Science.gov (United States)

Huynh, Bao-Lam; Ehlers, Jeffrey D; Ndeve, Arsenio; Wanamaker, Steve; Lucas, Mitchell R; Close, Timothy J; Roberts, Philip A

The cowpea aphid Aphis craccivora Koch (CPA) is a destructive insect pest of cowpea, a staple legume crop in Sub-Saharan Africa and other semiarid warm tropics and subtropics. In California, CPA causes damage on all local cultivars from early vegetative to pod development growth stages. Sources of CPA resistance are available in African cowpea germplasm. However, their utilization in breeding is limited by the lack of information on inheritance, genomic location and marker linkage associations of the resistance determinants. In the research reported here, a recombinant inbred line (RIL) population derived from a cross between a susceptible California blackeye cultivar (CB27) and a resistant African breeding line (IT97K-556-6) was genotyped with 1,536 SNP markers. The RILs and parents were phenotyped for CPA resistance using field-based screenings during two main crop seasons in a 'hotspot' location for this pest within the primary growing region of the Central Valley of California. One minor and one major quantitative trait locus (QTL) were consistently mapped on linkage groups 1 and 7, respectively, both with favorable alleles contributed from IT97K-556-6. The major QTL appeared dominant based on a validation test in a related F2 population. SNP markers flanking each QTL were positioned in physical contigs carrying genes involved in plant defense based on synteny with related legumes. These markers could be used to introgress resistance alleles from IT97K-556-6 into susceptible local blackeye varieties by backcrossing.

Dicty_cDB: Contig-U12435-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available hromosome 2 map 4915084... 40 0.24 7 ( AY934834 ) Cotesia plutellae clone 501-510 NADH dehydrogenas... 40 0....25 2 ( AY934846 ) Cotesia plutellae clone 641-646 NADH dehydrogenas... 40 0.25 2 ( AY934845 ) Cotesia plutella...e clone 631-636 NADH dehydrogenas... 40 0.25 2 ( AY934844 ) Cotesia plutellae c...lone 611-620 NADH dehydrogenas... 40 0.25 2 ( AY934842 ) Cotesia plutellae clone 581-583 NADH dehydrogenas...... 40 0.25 2 ( AY934840 ) Cotesia plutellae clone 561-570 NADH dehydrogenas... 40 0.25 2 ( AY934839 ) Cotesia plutella

Digitised Maps in the Danish Map Collection

OpenAIRE

Annie Lenschau-Teglers; Vivi Gade Rønsberg

2005-01-01

As in the rest of the library world, The Royal Library in Copenhagen is in the process of digitising its collections. At the moment we are mainly working on the handwritten manual catalogue - but digitising the material is also a major working assignment. The Map Collection at The Royal Library has today divided the effort in digitising its materials into 3 groups: 1. Digitised maps as a vital addition to the records in our bibliographic database REX 2. Digitised maps presented as a Digital F...

Smart "geomorphological" map browsing - a tale about geomorphological maps and the internet

Science.gov (United States)

Geilhausen, M.; Otto, J.-C.

2012-04-01

With the digital production of geomorphological maps, the dissemination of research outputs now extends beyond simple paper products. Internet technologies can contribute to both, the dissemination of geomorphological maps and access to geomorphologic data and help to make geomorphological knowledge available to a greater public. Indeed, many national geological surveys employ end-to-end digital workflows from data capture in the field to final map production and dissemination. This paper deals with the potential of web mapping applications and interactive, portable georeferenced PDF maps for the distribution of geomorphological information. Web mapping applications such as Google Maps have become very popular and widespread and increased the interest and access to mapping. They link the Internet with GIS technology and are a common way of presenting dynamic maps online. The GIS processing is performed online and maps are visualised in interactive web viewers characterised by different capabilities such as zooming, panning or adding further thematic layers, with the map refreshed after each task. Depending on the system architecture and the components used, advanced symbology, map overlays from different applications and sources and their integration into a Desktop GIS are possible. This interoperability is achieved through the use of international open standards that include mechanisms for the integration and visualisation of information from multiple sources. The portable document format (PDF) is commonly used for printing and is a standard format that can be processed by many graphic software and printers without loss of information. A GeoPDF enables the sharing of geospatial maps and data in PDF documents. Multiple, independent map frames with individual spatial reference systems are possible within a GeoPDF, for example, for map overlays or insets. Geospatial functionality of a GeoPDF includes scalable map display, layer visibility control, access to attribute

Germ line transmission of a yeast artificial chromosome spanning the murine [alpha][sub 1](I) collagen locus

Energy Technology Data Exchange (ETDEWEB)

Strauss, W.M.; Dausman, J.; Beard, C.; Jaenisch, R. (Massachusetts Inst. of Technology, Cambridge (United States)); Johnson, C.; Lawrence, J.B. (Univ. of Massachusetts Medical School, Worcester (United States))

1993-03-26

Molecular complementation of mutant phenotypes by transgenic technology is a potentially important tool for gene identification. A technology was developed to allow the transfer of a physically intact yeast artificial chromosome (YAC) into the germ line of the mouse. A purified 150-kilobase YAC encompassing the murine gene Col1a1 was efficiently introduced into embryonic stem (ES) cells via lipofection. Chimeric founder mice were derived from two transfected ES cell clones. These chimeras transmitted the full length transgene through the germ line, generating two transgenic mouse strains. Transgene expression was visualized as nascent transcripts in interphase nuclei and quantitated by ribonuclease protection analysis. Both assays indicated that the transgene was expressed at levels comparable to the endogenous collagen gene. 32 refs., 3 figs., 1 tab.

Primary care for young adult cancer survivors: an international perspective

DEFF Research Database (Denmark)

Hølge-Hazelton, Bibi; Blake-Gumbs, Lyla; Miedema, Baujke

2010-01-01

health insurance in Denmark, The Netherlands, and Canada but not in the US. Once the YAC has completed acute treatment and follow-up care, they often return to the care of the FPs who may potentially be expected to deal with and take action upon any possible medical, mental health, and psychosocial...... issues the YA cancer patient may present with. The role of the FP in follow-up care seems to be very limited. CONCLUSIONS: YACs in the western world seem to have comparable medical and psychosocial problems. However, the nature of health insurance is such that it impacts differently on the care...... continuing medical education (CME) initiatives, and an enhanced cooperative effort between those delivering and coordinating cancer care....

Map Archive Mining: Visual-Analytical Approaches to Explore Large Historical Map Collections

Directory of Open Access Journals (Sweden)

Johannes H. Uhl

2018-04-01

Full Text Available Historical maps are unique sources of retrospective geographical information. Recently, several map archives containing map series covering large spatial and temporal extents have been systematically scanned and made available to the public. The geographical information contained in such data archives makes it possible to extend geospatial analysis retrospectively beyond the era of digital cartography. However, given the large data volumes of such archives (e.g., more than 200,000 map sheets in the United States Geological Survey topographic map archive and the low graphical quality of older, manually-produced map sheets, the process to extract geographical information from these map archives needs to be automated to the highest degree possible. To understand the potential challenges (e.g., salient map characteristics and data quality variations in automating large-scale information extraction tasks for map archives, it is useful to efficiently assess spatio-temporal coverage, approximate map content, and spatial accuracy of georeferenced map sheets at different map scales. Such preliminary analytical steps are often neglected or ignored in the map processing literature but represent critical phases that lay the foundation for any subsequent computational processes including recognition. Exemplified for the United States Geological Survey topographic map and the Sanborn fire insurance map archives, we demonstrate how such preliminary analyses can be systematically conducted using traditional analytical and cartographic techniques, as well as visual-analytical data mining tools originating from machine learning and data science.

ActionMap: A web-based software that automates loci assignments to framework maps.

