WorldWideScience

Sample records for yac contig encompassing

  1. YAC contig information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 8908/lsdba.nbdc00318-06-001 Description of data contents YAC contigs on the rice chromosomes Data file File name: rgp_physical...map_yac_contigs.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_contigs#en Data acquisition method The range including YAC con...m Description Chrom. No. Chromosome number Region Region number Physical map image The file name of rice physical...n Download License Update History of This Database Site Policy | Contact Us YAC contig information - RGP physicalmap | LSDB Archive ...

  2. Construction of a YAC contig and STS map spanning 2.5 Mbp in Xq25, the critical region for the X-linked lymphoproliferative (XLP) gene

    Energy Technology Data Exchange (ETDEWEB)

    Lanyi, A.; Li, B.F.; Li, S. [Univ. of Nebraska Medical Center, Omaha, NE (United States)] [and others

    1994-09-01

    X-linked lymphoproliferative disease (XLP) is characterized by a marked vulnerability in Epstein-Barr virus (EBV) infection. Infection of XLP patients with EBV invariably results in fatal mononucleosis, agammaglobulinemia or B-cell lymphoma. The XLP gene lies within a 10 cM region in Xq25 between DXS42 and DXS10. Initial chromosome studies revealed an interstitial, cytogenetically visible deletion in Xq25 in one XLP family (43-004). We estimated the size of the Xq25 deletion by dual laser flow karyotyping to involve 2% of the X chromosome, or approximately 3 Mbp of DNA sequences. To further delineate the deletion we performed a series of pulsed field gel electrophoresis (PFGE) analyses which showed that DXS6 and DXS100, two Xq25-specific markers, are missing from 45-004 DNA. Five yeast artificial chromosomes (YACs) from a chromosome X specific YAC library containing sequences deleted in patient`s 43-004 DNA were isolated. These five YACs did not overlap, and their end fragments were used to screen the CEPH MegaYAC library. Seven YACs were isolated from the CEPH MegaYAC library. They could be arranged into a contig which spans between DXS6 and DXS100. The contig contains a minimum of 2.5 Mbp of human DNA. A total of 12 YAC end clone, lambda subclones and STS probes have been used to order clones within the contig. These reagents were also used in Southern blot and patients showed interstitial deletions in Xq25. The size of these deletions range between 0.5 and 2.5 Mbp. The shortest deletion probably represents the critical region for the XLP gene.

  3. Construction of a yeast artifical chromosome contig spanning the spinal muscular atrophy disease gene region

    Energy Technology Data Exchange (ETDEWEB)

    Kleyn, P.W.; Wang, C.H.; Vitale, E.; Pan, J.; Ross, B.M.; Grunn, A.; Palmer, D.A.; Warburton, D.; Brzustowicz, L.M.; Gilliam, T.G. (New York State Psychiatric Institute, NY (United States)); Lien, L.L.; Kunkel, L.M. (Howard Hughes Medical Institute, Boston, MA (United States))

    1993-07-15

    The childhood spinal muscular atrophies (SMAs) are the most common, serious neuromuscular disorders of childhood second to Duchenne muscular dystrophy. A single locus for these disorders has been mapped by recombination events to a region of 0.7 centimorgan (range, 0.1-2.1 centimorgans) between loci D5S435 and MAP1B on chromosome 5q11.2-13.3. By using PCR amplification to screen yeast artificial chromosome (YAC) DNA pools and the PCR-vectorette method to amplify YAC ends, a YAC contig was constructed across the disease gene region. Nine walk steps identified 32 YACs, including a minimum of seven overlapping YAC clones (average size, 460 kb) that span the SMA region. The contig is characterized by a collection of 30 YAC-end sequence tag sites together with seven genetic markers. The entire YAC contig spans a minimum of 3.2 Mb; the SMA locus is confined to roughly half of this region. Microsatellite markers generated along the YAC contig segregate with the SMA locus in all families where the flanking markers (D5S435 and MAP1B) recombine. Construction of a YAC contig across the disease gene region is an essential step in isolation of the SMA-encoding gene. 26 refs., 3 figs., 1 tab.

  4. A YAC contig and an EST map in the pericentromeric region of chromosome 13 surrounding the loci for neurosensory nonsyndromic deafness (DFNB1 and DFNA3) and Limb-Girdle muscular dystrophy type 2C (LGMD2C)

    Energy Technology Data Exchange (ETDEWEB)

    Guilford, P.; Crozet, F.; Blanchard, S. [Institut Pasteur, Paris (France)] [and others

    1995-09-01

    Two forms of inherited childhood nonsyndromic deafness (DFNB1 and DFNA3) and a Duchenne-like form of progressive muscular dystrophy (LGMD2C) have been mapped to the pericentromeric region of chromosome 13. To clone the genes responsible for these diseases we constructed a yeast artificial chromosome (YAC) contig spanning an 8-cM region between the polymorphic markers D13S221. The contig comprises 24 sequence-tagged sites, among which 15 were newly obtained. This contig allowed us to order the polymorphic markers centromere- D13S175-D13S141-D13S143-D13S115-AFM128yc1-D13S292-D13S283-AFM323vh5-D13S221-telomere. Eight expressed sequence tags, previously assigned to 13q11-q12 (D13S182E, D13S183E, D13S502E, D13S504E, D13S505E, D13S837E, TUBA2, ATP1AL1), were localized on the YAC contig. YAC screening of a cDNA library derived from mouse cochlea allowed us to identify an {alpha}-tubulin gene (TUBA2) that was subsequently precisely mapped within the candidate region. 36 refs., 2 figs., 2 tabs.

  5. A 1.7-Mb YAC contig around the human BDNF gene (11p13): integration of the physical, genetic, and cytogenetic maps in relation to WAGR syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Rosier, M.F.; Martin, A.; Houlgatte, R. [Genetique Moleculaire et Biologie du Development, Villejuif (France)] [and others

    1994-11-01

    WAGR (Wilms tumor, aniridia, genito-urinary abnormalities, mental retardation) syndrome in humans is associated with deletions of the 11p13 region. The brain-derived neurotrophic factor (BDNF) gene maps to this region, and its deletion seems to contribute to the severity of the patient`s mental retardation. Yeast artificial chromosomes (YACs) carrying the BDNF gene have been isolated and characterized. Localization of two known exons of this gene leads to a minimal estimation of its size of about 40 kb. Chimerism of the BDNF YACs has been investigated by fluorescence in situ hybridization and chromosome assignment on somatic cell hybrids. Using the BDNF gene, YAC end sequence tagged sites (STS), and Genethon microsatellite markers, the authors constructed a 1.7-Mb contig and refined the cytogenetic map at 11p13. The resulting integrated physical, genetic, and cytogenetic map constitutes a resource for the characterization of genes that may be involved in the WAGR syndrome. 42 refs., 2 figs., 3 tabs.