Science.gov (United States)

Albini, Guillaume; Falque, Matthieu; Joets, Johann

2003-07-01

Genetic linkage computation may be a repetitive and time consuming task, especially when numerous loci are assigned to a framework map. We thus developed ActionMap, a web-based software that automates genetic mapping on a fixed framework map without adding the new markers to the map. Using this tool, hundreds of loci may be automatically assigned to the framework in a single process. ActionMap was initially developed to map numerous ESTs with a small plant mapping population and is limited to inbred lines and backcrosses. ActionMap is highly configurable and consists of Perl and PHP scripts that automate command steps for the MapMaker program. A set of web forms were designed for data import and mapping settings. Results of automatic mapping can be displayed as tables or drawings of maps and may be exported. The user may create personal access-restricted projects to store raw data, settings and mapping results. All data may be edited, updated or deleted. ActionMap may be used either online or downloaded for free (http://moulon.inra.fr/~bioinfo/).

Mapping with Drupal

CERN Document Server

Palazzolo, Alan

2011-01-01

Build beautiful interactive maps on your Drupal website, and tell engaging visual stories with your data. This concise guide shows you how to create custom geographical maps from top to bottom, using Drupal 7 tools and out-of-the-box modules. You'll learn how mapping works in Drupal, with examples on how to use intuitive interfaces to map local events, businesses, groups, and other custom data. Although building maps with Drupal can be tricky, this book helps you navigate the system's complexities for creating sophisticated maps that match your site design. Get the knowledge and tools you ne

High Potential Source for Biomass Degradation Enzyme Discovery and Environmental Aspects Revealed through Metagenomics of Indian Buffalo Rumen

Directory of Open Access Journals (Sweden)

K. M. Singh

2014-01-01

Full Text Available The complex microbiomes of the rumen functions as an effective system for plant cell wall degradation, and biomass utilization provide genetic resource for degrading microbial enzymes that could be used in the production of biofuel. Therefore the buffalo rumen microbiota was surveyed using shot gun sequencing. This metagenomic sequencing generated 3.9 GB of sequences and data were assembled into 137270 contiguous sequences (contigs. We identified potential 2614 contigs encoding biomass degrading enzymes including glycoside hydrolases (GH: 1943 contigs, carbohydrate binding module (CBM: 23 contigs, glycosyl transferase (GT: 373 contigs, carbohydrate esterases (CE: 259 contigs, and polysaccharide lyases (PE: 16 contigs. The hierarchical clustering of buffalo metagenomes demonstrated the similarities and dissimilarity in microbial community structures and functional capacity. This demonstrates that buffalo rumen microbiome was considerably enriched in functional genes involved in polysaccharide degradation with great prospects to obtain new molecules that may be applied in the biofuel industry.

A Novel Yeast Genomics Method for Identifying New Breast Cancer Susceptibility Genes

National Research Council Canada - National Science Library

Brown, J. M; Brown, James A

2007-01-01

...) a hallmark of most breast cancers when deleted. Using a collection of yeast strains carrying the deletion of a unique open reading frame, we have transfected a yeast artificial chromosome (YAC...

A comparative map viewer integrating genetic maps for Brassica and Arabidopsis

Directory of Open Access Journals (Sweden)

Erwin Timothy A

2007-07-01

Full Text Available Abstract Background Molecular genetic maps provide a means to link heritable traits with underlying genome sequence variation. Several genetic maps have been constructed for Brassica species, yet to date, there has been no simple means to compare this information or to associate mapped traits with the genome sequence of the related model plant, Arabidopsis. Description We have developed a comparative genetic map database for the viewing, comparison and analysis of Brassica and Arabidopsis genetic, physical and trait map information. This web-based tool allows users to view and compare genetic and physical maps, search for traits and markers, and compare genetic linkage groups within and between the amphidiploid and diploid Brassica genomes. The inclusion of Arabidopsis data enables comparison between Brassica maps that share no common markers. Analysis of conserved syntenic blocks between Arabidopsis and collated Brassica genetic maps validates the application of this system. This tool is freely available over the internet on http://bioinformatics.pbcbasc.latrobe.edu.au/cmap. Conclusion This database enables users to interrogate the relationship between Brassica genetic maps and the sequenced genome of A. thaliana, permitting the comparison of genetic linkage groups and mapped traits and the rapid identification of candidate genes.

Mapping social values of ecosystem services: What is behind the map?

Directory of Open Access Journals (Sweden)

Laura Nahuelhual

2016-09-01

Full Text Available A growing interest in mapping the social value of ecosystem services (ES is not yet methodologically aligned with what is actually being mapped. We critically examine aspects of the social value mapping process that might influence map outcomes and limit their practical use in decision making. We rely on an empirical case of participatory mapping, for a single ES (recreation opportunities, which involves diverse stakeholders such as planners, researchers, and community representatives. Value elicitation relied on an individual open-ended interview and a mapping exercise. Interpretation of the narratives and GIS calculations of proximity, centrality, and dispersion helped in exploring the factors driving participants' answers. Narratives reveal diverse value types. Whereas planners highlighted utilitarian and aesthetic values, the answers from researchers revealed naturalistic values as well. In turn community representatives acknowledged symbolic values. When remitted to the map, these values were constrained to statements toward a much narrower set of features of the physical (e.g., volcanoes and built landscape (e.g., roads. The results suggest that mapping, as an instrumental approach toward social valuation, may capture only a subset of relevant assigned values. This outcome is the interplay between participants' characteristics, including their acquaintance with the territory and their ability with maps, and the mapping procedure itself, including the proxies used to represent the ES and the value typology chosen, the elicitation question, the cartographic features displayed on the base map, and the spatial scale.

Dicty_cDB: Contig-U05079-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ideum chromosome 2 map 4559693... 30 1.6 8 ( FG289956 ) 1108793312383 New World Screwworm Egg 9261 ESTs C...... 32 1.7 3 ( FG282923 ) 1108383360957 New World Screwworm Egg 9261 ESTs C... 32 1....... 36 1.7 7 ( FG290085 ) 1108793314272 New World Screwworm Egg 9261 ESTs C... 32...osum chromosome 5 clone RH044A21, **... 40 1.7 6 ( FG288205 ) 1108793264454 New World Screwworm Egg 9261 EST...00 com... 46 1.8 1 ( FG291788 ) 1108793372449 New World Screwworm Egg 9261 ESTs C... 32 1.8 3 ( FG295040 ) 1108770722162 New World

Dicty_cDB: Contig-U01494-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ... 38 3.9 3 ( EK502865 ) 1095505947941 Global-Ocean-Sampling_GS-32-01-01-1... 32 3.9 3 ( AP001687 ) Homo sapie...... 36 0.81 FJ006933_17( FJ006933 |pid:none) Brachyspira intermedia strain HB6.....1 ) ENTLN83TF Entamoeba histolytica Sheared DNA Entam... 38 0.024 3 ( AC114258 ) Dictyostelium discoideum chromosome 2 map compl...em... 52 0.026 1 ( ER450904 ) 1092963849313 Global-Ocean-Sampli...ng_GS-35-01-01-1... 52 0.026 1 ( EJ507915 ) 1095407013410 Global-Ocean-Sampling_GS-28-01-01-1... 52 0.026

Dicty_cDB: Contig-U15582-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ) EST1120673 Aquilegia cDNA library Aquilegia formo... 36 0.36 3 ( AC115612 ) Dictyostelium discoideum chrom... cDNA clone ... 46 4.1 1 ( BX858993 ) AGENAE Rainbow trout normalized testis library (t... 46 4.1 1 ( BF0889...discoideum chromosome 2 map 2567470... 40 0.11 12 ( AL844509 ) Plasmodium falciparum chromosome 13. 38 0.15 17 ( EU016597 ) Unculture...EST1196545 Aquilegia cDNA library Aquilegia formo... 36 0.28 3 ( DT766291 ) EST1200140 Aquilegia cDNA libr...ary Aquilegia formo... 36 0.29 3 ( DT729293 ) EST1163143 Aquilegia cDNA library Aqu