  6. High-resolution YAC-cosmid-STS map of human chromosome 13.

    Science.gov (United States)

    Cayanis, E; Russo, J J; Kalachikov, S; Ye, X; Park, S H; Sunjevaric, I; Bonaldo, M F; Lawton, L; Venkatraj, V S; Schon, E; Soares, M B; Rothstein, R; Warburton, D; Edelman, I S; Zhang, P; Efstratiadis, A; Fischer, S G

    1998-01-01

    We have assembled a high-resolution physical map of human chromosome 13 DNA (approximately 114 Mb) from hybridization, PCR, and FISH mapping data using a specifically designed set of computer programs. Although the mapping of 13p is limited, 13q (approximately 98 Mb) is covered by an almost continuous contig of 736 YACs aligned to 597 contigs of cosmids. Of a total of 10,789 cosmids initially selected from a chromosome 13-specific cosmid library (16,896 colonies) using inter-Alu PCR probes from the YACs and probes for markers mapped to chromosome 13, 511 were assembled in contigs that were established from cross-hybridization relationships between the cosmids. The 13q YAC-cosmid map was annotated with 655 sequence tagged sites (STSs) with an average spacing of 1 STS per 150 kb. This set of STSs, each identified by a D number and cytogenetic location, includes database markers (198), expressed sequence tags (93), and STSs generated by sequencing of the ends of cosmid inserts (364). Additional annotation has been provided by positioning 197 cosmids mapped by FISH on 13q. The final (comprehensive) map, a list of STS primers, and raw data used in map assembly are available at our Web site (genome1.ccc.columbia.edu/ approximately genome/) and can serve as a resource to facilitate accurate localization of additional markers, provide substrates for sequencing, and assist in the discovery of chromosome 13 genes associated with hereditary diseases.

  7. Yeast artificial chromosome cloning in the glycerol kinase and adrenal hypoplasia congenita region of Xp21

    Energy Technology Data Exchange (ETDEWEB)

    Worley, K.C.; Ellison, K.A.; Zhang, Y.H.; Wang, D.F.; Mason, J.; Roth, E.J.; Adams, V.; Fogt, D.D.; Zhu, X.M.; Towbin, J.A. [Baylor College of Medicine, Houston, TX (United States)] [and others

    1993-05-01

    The adrenal hypoplasia congenita (AHC) and glycerol kinase (GK) loci are telomeric to the Duchenne muscular dystrophy locus in Xp21. The authors developed a pair of yeast artificial chromosome (YAC) contigs spanning at least 1.2 Mb and encompassing the region from the telomeric end of the Duchenne muscular dystrophy (DMD) locus to beyond YHX39 (DXS727), including the genes for AHC and GK. The centromeric contig consists of 13 YACs reaching more than 600 kb from DMD through GK. The telomeric contig group consists of 8 YACs containing more than 600 kb including the markers YHX39 (DXS727) and QST-59 (DXS319). Patient deletion breakpoints in the region of the two YAC contigs define at least eight intervals, and seven deletion breakpoints are contained within these contigs. In addition to the probes developed from YAC ends, they have mapped eight Alu-PCR probes amplified from a radiation-reduced somatic cell hybrid, two anonymous DNA probes, and one Alu-PCR product amplified from a cosmid end, for a total of 26 new markers within this region of 2 Mb or less. One YAC in the centromeric contig contains an insert encompassing the minimum interval for GK deficiency defined by patient deletion breakpoints, and this clone includes all or part of the GK gene. 33 refs., 3 figs., 5 tabs.

  8. Refined mapping and YAC contig construction of the X-linked cleft palate and ankyloglossia locus (CPX) including the proximal X-Y homology breakpoint within Xq21.3

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, S.A.; Brennan, L.; Richardson, M. [Queen Charlotte`s Hospital, London (United Kingdom)] [and others

    1996-01-01

    The gene for X-linked cleft palate (CPX) has previously been mapped in an Icelandic kindred between the unordered proximal markers DXS1002/DXS349/DXS95 and the distal marker DXYS1X, which maps to the proximal end of the X-Y homology region in Xq21.3. Using six sequence-tagged sites (STSs) within the region, a total of 91 yeast artificial chromosome (YAC) clones were isolated and overlapped in a single contig that spans approximately 3.1 Mb between DXS1002 and DXYS1X. The order of microsatellite and STS markers in this was established as DXS1002-DXS1168-DXS349-DXS95-DXS364-DXS1196-DXS472-DXS1217-DXYS1X. A long-range restriction map of this region was created using eight nonchimeric, overlapping YAC clones. Analysis of newly positioned polymorphic markers in recombinant individuals from the Icelandic family has enabled us to identify DXS1196 and DXS1217 as the flanking markers for CPX. The maximum physical distance containing the CPX gene has been estimated to be 2.0 Mb, which is spanned by a minimum set of five nonchimeric YAC clones. In addition, YAC end clone and STS analyses have pinpointed the location of the proximal boundary of the X-Y homology region within the map. 40 refs., 2 figs., 2 tabs.

  9. Mapping of the locus for autosomal dominant amelogenesis imperfecta (AIH2) to a 4-Mb YAC contig on chromosome 4q11-q21

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, C.; Holmgren, G.; Forsman, K. [Univ. Hospital, Umea (Sweden)]|[Univ. of Umea (Sweden)] [and others

    1997-01-15

    Amelogenesis imperfecta (Al) is a clinically and genetically heterogeneous group of inherited enamel defects. We recently mapped a locus for autosomal dominant local hypoplastic amelogenesis imperfecta (AIH2) to the long arm of chromosome 4. The disease gene was localized to a 17.6-cM region between the markers D4S392 and D4S395. The albumin gene (ALB), located in the same interval, was a candidate gene for autosomal dominant AI (ADAI) since albumin has a potential role in enamel maturation. Here we describe refined mapping of the AIH2 locus and the construction of marker maps by radiation hybrid mapping and yeast artificial chromosome (YAC)-based sequence tagged site-content mapping. A radiation hybrid map consisting of 11 microsatellite markers in the 5-cM interval between D4S409 and D4S1558 was constructed. Recombinant haplotypes in six Swedish ADAI families suggest that the disease gene is located in the interval between D4S2421 and ALB. ALB is therefore not likely to be the disease-causing gene. Affected members in all six families share the same allele haplotypes, indicating a common ancestral mutation in all families. The AIH2 critical region is less than 4 cM and spans a physical distance of approximately 4 Mb as judged from radiation hybrid maps. A YAC contig over the AIH2 critical region including several potential candidate genes was constructed. 35 refs., 4 figs., 1 tab.

  10. Development of a YAC contig covering the minimal region of a CSNB1 locus in Xp11

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Gratton, K.J.; Moore, B.J. [Univ. of Calgary (Canada)] [and others

    1994-09-01

    X-linked congenital stationary night blindness (CSNB1) is an eye disorder that includes impairment of night vision, reduced visual acuity and, in some cases, myopia and congenital nystagmus. Electroretinography reveals a marked reduction of the b-wave in affected individuals suggesting that X-linked CSNB is due to a molecular defect in the bipolar layer of the retina. Based on our studies of a large four generation family with X-linked CSNB, a CSNB1 locus was mapped to a 4-5 cM region at Xp11.23-Xp11.22 bounded telomerically by DXS426 and centromerically by DXS988. Using a panel of radiation and conventional somatic cell hybrids, a detailed map of new and published STSs has been generated for the minimal region of CSNB1. PCR primer pairs for STSs has been generated for the minimal region of CSNB1. PCR primer pairs for twenty-five STSs, including eleven end-clones, were used to isolate YAC clones from CEPH, mega-CEPH, and X chromosome-specific YAC libraries. In total, fifty-two YACs were characterized for STS overlaps and assembled to provide a minimum of 3 Mb of physical coverage in the region between DXS426 and DXS988. Five gaps proximal to SYP are still to be closed. Our physical map suggests the following gene order: Xpter-OTAL1-GF1-DXS1011E-MG81-HUMCRAS2P-SYP-Xcen. STS analysis of the YACs revealed three subregions of the physical map which appear to be particularly susceptible to internal deletions and end-clone analysis demonstrated chimerism in six of seventeen YACs. A physical map of Xp11.23-Xp11.22 will provide a resource for the isolation of candidate genes for the X-linked CSNB gene which maps to this region.