An experimental study on the low-dose radiosensitivity of tumor cell lines

International Nuclear Information System (INIS)

Kim, Min Sook; Koh, Kwang Joon

1994-01-01

The purpose of this study was to aid in the radiation therapy of head and neck cancer patients. For this study, radiation survival curves were generated for B16, MG-63 and YAC-1 cell lines using semiautomated MTT assay and Dye Exclusion Assay. Irradiation of 2, 4, 6, 8, 10 Gy were delivered at room temperature at a dose rate of 210.2 cGy/min using 60 COγ-ray irradiator ALDORADO 8. The viable cells were determined for each radiation dose and compared to control values. The obtained results were as follows: 1. The was significantly different absorbance at 10 Gy on B16 cell line in MTT assay (P<0.05). 2. There was significantly different absorbance at 4, 6, 8, 10 Gy on MG-63 cell line in MTT assay (P<0.05). 3. YAC-1 cell line was more sensitive than B16 or MG-63 cell line to all doses of radiation (P<0.05). 4. There was significantly different absorbance among all tumor cell lines except between B16 and MG-63 cell line at 2 Gy in MTT assay (P<0.05). 5. Good correlation was obtained between MTT assay and DEA (P<0.05). The efficient of correlation of B16, MG-63 and YAC-1 cell line was 0.845-0.824 and 0.906, respectively.

Enhanced lysis of herpes simplex virus type 1-infected mouse cell lines by NC and NK effectors

Energy Technology Data Exchange (ETDEWEB)

Colmenares, C.; Lopez, C.

1986-05-01

Spontaneously cytotoxic murine lymphocytes lysed certain cell types infected by herpes simplex virus type 1 (HSV-1) better than uninfected cells. Although HSV-1 adsorbed to the surface of all the target cells, those in which the virus replicated more efficiently were lysed to a greater extent. As targets, the authors used cell lines that, when uninfected, were spontaneously lysed by NK cells (YAC-1) or by NC cells (WEHI-164). They also used a fibroblastoid cell line (M50) and a monocytic tumor line (PU51R), which were not spontaneously killed. NK cells lysed HSV-1-infected YAC cells better than uninfected cells, and an NC-like activity selectively lysed HSV-1-infected WEHI cells. These findings were consistent with the results of experiments performed to define the role of interferon in induction of virus-augmented cytolysis. Increased lysis of YAC-HSV and PU51R-HSV was entirely due to interferon activation and was completely abolished by performing the /sup 51/Cr-release assay in the presence of anti-interferon serum. The data show that HSV-1 infection of NK/NC targets induces increased cytotoxity, but the effector cell responsible for lysis is determined by the uninfected target, or by an interaction between the virus and target cell, rather than by a viral determinant alone.

Dicty_cDB: [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR

Dicty_cDB: SHE365 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ

Lunar Map Catalog

Data.gov (United States)

National Aeronautics and Space Administration — The Lunar Map Catalog includes various maps of the moon's surface, including Apollo landing sites; earthside, farside, and polar charts; photography index maps; zone...

MapFactory - Towards a mapping design pattern for big geospatial data

Science.gov (United States)

Rautenbach, Victoria; Coetzee, Serena

2018-05-01

With big geospatial data emerging, cartographers and geographic information scientists have to find new ways of dealing with the volume, variety, velocity, and veracity (4Vs) of the data. This requires the development of tools that allow processing, filtering, analysing, and visualising of big data through multidisciplinary collaboration. In this paper, we present the MapFactory design pattern that will be used for the creation of different maps according to the (input) design specification for big geospatial data. The design specification is based on elements from ISO19115-1:2014 Geographic information - Metadata - Part 1: Fundamentals that would guide the design and development of the map or set of maps to be produced. The results of the exploratory research suggest that the MapFactory design pattern will help with software reuse and communication. The MapFactory design pattern will aid software developers to build the tools that are required to automate map making with big geospatial data. The resulting maps would assist cartographers and others to make sense of big geospatial data.

GenMapDB: a database of mapped human BAC clones

OpenAIRE

Morley, Michael; Arcaro, Melissa; Burdick, Joshua; Yonescu, Raluca; Reid, Thomas; Kirsch, Ilan R.; Cheung, Vivian G.

2001-01-01

GenMapDB (http://genomics.med.upenn.edu/genmapdb) is a repository of human bacterial artificial chromosome (BAC) clones mapped by our laboratory to sequence-tagged site markers. Currently, GenMapDB contains over 3000 mapped clones that span 19 chromosomes, chromosomes 2, 4, 5, 9–22, X and Y. This database provides positional information about human BAC clones from the RPCI-11 human male BAC library. It also contains restriction fragment analysis data and end sequen...

Mapping the Heart

Science.gov (United States)

Hulse, Grace

2012-01-01

In this article, the author describes how her fourth graders made ceramic heart maps. The impetus for this project came from reading "My Map Book" by Sara Fanelli. This book is a collection of quirky, hand-drawn and collaged maps that diagram a child's world. There are maps of her stomach, her day, her family, and her heart, among others. The…

7. Annex II: Maps

OpenAIRE

Aeberli, Annina

2012-01-01

Map 1: States of South Sudan UN OCHA (2012) Republic of South Sudan – States, as of 15 July 2012, Reliefweb http://reliefweb.int/map/south-sudan-republic/republic-south-sudan-states-15-july-2012-reference-map, accessed 31 July 2012. Map 2: Counties of South Sudan UN OCHA (2012) Republic of South Sudan – Counties, as of 16 July 2012, Reliefweb http://reliefweb.int/map/south-sudan-republic/republic-south-sudan-counties-16-july-2012-reference-map, accessed 31 July 2012. Map 3: Eastern Equato...

Fluorescence in situ hybridization evaluation of chromosome deletion patterns in prostate cancer.

Science.gov (United States)

Huang, S F; Xiao, S; Renshaw, A A; Loughlin, K R; Hudson, T J; Fletcher, J A

1996-11-01

Various nonrandom chromosomal aberrations have been identified in prostate carcinoma. These aberrations include deletions of several chromosome regions, particularly the chromosome 8 short arm. Large-scale numerical aberrations, reflected in aberrant DNA ploidy, are also found in a minority of cases. However, it is unclear whether prostate carcinomas contain aberrations of certain chromosome regions that are deleted frequently in other common types of cancer. In this study, we performed dual-color fluorescence in situ hybridization on intact nuclei from touch preparations of 16 prostate cancers. Chromosome copy number was determined using pericentromeric probes, whereas potential chromosome arm deletions were evaluated using yeast artificial chromosome (YAC) and P1 probes. Two YAC probes targeted chromosome 8 short arm regions known to be deleted frequently in prostate cancer. Other YACs and P1s were for chromosome regions, including 1p22, 3p14, 6q21, 9p21, and 22q12, that are deletion targets in a variety of cancers although not extensively studied in prostate cancer. Hybridization efficiencies and signal intensities were excellent for both repeat sequence (alpha-satellite) and single, copy (YAC and P1) fluorescence in situ hybridization probes. Of 16 prostate cancers, 11 had clonal aberrations of 1 or more of the 13 chromosome regions evaluated, and 10 cases (62.5%) had 8p deletions, including 4 cases with 8p deletion in virtually all cells and aneuploidy in only a subset of those deleted cells. Deletions at 3p14, 6q21, and 22q12 were identified in 2, 1, and 1 case, respectively, and each of those cases had a similarly sized cell population with 8p deletion. These studies confirm 8p deletion in the majority of prostate carcinomas. 8p deletions appear to be early events in prostate tumorigenesis, often antedating aneuploidy. Fluorescence in situ hybridization strategies incorporating pericentromeric and single-copy regional chromosome probes offer a powerful and

Open Land-Use Map: A Regional Land-Use Mapping Strategy for Incorporating OpenStreetMap with Earth Observations

Science.gov (United States)

Yang, D.; Fu, C. S.; Binford, M. W.

2017-12-01

The southeastern United States has high landscape heterogeneity, withheavily managed forestlands, highly developed agriculture lands, and multiple metropolitan areas. Human activities are transforming and altering land patterns and structures in both negative and positive manners. A land-use map for at the greater scale is a heavy computation task but is critical to most landowners, researchers, and decision makers, enabling them to make informed decisions for varying objectives. There are two major difficulties in generating the classification maps at the regional scale: the necessity of large training point sets and the expensive computation cost-in terms of both money and time-in classifier modeling. Volunteered Geographic Information (VGI) opens a new era in mapping and visualizing our world, where the platform is open for collecting valuable georeferenced information by volunteer citizens, and the data is freely available to the public. As one of the most well-known VGI initiatives, OpenStreetMap (OSM) contributes not only road network distribution, but also the potential for using this data to justify land cover and land use classifications. Google Earth Engine (GEE) is a platform designed for cloud-based mapping with a robust and fast computing power. Most large scale and national mapping approaches confuse "land cover" and "land-use", or build up the land-use database based on modeled land cover datasets. Unlike most other large-scale approaches, we distinguish and differentiate land-use from land cover. By focusing our prime objective of mapping land-use and management practices, a robust regional land-use mapping approach is developed by incorporating the OpenstreepMap dataset into Earth observation remote sensing imageries instead of the often-used land cover base maps.

Comprehensive transcriptome assembly of Chickpea (Cicer arietinum L. using sanger and next generation sequencing platforms: development and applications.

Directory of Open Access Journals (Sweden)

Himabindu Kudapa

Full Text Available A comprehensive transcriptome assembly of chickpea has been developed using 134.95 million Illumina single-end reads, 7.12 million single-end FLX/454 reads and 139,214 Sanger expressed sequence tags (ESTs from >17 genotypes. This hybrid transcriptome assembly, referred to as Cicer arietinumTranscriptome Assembly version 2 (CaTA v2, available at http://data.comparative-legumes.org/transcriptomes/cicar/lista_cicar-201201, comprising 46,369 transcript assembly contigs (TACs has an N50 length of 1,726 bp and a maximum contig size of 15,644 bp. Putative functions were determined for 32,869 (70.8% of the TACs and gene ontology assignments were determined for 21,471 (46.3%. The new transcriptome assembly was compared with the previously available chickpea transcriptome assemblies as well as to the chickpea genome. Comparative analysis of CaTA v2 against transcriptomes of three legumes - Medicago, soybean and common bean, resulted in 27,771 TACs common to all three legumes indicating strong conservation of genes across legumes. CaTA v2 was also used for identification of simple sequence repeats (SSRs and intron spanning regions (ISRs for developing molecular markers. ISRs were identified by aligning TACs to the Medicago genome, and their putative mapping positions at chromosomal level were identified using transcript map of chickpea. Primer pairs were designed for 4,990 ISRs, each representing a single contig for which predicted positions are inferred and distributed across eight linkage groups. A subset of randomly selected ISRs representing all eight chickpea linkage groups were validated on five chickpea genotypes and showed 20% polymorphism with average polymorphic information content (PIC of 0.27. In summary, the hybrid transcriptome assembly developed and novel markers identified can be used for a variety of applications such as gene discovery, marker-trait association, diversity analysis etc., to advance genetics research and breeding

Dicty_cDB: SSE149 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

Dicty_cDB: VFB330 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND

DistMap: a toolkit for distributed short read mapping on a Hadoop cluster.

Directory of Open Access Journals (Sweden)

Ram Vinay Pandey

Full Text Available With the rapid and steady increase of next generation sequencing data output, the mapping of short reads has become a major data analysis bottleneck. On a single computer, it can take several days to map the vast quantity of reads produced from a single Illumina HiSeq lane. In an attempt to ameliorate this bottleneck we present a new tool, DistMap - a modular, scalable and integrated workflow to map reads in the Hadoop distributed computing framework. DistMap is easy to use, currently supports nine different short read mapping tools and can be run on all Unix-based operating systems. It accepts reads in FASTQ format as input and provides mapped reads in a SAM/BAM format. DistMap supports both paired-end and single-end reads thereby allowing the mapping of read data produced by different sequencing platforms. DistMap is available from http://code.google.com/p/distmap/

Quantitative RNA-Seq analysis in non-model species: assessing transcriptome assemblies as a scaffold and the utility of evolutionary divergent genomic reference species

Directory of Open Access Journals (Sweden)

Hornett Emily A

2012-08-01

Full Text Available Abstract Background How well does RNA-Seq data perform for quantitative whole gene expression analysis in the absence of a genome? This is one unanswered question facing the rapidly growing number of researchers studying non-model species. Using Homo sapiens data and resources, we compared the direct mapping of sequencing reads to predicted genes from the genome with mapping to de novo transcriptomes assembled from RNA-Seq data. Gene coverage and expression analysis was further investigated in the non-model context by using increasingly divergent genomic reference species to group assembled contigs by unique genes. Results Eight transcriptome sets, composed of varying amounts of Illumina and 454 data, were assembled and assessed. Hybrid 454/Illumina assemblies had the highest transcriptome and individual gene coverage. Quantitative whole gene expression levels were highly similar between using a de novo hybrid assembly and the predicted genes as a scaffold, although mapping to the de novo transcriptome assembly provided data on fewer genes. Using non-target species as reference scaffolds does result in some loss of sequence and expression data, and bias and error increase with evolutionary distance. However, within a 100 million year window these effect sizes are relatively small. Conclusions Predicted gene sets from sequenced genomes of related species can provide a powerful method for grouping RNA-Seq reads and annotating contigs. Gene expression results can be produced that are similar to results obtained using gene models derived from a high quality genome, though biased towards conserved genes. Our results demonstrate the power and limitations of conducting RNA-Seq in non-model species.

Baby Brain Map

Science.gov (United States)

... a Member Home Resources & Services Professional Resource Baby Brain Map Mar 17, 2016 The Brain Map was adapted in 2006 by ZERO TO ... supports Adobe Flash Player. To view the Baby Brain Map, please visit this page on a browser ...

Applicability of vulnerability maps

International Nuclear Information System (INIS)

Andersen, L.J.; Gosk, E.

1989-01-01

A number of aspects to vulnerability maps are discussed: the vulnerability concept, mapping purposes, possible users, and applicability of vulnerability maps. Problems associated with general-type vulnerability mapping, including large-scale maps, universal pollutant, and universal pollution scenario are also discussed. An alternative approach to vulnerability assessment - specific vulnerability mapping for limited areas, specific pollutant, and predefined pollution scenario - is suggested. A simplification of the vulnerability concept is proposed in order to make vulnerability mapping more objective and by this means more comparable. An extension of the vulnerability concept to the rest of the hydrogeological cycle (lakes, rivers, and the sea) is proposed. Some recommendations regarding future activities are given

Complex motion of elevators in piecewise map model combined with circle map

Science.gov (United States)

Nagatani, Takashi

2013-11-01

We study the dynamic behavior in the elevator traffic controlled by capacity when the inflow rate of passengers into elevators varies periodically with time. The dynamics of elevators is described by the piecewise map model combined with the circle map. The motion of the elevators depends on the inflow rate, its period, and the number of elevators. The motion in the piecewise map model combined with the circle map shows a complex behavior different from the motion in the piecewise map model.

Topographical Hill Shading Map Production Based Tianditu (map World)

Science.gov (United States)

Wang, C.; Zha, Z.; Tang, D.; Yang, J.