  11. A 2-megabase physical contig incorporating 43 DNA markers on the human X chromosome at p11.23-p11.22 from ZNF21 to DXS255

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Bech-Hansen, N.T. [Univ. of Calgary, Alberta (Canada); Halley, G.R.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)

    1996-05-01

    A comprehensive physical contig of yeast artificial chromosomes (YACs) and cosmid clones between ZNF21 and DXS255 has been constructed, spanning 2 Mb within the region Xp11.23-p11.22. As a portion of the region was found to be particularly unstable in yeast, the integrity of the contig is dependent on additional information provided by the sequence-tagged site (STS) content of cosmid clones and DNA marker retention in conventional and radiation hybrids. The contig was formatted with 43 DNA markers, including 19 new STSs from YAC insert ends and an internal Alu-PCR product. The density of STSs across the contig ranges from one marker every 20 kb to one every 60 kb, with an average density of one marker every 50 kb. The relative order of previously known gene and expressed sequence tags in this region is predicted to be Xpter-ZNF21-DXS7465E (MG66)-DXS7927E (MG81)-WASP, DXS1011E, DXS7467E (MG21)-DXS-7466E (MG44)-GATA1-DXS7469E (Xp664)-TFE3-SYP (DXS1007E)-Xcen. This contig extends the coverage in Xp11 and provides a framework for the future identification and mapping of new genes, as well as the resources for developing DNA sequencing templates. 47 refs., 1 fig., 4 tabs.

  12. The human MCP-2 gene (SCYA8): Cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2

    Energy Technology Data Exchange (ETDEWEB)

    Van Coillie, E.; Fiten, P.; Van Damme, J.; Opdenakker, G. [Univ. of Leuven (Belgium)] [and others

    1997-03-01

    Monocyte chemotactic proteins (MCPs) form a subfamily of chemokines that recruit leukocytes to sites of inflammation and that may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. With the use of degenerate primers that were based on CC chemokine consensus sequences, the known MIP-1{alpha}/LD78{alpha}, MCP-1, and MCP-3 genes and the previously unidentified eotaxin and MCP-2 genes were isolated from a YAC contig from human chromosome 17q11.2. The amplified genomic MCP-2 fragment was used to isolate an MCP-2 cosmid from which the gene sequence was determined. The MCP-2 gene shares with the MCP-1 and MCP-3 genes a conserved intron-exon structure and a coding nucleotide sequence homology of 77%. By Northern blot analysis the 1.0-kb MCP-2 mRNA was predominantly detectable in the small intestine, peripheral blood, heart, placenta, lung, skeletal muscle, ovary, colon, spinal cord, pancreas, and thymus. Transcripts of 1.5 and 2.4 kb were found in the testis, the small intestine, and the colon. The isolation of the MCP-2 gene from the chemokine contig localized it on YAC clones of chromosome 17q11.2, which also contain the eotaxin, MCP-1, MCP-3, and NCC-1/MCP-4 genes. The combination of using degenerate primer PCR and YACs illustrates that novel genes can efficiently be isolated from gene cluster contigs with less redundancy and effort than the isolation of novel ESTs. 42 refs., 5 figs., 2 tabs.

  13. Contig Maps and Genomic Sequencing Identify Candidate Genes in the Usher 1C Locus

    Science.gov (United States)

    Higgins, Michael J.; Day, Colleen D.; Smilinich, Nancy J.; Ni, L.; Cooper, Paul R.; Nowak, Norma J.; Davies, Chris; de Jong, Pieter J.; Hejtmancik, Fielding; Evans, Glen A.; Smith, Richard J.H.; Shows, Thomas B.

    1998-01-01

    Usher syndrome 1C (USH1C) is a congenital condition manifesting profound hearing loss, the absence of vestibular function, and eventual retinal degeneration. The USH1C locus has been mapped genetically to a 2- to 3-cM interval in 11p14–15.1 between D11S899 and D11S861. In an effort to identify the USH1C disease gene we have isolated the region between these markers in yeast artificial chromosomes (YACs) using a combination of STS content mapping and Alu–PCR hybridization. The YAC contig is ∼3.5 Mb and has located several other loci within this interval, resulting in the order CEN-LDHA-SAA1-TPH-D11S1310-(D11S1888/KCNC1)-MYOD1-D11S902D11S921-D11S1890-TEL. Subsequent haplotyping and homozygosity analysis refined the location of the disease gene to a 400-kb interval between D11S902 and D11S1890 with all affected individuals being homozygous for the internal marker D11S921. To facilitate gene identification, the critical region has been converted into P1 artificial chromosome (PAC) clones using sequence-tagged sites (STSs) mapped to the YAC contig, Alu–PCR products generated from the YACs, and PAC end probes. A contig of >50 PAC clones has been assembled between D11S1310 and D11S1890, confirming the order of markers used in haplotyping. Three PAC clones representing nearly two-thirds of the USH1C critical region have been sequenced. PowerBLAST analysis identified six clusters of expressed sequence tags (ESTs), two known genes (BIR,SUR1) mapped previously to this region, and a previously characterized but unmapped gene NEFA (DNA binding/EF hand/acidic amino-acid-rich). GRAIL analysis identified 11 CpG islands and 73 exons of excellent quality. These data allowed the construction of a transcription map for the USH1C critical region, consisting of three known genes and six or more novel transcripts. Based on their map location, these loci represent candidate disease loci for USH1C. The NEFA gene was assessed as the USH1C locus by the sequencing of an amplified NEFA

  14. YAC clone information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 08/lsdba.nbdc00318-06-002 Description of data contents YAC clones selected with DNA markers Data file File name: rgp_physical...map_yac_clones.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_clones#en Data acquisition method YAC clones selected with RGP...rom. No. Chromosome number Region Region number Physical map image The file name of rice physical map Order ...bout This Database Database Description Download License Update History of This Database Site Policy | Contact Us YAC clone information - RGP physicalmap | LSDB Archive ...

  15. Transfer of an expression YAC into goat fetal fibroblasts by cell fusion for mammary gland bioreactor

    International Nuclear Information System (INIS)

    Zhang Xufeng; Wu Guoxiang; Chen, Jian-Quan; Zhang Aimin; Liu Siguo; Jiao Binghua; Cheng Guoxiang

    2005-01-01

    Yeast artificial chromosomes (YACs) as transgenes in transgenic animals are likely to ensure optimal expression levels. Microinjection of YACs is the exclusive technique used to produce YACs transgenic livestock so far. However, low efficiency and high cost are its critical restrictive factors. In this study, we presented a novel procedure to produce YACs transgenic livestock as mammary gland bioreactor. A targeting vector, containing the gene of interest-a human serum albumin minigene (intron 1, 2), yeast selectable marker (G418R), and mammalian cell resistance marker (neo r ), replaced the α-lactalbumin gene in a 210 kb human α-lactalbumin YAC by homogeneous recombination in yeasts. The chimeric YAC was introduced into goat fetal fibroblasts using polyethylene glycol-mediated spheroplast fusion. PCR and Southern analysis showed that intact YAC was integrated in the genome of resistant cells. Perhaps, it may offer a cell-based route by nuclear transfer to produce YACs transgenic livestock