2018-04-01

TIANDITU (Map World) is the public version of National Platform for Common Geospatial Information Service, and the terrain service is an important channel for users on the platform. With the development of TIANDITU, topographical hill shading map production for providing and updating global terrain map on line becomes necessary for the characters of strong intuition, three-dimensional sense and aesthetic effect. As such, the terrain service of TIANDITU focuses on displaying the different scales of topographical data globally. And this paper mainly aims to research the method of topographical hill shading map production globally using DEM (Digital Elevation Model) data between the displaying scales about 1 : 140,000,000 to 1 : 4,000,000, corresponded the display level from 2 to 7 on TIANDITU website.

Mapping in the cloud

CERN Document Server

Peterson, Michael P

2014-01-01

This engaging text provides a solid introduction to mapmaking in the era of cloud computing. It takes students through both the concepts and technology of modern cartography, geographic information systems (GIS), and Web-based mapping. Conceptual chapters delve into the meaning of maps and how they are developed, covering such topics as map layers, GIS tools, mobile mapping, and map animation. Methods chapters take a learn-by-doing approach to help students master application programming interfaces and build other technical skills for creating maps and making them available on the Internet. Th

Dicty_cDB: Contig-U15683-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ame: Full=Ubiquitin carboxyl-terminal hydrolase 4; ... 41 0.14 BC143354_1( BC143354 |pid:none) Homo sapiens ...pe... 41 0.14 ( Q92353 ) RecName: Full=Ubiquitin carboxyl-terminal hydrolase 6; ... 41 0.14 AC140026_8( AC140026 |pid:none) Med...e-07 1 ( AC116979 ) Dictyostelium discoideum chromosome 2 map 6445720... 54 1e-06 2 ( ER292388 ) 1092343612868 Global-Ocean-Sampli...ing embryo clone:m... 50 4e-05 2 ( EJ238241 ) 1095323012610 Global-Ocean-Sampling_GS-27-01-01-1... 40 3e-04 ...siae mRNA, clone: S03052-24_O... 48 0.35 2 ( EK189498 ) 1095460013501 Global-Ocean-Sampling_GS-31-01-01-1...

Dicty_cDB: Contig-U04013-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available pid:none) Flavobacterium psychrophilum JIP... 98 3e-19 EU678894_1( EU678894 |pid:none) Bacillus intermedius ...46 3e-04 2 ( EH672780 ) CCIL10412.b1_G11.ab1 CCI(LMS) chicory Cichorium i... 46 3e-04 2 ( EJ368820 ) 1092963715450 Global-Ocean-Sampl...41 |pid:none) Sulfolobus solfataricus P2, com... 89 2e-16 AH1770( AH1770 ) conserved hypothetical protein lin2710 [imported...AY653733 ) Acanthamoeba polyphaga mimivirus, complete genome. 62 3e-05 1 ( EH678404 ) CCIL3410.b1_D14.ab1 CC...ngs S... 44 6.8 1 >( AC116963 ) Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, compl

Dicty_cDB: Contig-U01237-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available EK998049 ) 1095521194243 Global-Ocean-Sampling_GS-33-01-01-1... 56 0.001 2 ( EH731489 ) CNMM4467.b1_E14.ab1 CNM(LMS) spotted...064606 ) 1095458025043 Global-Ocean-Sampling_GS-26-01-01-1... 56 0.003 1 ( ED814422 ) ML__Ba0092N03r ML__Ba Mim..... 161 5e-38 ( O14595 ) RecName: Full=Carboxy-terminal domain RNA polymerase II... 161 5e-38 ( Q09695 ) RecN...447 |pid:none) Homo sapiens CTD (carboxy-terminal... 56 2e-06 AM920428_969( AM920428 |pid:none) Penicillium ...um discoideum chromosome 2 map 3879572... 42 2e-04 9 ( FM992689 ) Candida dubliniensis CD36 chromosome 2, compl

Single-edition quadrangle maps

Science.gov (United States)

,

1998-01-01

In August 1993, the U.S. Geological Survey's (USGS) National Mapping Division and the U.S. Department of Agriculture's Forest Service signed an Interagency Agreement to begin a single-edition joint mapping program. This agreement established the coordination for producing and maintaining single-edition primary series topographic maps for quadrangles containing National Forest System lands. The joint mapping program saves money by eliminating duplication of effort by the agencies and results in a more frequent revision cycle for quadrangles containing national forests. Maps are revised on the basis of jointly developed standards and contain normal features mapped by the USGS, as well as additional features required for efficient management of National Forest System lands. Single-edition maps look slightly different but meet the content, accuracy, and quality criteria of other USGS products. The Forest Service is responsible for the land management of more than 191 million acres of land throughout the continental United States, Alaska, and Puerto Rico, including 155 national forests and 20 national grasslands. These areas make up the National Forest System lands and comprise more than 10,600 of the 56,000 primary series 7.5-minute quadrangle maps (15-minute in Alaska) covering the United States. The Forest Service has assumed responsibility for maintaining these maps, and the USGS remains responsible for printing and distributing them. Before the agreement, both agencies published similar maps of the same areas. The maps were used for different purposes, but had comparable types of features that were revised at different times. Now, the two products have been combined into one so that the revision cycle is stabilized and only one agency revises the maps, thus increasing the number of current maps available for National Forest System lands. This agreement has improved service to the public by requiring that the agencies share the same maps and that the maps meet a

Custom OpenStreetMap Rendering – OpenTrackMap Experience

Directory of Open Access Journals (Sweden)

Radek Bartoň

2010-02-01

Full Text Available After 5 years of its existence, the OpenSteetMap [1] is becoming to be an important and valuable source of a geographic data for all people on the world. Although initially targeted to provide a map of cities for routing services, it can be exploited to other and often unexpected purposes. Such an utilization is an effort to map a network of hiking tracks of the Czech Tourist Club [2].  To support and apply this endeavour, the OpenTrackMap [3] project was started. Its aim is to primarily provide a customized rendering style for Mapnik renderer which emphasizes map features important to tourists and displays a layer with hiking tracks. This article presents obstacles which such project must face and it can be used as a tutorial for other projects of similar type.

cudaMap: a GPU accelerated program for gene expression connectivity mapping.

Science.gov (United States)

McArt, Darragh G; Bankhead, Peter; Dunne, Philip D; Salto-Tellez, Manuel; Hamilton, Peter; Zhang, Shu-Dong

2013-10-11

Modern cancer research often involves large datasets and the use of sophisticated statistical techniques. Together these add a heavy computational load to the analysis, which is often coupled with issues surrounding data accessibility. Connectivity mapping is an advanced bioinformatic and computational technique dedicated to therapeutics discovery and drug re-purposing around differential gene expression analysis. On a normal desktop PC, it is common for the connectivity mapping task with a single gene signature to take > 2h to complete using sscMap, a popular Java application that runs on standard CPUs (Central Processing Units). Here, we describe new software, cudaMap, which has been implemented using CUDA C/C++ to harness the computational power of NVIDIA GPUs (Graphics Processing Units) to greatly reduce processing times for connectivity mapping. cudaMap can identify candidate therapeutics from the same signature in just over thirty seconds when using an NVIDIA Tesla C2050 GPU. Results from the analysis of multiple gene signatures, which would previously have taken several days, can now be obtained in as little as 10 minutes, greatly facilitating candidate therapeutics discovery with high throughput. We are able to demonstrate dramatic speed differentials between GPU assisted performance and CPU executions as the computational load increases for high accuracy evaluation of statistical significance. Emerging 'omics' technologies are constantly increasing the volume of data and information to be processed in all areas of biomedical research. Embracing the multicore functionality of GPUs represents a major avenue of local accelerated computing. cudaMap will make a strong contribution in the discovery of candidate therapeutics by enabling speedy execution of heavy duty connectivity mapping tasks, which are increasingly required in modern cancer research. cudaMap is open source and can be freely downloaded from http://purl.oclc.org/NET/cudaMap.