  16. A method for high efficiency YAC lipofection into murine embryonic stem cells.

    Science.gov (United States)

    Lee, J T; Jaenisch, R

    1996-01-01

    We describe a modified protocol for introducing yeast artificial chromosomes (YACs) into murine embryonic stem (ES) cells by lipofection. With a decreased DNA:cell ratio, increased concentration of condensing agents and altered culture conditions, this protocol reduces the requirement for YAC DNA to a few micrograms, improves the recovery of neomycin-resistant ES colonies and increases the yield of clones containing both flanking vector markers and insert. These modifications enable generation of sufficient 'intact' transgenic clones for biological analysis with a single experiment. PMID:9016681

  17. Physical and transcription map of a 25 Mb region on human chromosome 7 (region q21-q22)

    Energy Technology Data Exchange (ETDEWEB)

    Scherer, S. [Univ. of Toronto (Canada)]|[Hosptial for Sick Children, Toronto (Canada); Little, S.; Vandenberg, A. [Hospital for Sick Children, Toronto (Canada)] [and others

    1994-09-01

    We are interested in the q21-q22 region of chromosome 7 because of its implication in a number of diseases. This region of about 25 Mb appears to be involved in ectrodactyly/ectodermal dysplasia/cleft plate (EEC) and split hand/split foot deformity (SHFD1), as well as myelodysplastic syndrome and acute non-lymphocyte leukemia. In order to identify the genes responsible for these and other diseases, we have constructed a physical map of this region. The proximal and distal boundaries of the region were operationally defined by the microsatellite markers D7S660 and D7S692, which are about 35 cM apart. This region between these two markers could be divided into 13 intervals on the basis of chromosome breakpoints contained in somatic cell hybrids. The map positions for 43 additional microsatellite markers and 25 cloned genes were determined with respect to these intervals. A physical map based on contigs of over 250 YACs has also been assembled. While the contigs encompass all of the known genetic markers mapped to the region and almost cover the entire 25-Mb region, there are 3 gaps on the map. One of these gaps spans a set of DNA markers for which no corresponding YAC clones could be identified. To connect the two adjacent contigs we have initiated cosmid walking with a chromosome 7-specific library (Lawrence Livermore Laboratory). A tiling path of 60 contiguous YAC clones has been assembled and used for direct cDNA selection. Over 300 cDNA clones have been isolated and characterized. They are being grouped into transcription units by Northern blot analysis and screening of full-length cDNA libraries. Further, exon amplification and direct cDNA library screening with evolutionarily conserved sequences are being performed for a 1-Mb region spanning the SHFD1 locus to ensure detection of all transcribed sequences.

  18. Report of the Fourth International Workshop on human X chromosome mapping 1993

    Energy Technology Data Exchange (ETDEWEB)

    Schlessinger, D.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Willard, H.F. [eds.

    1993-12-31

    Vigorous interactive efforts by the X chromosome community have led to accelerated mapping in the last six months. Seventy-five participants from 12 countries around the globe contributed progress reports to the Fourth International X Chromosome Workshop, at St. Louis, MO, May 9-12, 1993. It became clear that well over half the chromosome is now covered by YAC contigs that are being extended, verified, and aligned by their content of STSs and other markers placed by cytogenetic or linkage mapping techniques. The major aim of the workshop was to assemble the consensus map that appears in this report, summarizing both consensus order and YAC contig information.

  19. Evaluation of Texture Profile, Color and Determination of FOS in Yacón Products (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Valeria Cristina Del Castillo

    2016-07-01

    Full Text Available Textural characteristics, color and fructooligosaccharides (FOS content, in yacón root products (syrup and dried snack subjected to different pretreatments with NaCl, blanching and ascorbic acid were evaluated. Yacón from Salta Capital, with 8 months of growth were used. Texture profiles and Color were evaluated instrumentally and FOS content by HPLC. There were significant differences between the samples treated with NaCl and the ones treated by blanching and ascorbic acid for fracture strength, fracture number and hardness according to pretreatment used, and for hardness and tackiness by the drying time. Regarding to color: longer drying time reduces sample brightness. In processed products the FOS content is lower than in fresh yacón, but higher in sucrose, glucose and fructose.

  20. Efecto de gelificantes en la formulación de dulce de yacón

    OpenAIRE

    Maldonado,Silvina; Singh,Judith del Carmen

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  1. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  2. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

  3. Dicty_cDB: Contig-U09694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

  4. AcEST: CL1889Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91

  5. Dicty_cDB: Contig-U15058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

  6. Dicty_cDB: Contig-U14745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

  7. Dicty_cDB: Contig-U03367-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

  8. Dicty_cDB: Contig-U16086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

  9. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

  10. Dicty_cDB: Contig-U06307-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

  11. Dicty_cDB: Contig-U15541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

  12. Dicty_cDB: Contig-U06822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

  13. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  14. Dicty_cDB: Contig-U13254-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

  15. Dicty_cDB: Contig-U13891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

  16. Dicty_cDB: Contig-U16093-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

  17. Dicty_cDB: Contig-U06384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

  18. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  19. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

  20. Dicty_cDB: Contig-U13065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

  1. Dicty_cDB: Contig-U08861-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

  2. Dicty_cDB: Contig-U06829-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

  3. Dicty_cDB: Contig-U12073-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

  4. Dicty_cDB: Contig-U09615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

  5. Dicty_cDB: Contig-U04432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

  6. Dicty_cDB: Contig-U15828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

  7. Dicty_cDB: Contig-U01750-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

  8. Dicty_cDB: Contig-U07021-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  9. Dicty_cDB: Contig-U16108-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

  10. Dicty_cDB: Contig-U13974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

  11. Dicty_cDB: Contig-U16008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

  12. Dicty_cDB: Contig-U11342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

  13. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  14. Dicty_cDB: Contig-U01791-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

  15. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

  16. Dicty_cDB: Contig-U12357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

  17. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  18. Dicty_cDB: Contig-U12049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

  19. Dicty_cDB: Contig-U13894-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

  20. Dicty_cDB: Contig-U15462-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

  1. Dicty_cDB: Contig-U09720-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

  2. Dicty_cDB: Contig-U09379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

  3. Dicty_cDB: Contig-U15566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

  4. Dicty_cDB: Contig-U04334-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

  5. Dicty_cDB: Contig-U10335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

  6. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  7. Dicty_cDB: Contig-U11404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

  8. Dicty_cDB: Contig-U09569-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

  9. Dicty_cDB: Contig-U15306-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

  10. Dicty_cDB: Contig-U14772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

  11. Dicty_cDB: Contig-U11141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

  12. Dicty_cDB: Contig-U13202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

  13. Dicty_cDB: Contig-U15062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

  14. Dicty_cDB: Contig-U09432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

  15. Dicty_cDB: Contig-U15005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

  16. Dicty_cDB: Contig-U10406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

  17. Dicty_cDB: Contig-U16457-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

  18. Dicty_cDB: Contig-U04768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

  19. Dicty_cDB: Contig-U13326-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

  20. Dicty_cDB: Contig-U15036-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

  1. Dicty_cDB: Contig-U13455-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

  2. Dicty_cDB: Contig-U14400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

  3. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  4. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  5. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  6. Dicty_cDB: Contig-U09480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