Web mapping: tools and solutions for creating interactive maps of forestry interest

Directory of Open Access Journals (Sweden)

Notarangelo G

2011-12-01

Full Text Available The spread of geobrowsers as tools for displaying geographically referenced information provides insights and opportunities to those who, not being specialists in Geographic Information Systems, want to take advantage from exploration and communication power offered by these software. Through the use of web services such as Google Maps and the use of suitable markup languages, one can create interactive maps starting from highly heterogeneous data and information. These interactive maps can also be easily distributed and shared with Internet users, because they do not need to use proprietary software nor special skills but only a web browser. Unlike the maps created with GIS, whose output usually is a static image, the interactive maps retain all their features to users advantage. This paper describes a web application that, using the Keyhole Markup Language and the free service of Google Maps, produces choropleth maps relating to some forest indicators estimated by the last Italian National Forest Inventory. The creation of a map is done through a simple and intuitive interface. The maps created by users can be downloaded as KML file and can be viewed or modified via the freeware application Google Earth or free and open source GIS software like Quantum GIS. The web application is free and available at www.ricercaforestale.it.

MAPS of Cancer

Science.gov (United States)

Gray, Lincoln

1998-01-01

Our goal was to produce an interactive visualization from a mathematical model that successfully predicts metastases from head and neck cancer. We met this goal early in the project. The visualization is available for the public to view. Our work appears to fill a need for more information about this deadly disease. The idea of this project was to make an easily interpretable visualization based on what we call "functional maps" of disease. A functional map is a graphic summary of medical data, where distances between parts of the body are determined by the probability of disease, not by anatomical distances. Functional maps often beat little resemblance to anatomical maps, but they can be used to predict the spread of disease. The idea of modeling the spread of disease in an abstract multidimensional space is difficult for many people. Our goal was to make the important predictions easy to see. NASA must face this problem frequently: how to help laypersons and professionals see important trends in abstract, complex data. We took advantage of concepts perfected in NASA's graphics libraries. As an analogy, consider a functional map of early America. Suppose we choose travel times, rather than miles, as our measures of inter-city distances. For Abraham Lincoln, travel times would have been the more meaningful measure of separation between cities. In such a map New Orleans would be close to Memphis because of the Mississippi River. St. Louis would be close to Portland because of the Oregon Trail. Oklahoma City would be far from Little Rock because of the Cheyenne. Such a map would look puzzling to those of us who have always seen physical maps, but the functional map would be more useful in predicting the probabilities of inter-site transit. Continuing the analogy, we could predict the spread of social diseases such as gambling along the rivers and cattle rustling along the trails. We could simply print the functional map of America, but it would be more interesting

VEGETATION MAPPING IN WETLANDS

Directory of Open Access Journals (Sweden)

F. PEDROTTI

2004-01-01

Full Text Available The current work examines the main aspects of wetland vegetation mapping, which can be summarized as analysis of the ecological-vegetational (ecotone gradients; vegetation complexes; relationships between vegetation distribution and geomorphology; vegetation of the hydrographic basin lo which the wetland in question belongs; vegetation monitoring with help of four vegetation maps: phytosociological map of the real and potential vegetation, map of vegetation dynamical tendencies, map of vegetation series.

Branched polynomial covering maps

DEFF Research Database (Denmark)

Hansen, Vagn Lundsgaard

2002-01-01

A Weierstrass polynomial with multiple roots in certain points leads to a branched covering map. With this as the guiding example, we formally define and study the notion of a branched polynomial covering map. We shall prove that many finite covering maps are polynomial outside a discrete branch ...... set. Particular studies are made of branched polynomial covering maps arising from Riemann surfaces and from knots in the 3-sphere. (C) 2001 Elsevier Science B.V. All rights reserved.......A Weierstrass polynomial with multiple roots in certain points leads to a branched covering map. With this as the guiding example, we formally define and study the notion of a branched polynomial covering map. We shall prove that many finite covering maps are polynomial outside a discrete branch...

Generating a Danish raster-based topsoil property map combining choropleth maps and point information

DEFF Research Database (Denmark)

Greve, Mogens H.; Greve, Mette B.; Bøcher, Peder K.

2007-01-01

The Danish environmental authorities have posed a soil type dependent restriction on the application of nitrogen. The official Danish soil map is a choropleth topsoil map classifying the agricultural land into eight classes. The use of the soil map has shown that the maps have serious...... classification flaws. The objective of this work is to compile a continuous national topsoil texture map to replace the old topsoil map. Approximately 45,000 point samples were interpolated using ordinary kriging in 250 m x 250 m cells. To reduce variability and to obtain more homogeneous strata, the samples...... were stratified according to landscape types. Five new soil texture maps were compiled; one for each of the five textural classes, and a new categorical soil type map was compiled using the old classification system. Both the old choropleth map and the new continuous soil maps were compared to 354...

Mapping Urban Social Divisions

Directory of Open Access Journals (Sweden)

Susan Ball

2010-05-01

Full Text Available Against the background of increased levels of interest in space and images beyond the field of geography, this article (re- introduces earlier work on the semiotics of maps undertaken by geographers in the 1960s. The data limitations, purpose and cultural context in which a user interprets a map's codes and conventions are highlighted in this work, which remains relevant to the interpretation of maps—new and old—forty years later. By means of drawing on geography's contribution to the semiotics of maps, the article goes on to examine the concept of urban social divisions as represented in map images. Using a small number of map images, including two of the most widely known maps of urban social division in Europe and North America, the roles of context, data and purpose in the production and interpretation of maps are discussed. By presenting the examples chronologically the article shows that although advances in data collection and manipulation have allowed researchers to combine different social variables in maps of social division, and to interact with map images, work by geographers on the semiotics of maps is no less relevant today than when it was first proposed forty years ago. URN: urn:nbn:de:0114-fqs1002372

Dicty_cDB: SSB171 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

Multi-moment maps

DEFF Research Database (Denmark)

Swann, Andrew Francis; Madsen, Thomas Bruun

2012-01-01

We introduce a notion of moment map adapted to actions of Lie groups that preserve a closed three-form. We show existence of our multi-moment maps in many circumstances, including mild topological assumptions on the underlying manifold. Such maps are also shown to exist for all groups whose second...

Saturation of an intra-gene pool linkage map: towards a unified consensus linkage map for fine mapping and synteny analysis in common bean.

Science.gov (United States)

Galeano, Carlos H; Fernandez, Andrea C; Franco-Herrera, Natalia; Cichy, Karen A; McClean, Phillip E; Vanderleyden, Jos; Blair, Matthew W

2011-01-01

Map-based cloning and fine mapping to find genes of interest and marker assisted selection (MAS) requires good genetic maps with reproducible markers. In this study, we saturated the linkage map of the intra-gene pool population of common bean DOR364 × BAT477 (DB) by evaluating 2,706 molecular markers including SSR, SNP, and gene-based markers. On average the polymorphism rate was 7.7% due to the narrow genetic base between the parents. The DB linkage map consisted of 291 markers with a total map length of 1,788 cM. A consensus map was built using the core mapping populations derived from inter-gene pool crosses: DOR364 × G19833 (DG) and BAT93 × JALO EEP558 (BJ). The consensus map consisted of a total of 1,010 markers mapped, with a total map length of 2,041 cM across 11 linkage groups. On average, each linkage group on the consensus map contained 91 markers of which 83% were single copy markers. Finally, a synteny analysis was carried out using our highly saturated consensus maps compared with the soybean pseudo-chromosome assembly. A total of 772 marker sequences were compared with the soybean genome. A total of 44 syntenic blocks were identified. The linkage group Pv6 presented the most diverse pattern of synteny with seven syntenic blocks, and Pv9 showed the most consistent relations with soybean with just two syntenic blocks. Additionally, a co-linear analysis using common bean transcript map information against soybean coding sequences (CDS) revealed the relationship with 787 soybean genes. The common bean consensus map has allowed us to map a larger number of markers, to obtain a more complete coverage of the common bean genome. Our results, combined with synteny relationships provide tools to increase marker density in selected genomic regions to identify closely linked polymorphic markers for indirect selection, fine mapping or for positional cloning.