  7. Dicty_cDB: Contig-U09345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

  8. Dicty_cDB: Contig-U15323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

  9. Dicty_cDB: Contig-U14236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

  10. Dicty_cDB: Contig-U10291-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

  11. Dicty_cDB: Contig-U07545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

  12. Dicty_cDB: Contig-U15359-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

  13. Dicty_cDB: Contig-U09581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

  14. Dicty_cDB: Contig-U04729-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

  15. Dicty_cDB: Contig-U06929-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

  16. Dicty_cDB: Contig-U15525-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

  17. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  18. Dicty_cDB: Contig-U11883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

  19. Dicty_cDB: Contig-U13680-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

  20. Dicty_cDB: Contig-U15718-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

  1. Dicty_cDB: Contig-U15573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

  2. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

  3. Dicty_cDB: Contig-U12043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

  4. Dicty_cDB: Contig-U16467-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

  5. Dicty_cDB: Contig-U12682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  6. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

  7. Cellular, molecular and functional characterisation of YAC transgenic mouse models of Friedreich ataxia.

    Directory of Open Access Journals (Sweden)

    Sara Anjomani Virmouni

    Full Text Available Friedreich ataxia (FRDA is an autosomal recessive neurodegenerative disorder, caused by a GAA repeat expansion mutation within intron 1 of the FXN gene. We have previously established and performed preliminary characterisation of several human FXN yeast artificial chromosome (YAC transgenic FRDA mouse models containing GAA repeat expansions, Y47R (9 GAA repeats, YG8R (90 and 190 GAA repeats and YG22R (190 GAA repeats.We now report extended cellular, molecular and functional characterisation of these FXN YAC transgenic mouse models. FXN transgene copy number analysis of the FRDA mice demonstrated that the YG22R and Y47R lines each have a single copy of the FXN transgene while the YG8R line has two copies. Single integration sites of all transgenes were confirmed by fluorescence in situ hybridisation (FISH analysis of metaphase and interphase chromosomes. We identified significant functional deficits, together with a degree of glucose intolerance and insulin hypersensitivity, in YG8R and YG22R FRDA mice compared to Y47R and wild-type control mice. We also confirmed increased somatic GAA repeat instability in the cerebellum and brain of YG22R and YG8R mice, together with significantly reduced levels of FXN mRNA and protein in the brain and liver of YG8R and YG22R compared to Y47R.Together these studies provide a detailed characterisation of our GAA repeat expansion-based YAC transgenic FRDA mouse models that will help investigations of FRDA disease mechanisms and therapy.

  8. Dicty_cDB: Contig-U15069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

  9. Dicty_cDB: Contig-U12316-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

  10. Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

    OpenAIRE

    Ramos Zapana, Rubén; Arias Arroyo, Gladys

    2014-01-01

    Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

  11. Projector : automatic contig mapping for gap closure purposes

    NARCIS (Netherlands)

    van Hijum, SAFT; Zomer, AL; Kuipers, OP; Kok, J

    2003-01-01

    Projector was designed for automatic positioning of contigs from an unfinished prokaryotic genome onto a template genome of a closely related strain or species. Projector mapped 84 contigs of Lactococcus lactis MG1363 (corresponding to 81% of the assembly nucleotides) against the genome of L.lactis

  12. Mice lacking caspase-2 are protected from behavioral changes, but not pathology, in the YAC128 model of Huntington disease

    Directory of Open Access Journals (Sweden)

    Bissada Nagat

    2011-08-01

    Full Text Available Abstract Background Huntington Disease (HD is a neurodegenerative disorder in which caspase activation and cleavage of substrates, including the huntingtin protein, has been invoked as a pathological mechanism. Specific changes in caspase-2 (casp2 activity have been suggested to contribute to the pathogenesis of HD, however unique casp2 cleavage substrates have remained elusive. We thus utilized mice completely lacking casp2 (casp2-/- to examine the role played by casp2 in the progression of HD. This 'substrate agnostic' approach allows us to query the effect of casp2 on HD progression without pre-defining proteolytic substrates of interest. Results YAC128 HD model mice lacking casp2 show protection from well-validated motor and cognitive features of HD, including performance on rotarod, swimming T-maze, pre-pulse inhibition, spontaneous alternation and locomotor tasks. However, the specific pathological features of the YAC128 mice including striatal volume loss and testicular degeneration are unaltered in mice lacking casp2. The application of high-resolution magnetic resonance imaging (MRI techniques validates specific neuropathology in the YAC128 mice that is not altered by ablation of casp2. Conclusions The rescue of behavioral phenotypes in the absence of pathological improvement suggests that different pathways may be operative in the dysfunction of neural circuitry in HD leading to behavioral changes compared to the processes leading to cell death and volume loss. Inhibition of caspase-2 activity may be associated with symptomatic improvement in HD.

  13. Cinética de la transferencia de masa durante la deshidratación osmótica de yacón (Smallanthus sonchifolius Cinética de transferência de massa durante a desidratação osmótica de yacón (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-03-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino de vida útil muy corta bajo condiciones ambientales. Los objetivos de este trabajo fueron determinar: 1 la cinética de deshidratación osmótica de yacón, utilizando sacarosa como soluto; 2 el ajuste de la ecuación de Peleg a los datos experimentales; y 3 el coeficiente de difusión usando la ecuación de Hawkes y Flink. La fruta se peló y cortó en placas de 3 x 3 x 0,3 cm. Se la deshidrató osmóticamente con solución de sacarosa al 40% (p/p, hasta aw = 0,97. El proceso se realizó a temperatura de 25 °C y con agitación continua (105 rpm. Se determinó la pérdida de peso de las muestras, la ganancia de sólidos y la retención de agua. Los parámetros obtenidos para el ajuste de pérdida de agua y ganancia de sólidos son respectivamente: k1: 8,2 0,1 y k2: 0,53 ± 0,06; k1: 234 ± 8 y k2: 2,6 ± 0,5. La mayor transferencia de masa, tanto de agua como de soluto, ocurre durante los primeros 60 a 90 minutos de proceso, lográndose una ganancia media de sólidos de 9,5 [g.100 g-1 MF] y una pérdida de agua de 68,8 [g.100 g-1MF]. Se puede asegurar que es posible aplicar satisfactoriamente el proceso de deshidratación osmótica en yacón como pre tratamiento de conservación.O yacón (Smallanthus sonchifolius é um tubérculo andino de vida útil muito curta sob condições ambientais. Os objetivos deste trabalho foram determinar: 1 a cinética de desidratação osmótica do yacón, utilizando sacarose como soluto; 2 o ajuste da equação de Peleg aos dados experimentais; e 3 o coeficiente de difusão usando a equação de Hawkes e Flink. A fruta foi descascada e cortada em placas de 3 x 3 x 0,3 cm. Foi desidratada osmoticamente usando uma solução de sacarose aos 40% (p/p, até aw = 0,97. O processo foi conduzido mantendo a temperatura constante em 25 °C e com agitação orbital contínua (105 rpm. Determinou-se a perda de peso das mostras, o ganho de sólidos e a retenção de

  14. Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

    Science.gov (United States)

    Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

    2016-01-01

    A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

  15. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    OpenAIRE

    Silvina Maldonado; Judith del Carmen Singh

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  16. difusividad, masa, humedad, volumen y sólidos en yacón (Smallantus sonchifolius deshidratado osmóticamente

    Directory of Open Access Journals (Sweden)