Cytogenetic mapping of a novel locus for type II Waardenburg syndrome.

Science.gov (United States)

Selicorni, Angelo; Guerneri, Silvana; Ratti, Antonia; Pizzuti, Antonio

2002-01-01

An Italian family in which Waardenburg syndrome type II (WS2) segregates together with a der(8) chromosome from a (4p;8p) balanced translocation was studied. Cytogenetic analysis by painting and subtelomeric probe hybridization positioned the chromosome 8 breakpoint at p22-pter. Fluorescence in situ hybridization analysis with yeast artificial chromosomes from a contig spanning the 8p21-pter region refined the breakpoint in an interval of less than 170 kb between markers WI-3823 and D8S1819. The only cloned gene for WS2 is that for microphtalmia (MITF) on chromosome 3p. In this family, MITF mutations were excluded by sequencing the whole coding region. The 8p23 region may represent a third locus for WS2 (WS2C).

The peculiar landscape of repetitive sequences in the olive (Olea europaea L.) genome.

Science.gov (United States)

Barghini, Elena; Natali, Lucia; Cossu, Rosa Maria; Giordani, Tommaso; Pindo, Massimo; Cattonaro, Federica; Scalabrin, Simone; Velasco, Riccardo; Morgante, Michele; Cavallini, Andrea

2014-04-01

Analyzing genome structure in different species allows to gain an insight into the evolution of plant genome size. Olive (Olea europaea L.) has a medium-sized haploid genome of 1.4 Gb, whose structure is largely uncharacterized, despite the growing importance of this tree as oil crop. Next-generation sequencing technologies and different computational procedures have been used to study the composition of the olive genome and its repetitive fraction. A total of 2.03 and 2.3 genome equivalents of Illumina and 454 reads from genomic DNA, respectively, were assembled following different procedures, which produced more than 200,000 differently redundant contigs, with mean length higher than 1,000 nt. Mapping Illumina reads onto the assembled sequences was used to estimate their redundancy. The genome data set was subdivided into highly and medium redundant and nonredundant contigs. By combining identification and mapping of repeated sequences, it was established that tandem repeats represent a very large portion of the olive genome (∼31% of the whole genome), consisting of six main families of different length, two of which were first discovered in these experiments. The other large redundant class in the olive genome is represented by transposable elements (especially long terminal repeat-retrotransposons). On the whole, the results of our analyses show the peculiar landscape of the olive genome, related to the massive amplification of tandem repeats, more than that reported for any other sequenced plant genome.

XenDB: Full length cDNA prediction and cross species mapping in Xenopus laevis

Directory of Open Access Journals (Sweden)

Giegerich Robert

2005-09-01

Full Text Available Abstract Background Research using the model system Xenopus laevis has provided critical insights into the mechanisms of early vertebrate development and cell biology. Large scale sequencing efforts have provided an increasingly important resource for researchers. To provide full advantage of the available sequence, we have analyzed 350,468 Xenopus laevis Expressed Sequence Tags (ESTs both to identify full length protein encoding sequences and to develop a unique database system to support comparative approaches between X. laevis and other model systems. Description Using a suffix array based clustering approach, we have identified 25,971 clusters and 40,877 singleton sequences. Generation of a consensus sequence for each cluster resulted in 31,353 tentative contig and 4,801 singleton sequences. Using both BLASTX and FASTY comparison to five model organisms and the NR protein database, more than 15,000 sequences are predicted to encode full length proteins and these have been matched to publicly available IMAGE clones when available. Each sequence has been compared to the KOG database and ~67% of the sequences have been assigned a putative functional category. Based on sequence homology to mouse and human, putative GO annotations have been determined. Conclusion The results of the analysis have been stored in a publicly available database XenDB http://bibiserv.techfak.uni-bielefeld.de/xendb/. A unique capability of the database is the ability to batch upload cross species queries to identify potential Xenopus homologues and their associated full length clones. Examples are provided including mapping of microarray results and application of 'in silico' analysis. The ability to quickly translate the results of various species into 'Xenopus-centric' information should greatly enhance comparative embryological approaches. Supplementary material can be found at http://bibiserv.techfak.uni-bielefeld.de/xendb/.

Stochasticity in the Josephson map

International Nuclear Information System (INIS)

Nomura, Y.; Ichikawa, Y.H.; Filippov, A.T.

1996-04-01

The Josephson map describes nonlinear dynamics of systems characterized by standard map with the uniform external bias superposed. The intricate structures of the phase space portrait of the Josephson map are examined on the basis of the tangent map associated with the Josephson map. Numerical observation of the stochastic diffusion in the Josephson map is examined in comparison with the renormalized diffusion coefficient calculated by the method of characteristic function. The global stochasticity of the Josephson map occurs at the values of far smaller stochastic parameter than the case of the standard map. (author)

IceMap250—Automatic 250 m Sea Ice Extent Mapping Using MODIS Data

Directory of Open Access Journals (Sweden)

Charles Gignac

2017-01-01

Full Text Available The sea ice cover in the North evolves at a rapid rate. To adequately monitor this evolution, tools with high temporal and spatial resolution are needed. This paper presents IceMap250, an automatic sea ice extent mapping algorithm using MODIS reflective/emissive bands. Hybrid cloud-masking using both the MOD35 mask and a visibility mask, combined with downscaling of Bands 3–7 to 250 m, are utilized to delineate sea ice extent using a decision tree approach. IceMap250 was tested on scenes from the freeze-up, stable cover, and melt seasons in the Hudson Bay complex, in Northeastern Canada. IceMap250 first product is a daily composite sea ice presence map at 250 m. Validation based on comparisons with photo-interpreted ground-truth show the ability of the algorithm to achieve high classification accuracy, with kappa values systematically over 90%. IceMap250 second product is a weekly clear sky map that provides a synthesis of 7 days of daily composite maps. This map, produced using a majority filter, makes the sea ice presence map even more accurate by filtering out the effects of isolated classification errors. The synthesis maps show spatial consistency through time when compared to passive microwave and national ice services maps.

Dicty_cDB: Contig-U09489-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 1.4 1 ( EL926599 ) NY4ThAmp1_4_D02.b1_A039 NY4 theronts: amplified l... 46 1.4 1 ( AM489368 ) Vitis vinifer...6819 |pid:none) Arabidopsis thaliana mRNA for ubiq... 51 3e-05 (Q84WU2) RecName: Full=Ubiquitin carboxyl-term...omosome 2 map 2567470... 38 0.024 9 ( EK127276 ) 1092990501278 Global-Ocean-Sampling_GS-31-01-01-1... 48 0.3...7... 34 7.5 6 ( EJ927426 ) 1093018788425 Global-Ocean-Sampling_GS-30-02-01-1... 36 9.1 2 ( AC014163 ) Drosop...6e-06 (Q9FPT1) RecName: Full=Ubiquitin carboxyl-terminal hydrolase 12;... 53 6e-0

The National Map: from geography to mapping and back again

Science.gov (United States)

Kelmelis, John A.; DeMulder, Mark L.; Ogrosky, Charles E.; Van Driel, J. Nicholas; Ryan, Barbara J.

2003-01-01

When the means of production for national base mapping were capital intensive, required large production facilities, and had ill-defined markets, Federal Government mapping agencies were the primary providers of the spatial data needed for economic development, environmental management, and national defense. With desktop geographic information systems now ubiquitous, source data available as a commodity from private industry, and the realization that many complex problems faced by society need far more and different kinds of spatial data for their solutions, national mapping organizations must realign their business strategies to meet growing demand and anticipate the needs of a rapidly changing geographic information environment. The National Map of the United States builds on a sound historic foundation of describing and monitoring the land surface and adds a focused effort to produce improved understanding, modeling, and prediction of land-surface change. These added dimensions bring to bear a broader spectrum of geographic science to address extant and emerging issues. Within the overarching construct of The National Map, the U.S. Geological Survey (USGS) is making a transition from data collector to guarantor of national data completeness; from producing paper maps to supporting an online, seamless, integrated database; and from simply describing the Nation’s landscape to linking these descriptions with increased scientific understanding. Implementing the full spectrum of geographic science addresses a myriad of public policy issues, including land and natural resource management, recreation, urban growth, human health, and emergency planning, response, and recovery. Neither these issues nor the science and technologies needed to deal with them are static. A robust research agenda is needed to understand these changes and realize The National Map vision. Initial successes have been achieved. These accomplishments demonstrate the utility of

Mapping the Wolf-Hirschhorn syndrome phenotype outside the currently accepted WHS critical region and defining a new critical region, WHSCR-2.

Science.gov (United States)

Zollino, Marcella; Lecce, Rosetta; Fischetto, Rita; Murdolo, Marina; Faravelli, Francesca; Selicorni, Angelo; Buttè, Cinzia; Memo, Luigi; Capovilla, Giuseppe; Neri, Giovanni

2003-03-01

In an attempt to define the distinctive Wolf-Hirschhorn syndrome (WHS) phenotype, and to map its specific clinical manifestations, a total of eight patients carrying a 4p16.3 microdeletion were analyzed for their clinical phenotype and their respective genotypes. The extent of each individual deletion was established by fluorescence in situ hybridization, with a cosmid contig spanning the genomic region from MSX1 (distal half of 4p16.1) to the subtelomeric locus D4S3359. The deletions were 1.9-3.5 Mb, and all were terminal. All the patients presented with a mild phenotype, in which major malformations were usually absent. It is worth noting that head circumference was normal for height in two patients (those with the smallest deletions [1.9 and 2.2 Mb]). The currently accepted WHS critical region (WHSCR) was fully preserved in the patient with the 1.9-Mb deletion, in spite of a typical WHS phenotype. The deletion in this patient spanned the chromosome region from D4S3327 (190 b4 cosmid clone included) to the telomere. From a clinical point of view, the distinctive WHS phenotype is defined by the presence of typical facial appearance, mental retardation, growth delay, congenital hypotonia, and seizures. These signs represent the minimal diagnostic criteria for WHS. This basic phenotype maps distal to the currently accepted WHSCR. Here, we propose a new critical region for WHS, and we refer to this region as "WHSCR-2." It falls within a 300-600-kb interval in 4p16.3, between the loci D4S3327 and D4S98-D4S168. Among the candidate genes already described for WHS, LETM1 (leucine zipper/EF-hand-containing transmembrane) is likely to be pathogenetically involved in seizures. On the basis of genotype-phenotype correlation analysis, dividing the WHS phenotype into two distinct clinical entities, a "classical" and a "mild" form, is recommended for the purpose of proper genetic counseling.

Mapping of wine industry

Directory of Open Access Journals (Sweden)

Віліна Пересадько

2016-10-01

Full Text Available Having reviewed a variety of approaches to understanding the essence of wine industry, having studied the modern ideas about the future of wine industry, having analyzed more than 50 maps from the Internet we have set the trends and special features of wine industry mapping in the world, such as: - the vast majority of maps displays the development of the industry at regional or national level, whereas there are practically no world maps; - wine-growing regions are represented on maps very unevenly; - all existing maps of the industry could be classified as analytical ascertaining inventory type; - the dominant ways of cartographic representation are area method and qualitative background method, sign method and collation maps are rarely used; - basically all the Internet maps have low quality as they are scanned images with poor resolution; - the special feature of maps published lately is lack of geographical basis (except for state borders and coastline. We created wine production and consumption world map «Wine Industry» in the scale of 1:60 000 000 with simple geographical basis (state names, state borders, major rivers, coastline. It was concluded that from the methodological point of view it is incorrect not to show geographical basis on maps of wine industry. Analysis of this map allowed us to identify areas of traditional wine-making, potential wine-making areas and countries which claim to be the world leaders in the field of wine production. We found disbalans between wine production and wine consumption - increasing wine production in South America, China and the United States and increasing wine consumption (mainly due to the import products in countries where the grape is not the primary agricultural product.

The Mapping X-ray Fluorescence Spectrometer (MapX)

Science.gov (United States)

Sarrazin, P.; Blake, D. F.; Marchis, F.; Bristow, T.; Thompson, K.

2017-12-01

Many planetary surface processes leave traces of their actions as features in the size range 10s to 100s of microns. The Mapping X-ray Fluorescence Spectrometer (MapX) will provide elemental imaging at 100 micron spatial resolution, yielding elemental chemistry at a scale where many relict physical, chemical, or biological features can be imaged and interpreted in ancient rocks on planetary bodies and planetesimals. MapX is an arm-based instrument positioned on a rock or regolith with touch sensors. During an analysis, an X-ray source (tube or radioisotope) bombards the sample with X-rays or alpha-particles / gamma-rays, resulting in sample X-ray Fluorescence (XRF). X-rays emitted in the direction of an X-ray sensitive CCD imager pass through a 1:1 focusing lens (X-ray micro-pore Optic (MPO)) that projects a spatially resolved image of the X-rays onto the CCD. The CCD is operated in single photon counting mode so that the energies and positions of individual X-ray photons are recorded. In a single analysis, several thousand frames are both stored and processed in real-time. Higher level data products include single-element maps with a lateral spatial resolution of 100 microns and quantitative XRF spectra from ground- or instrument- selected Regions of Interest (ROI). XRF spectra from ROI are compared with known rock and mineral compositions to extrapolate the data to rock types and putative mineralogies. When applied to airless bodies and implemented with an appropriate radioisotope source for alpha-particle excitation, MapX will be able to analyze biogenic elements C, N, O, P, S, in addition to the cations of the rock-forming elements >Na, accessible with either X-ray or gamma-ray excitation. The MapX concept has been demonstrated with a series of lab-based prototypes and is currently under refinement and TRL maturation.

Map of Nasca Geoglyphs

Science.gov (United States)

Hanzalová, K.; Pavelka, K.

2013-07-01

The Czech Technical University in Prague in the cooperation with the University of Applied Sciences in Dresden (Germany) work on the Nasca Project. The cooperation started in 2004 and much work has been done since then. All work is connected with Nasca lines in southern Peru. The Nasca project started in 1995 and its main target is documentation and conservation of the Nasca lines. Most of the project results are presented as WebGIS application via Internet. In the face of the impending destruction of the soil drawings, it is possible to preserve this world cultural heritage for the posterity at least in a digital form. Creating of Nasca lines map is very useful. The map is in a digital form and it is also available as a paper map. The map contains planimetric component of the map, map lettering and altimetry. Thematic folder in this map is a vector layer of the geoglyphs in Nasca/Peru. Basis for planimetry are georeferenced satellite images, altimetry is created from digital elevation model. This map was created in ArcGis software.

MAP OF NASCA GEOGLYPHS

Directory of Open Access Journals (Sweden)

K. Hanzalová

2013-07-01

Full Text Available The Czech Technical University in Prague in the cooperation with the University of Applied Sciences in Dresden (Germany work on the Nasca Project. The cooperation started in 2004 and much work has been done since then. All work is connected with Nasca lines in southern Peru. The Nasca project started in 1995 and its main target is documentation and conservation of the Nasca lines. Most of the project results are presented as WebGIS application via Internet. In the face of the impending destruction of the soil drawings, it is possible to preserve this world cultural heritage for the posterity at least in a digital form. Creating of Nasca lines map is very useful. The map is in a digital form and it is also available as a paper map. The map contains planimetric component of the map, map lettering and altimetry. Thematic folder in this map is a vector layer of the geoglyphs in Nasca/Peru. Basis for planimetry are georeferenced satellite images, altimetry is created from digital elevation model. This map was created in ArcGis software.