    Julio Rojas Naccha

    2012-01-01

    Full Text Available Se evaluó la capacidad predictiva de la Red Neuronal Artificial (RNA en el efecto de la concentración (30,40, 50 y 60 % p/p y temperatura (30, 40 y 50°C de la solución de fructooligosacaridos (FOS en la masa,humedad, volumen y sólidos en cubos de yacón osmodeshidratados, y en el coeficiente de difusividad efectivamedia del agua, con y sin encogimiento. Se aplicó la RNA del tipoFeedforwardcon los algoritmos deentrenamientoBackpropagationy de ajuste de pesosLevenberg-Marquardt, usando la topología: error metade 10-5, tasa de aprendizaje de 0.01, coeficiente de momento de 0.5, 2 neuronas de entrada, 6 neuronas desalida, una capa oculta con 18 neuronas, 15 etapas de entrenamiento y funciones de transferencialogsig-purelin. El error promedio global por la RNA fue 3.44% y los coeficientes de correlación fueron mayores a0.9. No se encontraron diferencias significativas entre los valores experimentales con losvalores predichos porla RNA y con los valores predichos por un modelo estadístico de regresión polinomial de segundo orden (p >0.95.Palabras clave:Red Neuronal Artificial (RNA, difusividad efectiva, yacón, deshidratación osmótica

  17. Dicty_cDB: Contig-U16279-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

  18. A Blumeria graminis f.sp. hordei BAC library - contig building and microsynteny studies

    DEFF Research Database (Denmark)

    Pedersen, C.; Wu, B.; Giese, H.

    2002-01-01

    A bacterial artificial chromosome (BAC) library of Blumeria graminis f.sp. hordei, containing 12,000 clones with an average insert size of 41 kb, was constructed. The library represents about three genome equivalents and BAC-end sequencing showed a high content of repetitive sequences, making...... contigs, at or close to avirulence loci, were constructed. Single nucleotide polymorphism (SNP) markers were developed from BAC-end sequences to link the contigs to the genetic maps. Two other BAC contigs were used to study microsynteny between B. graminis and two other ascomycetes, Neurospora crassa...

  19. Cloning of the anhidrotic ectodermal dysplasia gene: Identification of cDNAs associated with CpG islands mapped near translocation breakpoint in two female patients

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Kere, J. [Univ. of Helsinki (Finland)] [and others

    1994-09-01

    The gene for the X chromosomal developmental disorder anhidrotic ectodermal dysplasia (EDA) has been mapped to Xq12-q13 by linkage analysis and is expressed in a few females with chromosomal translocations involving band Xq12-q13. A yeast artificial chromosome (YAC) contig (2.0 Mb) spanning two translocation breakpoints has been assembled by sequence-tagged site (STS)-based chromosomal walking. The two translocation breakpoints (X:autosome translocations from the affected female patients) have been mapped less than 60 kb apart within a YAC contig. Unique probes and intragenic STSs (mapped between the two translocations) have been developed and a somatic cell hybrid carrying the translocated X chromosome from the AK patient has been analyzed by isolating unique probes that span the breakpoint. Several STSs made from intragenic sequences have been found to be conserved in mouse, hamster and monkey, but we have detected no mRNAs in a number of tissues tested. However, a probe and STS developed from the DNA spanning the AK breakpoint is conserved in mouse, hamster and monkey, and we have detected expressed sequences in skin cells and cDNA libraries. In addition, unique sequences have been obtained from two CpG islands in the region that maps proximal to the breakpoints. cDNAs containing these sequences are being studied as candidates for the gene affected in the etiology of EDA.

  20. ESTminer: a Web interface for mining EST contig and cluster databases.

    Science.gov (United States)

    Huang, Yecheng; Pumphrey, Janie; Gingle, Alan R

    2005-03-01

    ESTminer is a Web application and database schema for interactive mining of expressed sequence tag (EST) contig and cluster datasets. The Web interface contains a query frame that allows the selection of contigs/clusters with specific cDNA library makeup or a threshold number of members. The results are displayed as color-coded tree nodes, where the color indicates the fractional size of each cDNA library component. The nodes are expandable, revealing library statistics as well as EST or contig members, with links to sequence data, GenBank records or user configurable links. Also, the interface allows 'queries within queries' where the result set of a query is further filtered by the subsequent query. ESTminer is implemented in Java/JSP and the package, including MySQL and Oracle schema creation scripts, is available from http://cggc.agtec.uga.edu/Data/download.asp agingle@uga.edu.

  1. Dicty_cDB: Contig-U03802-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

  2. LTC: a novel algorithm to improve the efficiency of contig assembly for physical mapping in complex genomes

    Directory of Open Access Journals (Sweden)

    Feuillet Catherine

    2010-11-01

    Full Text Available Abstract Background Physical maps are the substrate of genome sequencing and map-based cloning and their construction relies on the accurate assembly of BAC clones into large contigs that are then anchored to genetic maps with molecular markers. High Information Content Fingerprinting has become the method of choice for large and repetitive genomes such as those of maize, barley, and wheat. However, the high level of repeated DNA present in these genomes requires the application of very stringent criteria to ensure a reliable assembly with the FingerPrinted Contig (FPC software, which often results in short contig lengths (of 3-5 clones before merging as well as an unreliable assembly in some difficult regions. Difficulties can originate from a non-linear topological structure of clone overlaps, low power of clone ordering algorithms, and the absence of tools to identify sources of gaps in Minimal Tiling Paths (MTPs. Results To address these problems, we propose a novel approach that: (i reduces the rate of false connections and Q-clones by using a new cutoff calculation method; (ii obtains reliable clusters robust to the exclusion of single clone or clone overlap; (iii explores the topological contig structure by considering contigs as networks of clones connected by significant overlaps; (iv performs iterative clone clustering combined with ordering and order verification using re-sampling methods; and (v uses global optimization methods for clone ordering and Band Map construction. The elements of this new analytical framework called Linear Topological Contig (LTC were applied on datasets used previously for the construction of the physical map of wheat chromosome 3B with FPC. The performance of LTC vs. FPC was compared also on the simulated BAC libraries based on the known genome sequences for chromosome 1 of rice and chromosome 1 of maize. Conclusions The results show that compared to other methods, LTC enables the construction of highly

  3. Efecto hepatoprotector del extracto acuoso de Smallanthus sonchifolius (yacón en un modelo de intoxicación con acetaminofén

    Directory of Open Access Journals (Sweden)

    Acela Inés Arnao-Salas

    2012-07-01

    Full Text Available En la medicina tradicional se ha publicado que las hojas de Smallanthus sonchifolius (yacón poseen efectos antidiabético y hepatoprotector. Objetivos: Evaluar en suero y hematíes el efecto hepatoprotector del extracto acuoso de hojas de yacón (EAY en un modelo de intoxicación con acetaminofén en ratas. Diseño: Experimental, transversal. Institución: Centro de Investigación de Bioquímica y Nutrición, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Hojas de yacón. Intervenciones: Se formó cinco grupos de ratas hembra (n=6 que recibieron por cinco días, por vía oral, suero fisiológico (SF, EAY o silimarina (Sil (50 mg/kg y luego de 1 hora, SF o acetaminofén (A 250 mg/kg, según lo siguiente: G1 (control; SF-SF, G2 (SF-A, G3 (EAY (200 mg/kg-A, G4 (EAY (400 mg/kg-A y G5 (Sil-A. Principales medidas de los resultados: Actividad de aspartato amino transferasas (AST, alanina amino transferasa (ALT, fosfatasa alcalina (FAL γ γ-amino transferasa (γ-GTP; niveles de bilirrubina total (BT, proteνnas y lipoperoxidaciσn (MDA. En hematíes, actividades de superóxido dismutasa (SOD, catalasa (CAT y hemoglobina. Resultados: Se observó aumento significativo (p<0,05 en la actividad de γ-GTP entre el grupo G2 y los grupos G3 y G4. Hubo disminuciσn significativa (p<0,05 de proteνnas en el grupo G2 con respecto G1. El nivel de MDA fue menor en el grupo que recibió 200 mg/kg de EAY con respecto al control. Las actividades de AST, ALT y FAL no mostraron diferencias significativas. La relación SOD/CAT fue similar entre los grupos G1, G4 y G5, evidencia de una recuperación del daño causado por el acetaminofén. Conclusiones: La administración del EAY tuvo un efecto hepatoprotector comparable a la silimarina.

  4. Efecto del smallanthus sonchifolius "yacón" en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007

    OpenAIRE

    Reyes Beltrán, María Esther Daisy

    2009-01-01

    Autor: María Esther Daisy Reyes Beltrán Título Tesis Doctoral: Efecto del Smallanthus sonchifolius “yacón” en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007. Asesor: Dr. Juan Jorge Huamán Saavedra. Páginas Totales: 40 Institución: Facultad de Medicina, Universidad Nacional de Trujillo. El aumento de LDL colesterol y de triglicéridos y la disminución de HDL colesterol son factores de riesgo coronario. Es de interés saber si existe alguna variació...

  5. Two sequence-ready contigs spanning the two copies of a 200-kb duplication on human 21q: partial sequence and polymorphisms.

    Science.gov (United States)

    Potier, M; Dutriaux, A; Orti, R; Groet, J; Gibelin, N; Karadima, G; Lutfalla, G; Lynn, A; Van Broeckhoven, C; Chakravarti, A; Petersen, M; Nizetic, D; Delabar, J; Rossier, J

    1998-08-01

    Physical mapping across a duplication can be a tour de force if the region is larger than the size of a bacterial clone. This was the case of the 170- to 275-kb duplication present on the long arm of chromosome 21 in normal human at 21q11.1 (proximal region) and at 21q22.1 (distal region), which we described previously. We have constructed sequence-ready contigs of the two copies of the duplication of which all the clones are genuine representatives of one copy or the other. This required the identification of four duplicon polymorphisms that are copy-specific and nonallelic variations in the sequence of the STSs. Thirteen STSs were mapped inside the duplicated region and 5 outside but close to the boundaries. Among these STSs 10 were end clones from YACs, PACs, or cosmids, and the average interval between two markers in the duplicated region was 16 kb. Eight PACs and cosmids showing minimal overlaps were selected in both copies of the duplication. Comparative sequence analysis along the duplication showed three single-basepair changes between the two copies over 659 bp sequenced (4 STSs), suggesting that the duplication is recent (less than 4 mya). Two CpG islands were located in the duplication, but no genes were identified after a 36-kb cosmid from the proximal copy of the duplication was sequenced. The homology of this chromosome 21 duplicated region with the pericentromeric regions of chromosomes 13, 2, and 18 suggests that the mechanism involved is probably similar to pericentromeric-directed mechanisms described in interchromosomal duplications. Copyright 1998 Academic Press.

  6. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  7. The binning of metagenomic contigs for microbial physiology of mixed cultures.

    Science.gov (United States)

    Strous, Marc; Kraft, Beate; Bisdorf, Regina; Tegetmeyer, Halina E

    2012-01-01

    So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population. In the present study eight metagenomic samples from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to existing algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a 100 times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt).

  8. The binning of metagenomic contigs for microbial physiology of mixed cultures

    Directory of Open Access Journals (Sweden)

    Marc eStrous

    2012-12-01

    Full Text Available So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population.In the present study eight metagenomic samples originating from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to exisiting algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a hunderd times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt.

  9. CSAR-web: a web server of contig scaffolding using algebraic rearrangements.

    Science.gov (United States)

    Chen, Kun-Tze; Lu, Chin Lung

    2018-05-04

    CSAR-web is a web-based tool that allows the users to efficiently and accurately scaffold (i.e. order and orient) the contigs of a target draft genome based on a complete or incomplete reference genome from a related organism. It takes as input a target genome in multi-FASTA format and a reference genome in FASTA or multi-FASTA format, depending on whether the reference genome is complete or incomplete, respectively. In addition, it requires the users to choose either 'NUCmer on nucleotides' or 'PROmer on translated amino acids' for CSAR-web to identify conserved genomic markers (i.e. matched sequence regions) between the target and reference genomes, which are used by the rearrangement-based scaffolding algorithm in CSAR-web to order and orient the contigs of the target genome based on the reference genome. In the output page, CSAR-web displays its scaffolding result in a graphical mode (i.e. scalable dotplot) allowing the users to visually validate the correctness of scaffolded contigs and in a tabular mode allowing the users to view the details of scaffolds. CSAR-web is available online at http://genome.cs.nthu.edu.tw/CSAR-web.

  10. AAV-dominant negative tumor necrosis factor (DN-TNF gene transfer to the striatum does not rescue medium spiny neurons in the YAC128 mouse model of Huntington's disease.

    Directory of Open Access Journals (Sweden)

    Laura Taylor Alto

    Full Text Available CNS inflammation is a hallmark of neurodegenerative disease, and recent studies suggest that the inflammatory response may contribute to neuronal demise. In particular, increased tumor necrosis factor (TNF signaling is implicated in the pathology of both Parkinson's disease (PD and Alzheimer's disease (AD. We have previously shown that localized gene delivery of dominant negative TNF to the degenerating brain region can limit pathology in animal models of PD and AD. TNF is upregulated in Huntington's disease (HD, like in PD and AD, but it is unknown whether TNF signaling contributes to neuronal degeneration in HD. We used in vivo gene delivery to test whether selective reduction of soluble TNF signaling could attenuate medium spiny neuron (MSN degeneration in the YAC128 transgenic (TG mouse model of Huntington's disease (HD. AAV vectors encoding cDNA for dominant-negative tumor necrosis factor (DN-TNF or GFP (control were injected into the striatum of young adult wild type WT and YAC128 TG mice and achieved 30-50% target coverage. Expression of dominant negative TNF protein was confirmed immunohistologically and biochemically and was maintained as mice aged to one year, but declined significantly over time. However, the extent of striatal DN-TNF gene transfer achieved in our studies was not sufficient to achieve robust effects on neuroinflammation, rescue degenerating MSNs or improve motor function in treated mice. Our findings suggest that alternative drug delivery strategies should be explored to determine whether greater target coverage by DN-TNF protein might afford some level of neuroprotection against HD-like pathology and/or that soluble TNF signaling may not be the primary driver of striatal neuroinflammation and MSN loss in YAC128 TG mice.

  11. Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

    Energy Technology Data Exchange (ETDEWEB)

    Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

    1996-11-01

    Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

  12. Educational NASA Computational and Scientific Studies (enCOMPASS)

    Science.gov (United States)

    Memarsadeghi, Nargess

    2013-01-01

    Educational NASA Computational and Scientific Studies (enCOMPASS) is an educational project of NASA Goddard Space Flight Center aimed at bridging the gap between computational objectives and needs of NASA's scientific research, missions, and projects, and academia's latest advances in applied mathematics and computer science. enCOMPASS achieves this goal via bidirectional collaboration and communication between NASA and academia. Using developed NASA Computational Case Studies in university computer science/engineering and applied mathematics classes is a way of addressing NASA's goals of contributing to the Science, Technology, Education, and Math (STEM) National Objective. The enCOMPASS Web site at http://encompass.gsfc.nasa.gov provides additional information. There are currently nine enCOMPASS case studies developed in areas of earth sciences, planetary sciences, and astrophysics. Some of these case studies have been published in AIP and IEEE's Computing in Science and Engineering magazines. A few university professors have used enCOMPASS case studies in their computational classes and contributed their findings to NASA scientists. In these case studies, after introducing the science area, the specific problem, and related NASA missions, students are first asked to solve a known problem using NASA data and past approaches used and often published in a scientific/research paper. Then, after learning about the NASA application and related computational tools and approaches for solving the proposed problem, students are given a harder problem as a challenge for them to research and develop solutions for. This project provides a model for NASA scientists and engineers on one side, and university students, faculty, and researchers in computer science and applied mathematics on the other side, to learn from each other's areas of work, computational needs and solutions, and the latest advances in research and development. This innovation takes NASA science and

  13. CBrowse: a SAM/BAM-based contig browser for transcriptome assembly visualization and analysis.

    Science.gov (United States)

    Li, Pei; Ji, Guoli; Dong, Min; Schmidt, Emily; Lenox, Douglas; Chen, Liangliang; Liu, Qi; Liu, Lin; Zhang, Jie; Liang, Chun

    2012-09-15

    To address the impending need for exploring rapidly increased transcriptomics data generated for non-model organisms, we developed CBrowse, an AJAX-based web browser for visualizing and analyzing transcriptome assemblies and contigs. Designed in a standard three-tier architecture with a data pre-processing pipeline, CBrowse is essentially a Rich Internet Application that offers many seamlessly integrated web interfaces and allows users to navigate, sort, filter, search and visualize data smoothly. The pre-processing pipeline takes the contig sequence file in FASTA format and its relevant SAM/BAM file as the input; detects putative polymorphisms, simple sequence repeats and sequencing errors in contigs and generates image, JSON and database-compatible CSV text files that are directly utilized by different web interfaces. CBowse is a generic visualization and analysis tool that facilitates close examination of assembly quality, genetic polymorphisms, sequence repeats and/or sequencing errors in transcriptome sequencing projects. CBrowse is distributed under the GNU General Public License, available at http://bioinfolab.muohio.edu/CBrowse/ liangc@muohio.edu or liangc.mu@gmail.com; glji@xmu.edu.cn Supplementary data are available at Bioinformatics online.

  14. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

  15. Physical mapping of a commonly deleted region, the site of a candidate tumor suppressor gene, at 12q22 in human male germ cell tumors

    Energy Technology Data Exchange (ETDEWEB)

    Murty, V.V.V.S.; Bosl, G.J.; Chaganti, R.S.K. [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)] [and others

    1996-08-01

    A candidate tumor suppressor gene (TSG) site at 12q22 characterized by a high frequency of loss of heterozygosity (LOH) and a homozygous deletion has previously (LOH) and a homozygous deletion has previously been reported in human male germ cell tumors (GCTs). In a detailed deletion mapping analysis of 67 normal-tumor DNAs utilizing 20 polymorphic markers mapped to 12q22-q24, we identified the limits of the minimal region of deletion at 12q22 between D12S377 (priximal) and D12S296 (distal). We have constructed a YAC contig map of a 3-cM region of this band between the proximal marker D12S101 and the distal marker D12S346, which contained the minimal region of deletion in GCTs. The map is composed of 53 overlapping YACs and 3 cosmids onto which 25 polymorphic and nonpolymorphic sequence-tagged sites (STSs) were placed in a unique order. The size of the minimal region of deletion was approximately 2 Mb from overlapping, nonchimeric YACs that spanned the region. We also developed a radiation hybrid (RH) map of the region between D12S101 and D12S346 containing 17 loci. The consensus order developed by RH mapping is in good agreement with the YAC STS-content map order. The RH map estimated the distance between D12S101 and D12S346 to be 246 cR{sub 8000} and the minimal region of deletion to be 141 cR{sub 8000}. In addition, four genes that were previously mapped to 12q22 have been excluded as candidate genes. The leads gained from the deletion mapping and physical maps should expedite the isolation and characterization of the TSG at 12q22. 35 refs., 4 figs., 2 tabs.

  16. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-06-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se agregó benzoato de sodio, metabisulfito de sodio y ácido cítrico. Se desarrolló un dulce tipo pan. Se registró la evolución de temperatura durante la cocción. Se empacó y envasó el dulce en bandejas. Se analizaron parámetros de textura principales y secundarios. La formulación que alcanzó valores de textura similares a la referencia fue: 0,48% de agar-agar; 12% de sacarosa; 17% de glucosa; 23% de agua; 996,75 ppm de metabisulfito; 498,50 ppm de ácido cítrico y 1435,7 ppm de benzoato de sodio. Se realizó una prueba sensorial a través de la evaluación de los parámetros más representativos de la textura, utilizando para ello una escala hedónica, determinando la aceptación de la formulación seleccionada.O yacón (Smallanthus sonchifolius é um tubérculo andino cultivado nas encostas Dos Andes. É uma planta perene que chega a sua maduração entre 6 meses e 1 ano. Este trabalho propõe a formulação de um produto alimentício a partir do yacón agregando solutos: glicose, sacarose e combinação de barreiras de estresse. Estudou-se o efeito de gelificantes: ágar-ágar e arábica, em três concentrações 0.30, 0.41 e 0.48%. Agregou-se benzoato de sódio, metabisulfito de sódio, e ácido cítrico. Desenvolveu-se um doce tipo pão. Registrou-se a evolução da temperatura durate cozimento. Empacotou-se e envasou-se o doce em bandejas. Analisaram-se parâmetros de textura principais e secundários. A formulação que atingiu os

  17. Germ line transmission of a yeast artificial chromosome spanning the murine [alpha][sub 1](I) collagen locus

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, W.M.; Dausman, J.; Beard, C.; Jaenisch, R. (Massachusetts Inst. of Technology, Cambridge (United States)); Johnson, C.; Lawrence, J.B. (Univ. of Massachusetts Medical School, Worcester (United States))

    1993-03-26

    Molecular complementation of mutant phenotypes by transgenic technology is a potentially important tool for gene identification. A technology was developed to allow the transfer of a physically intact yeast artificial chromosome (YAC) into the germ line of the mouse. A purified 150-kilobase YAC encompassing the murine gene Col1a1 was efficiently introduced into embryonic stem (ES) cells via lipofection. Chimeric founder mice were derived from two transfected ES cell clones. These chimeras transmitted the full length transgene through the germ line, generating two transgenic mouse strains. Transgene expression was visualized as nascent transcripts in interphase nuclei and quantitated by ribonuclease protection analysis. Both assays indicated that the transgene was expressed at levels comparable to the endogenous collagen gene. 32 refs., 3 figs., 1 tab.

  18. Dicty_cDB: Contig-U11311-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A from... 58 6e-07 2 ( AM481444 ) Vitis vinifera contig VV78X144362.4, whole genome... 68 1e-06 1 ( AY604469 ) Prodonto...117 4e-27 AY604469_1( AY604469 |pid:none) Prodontorhabditis wirthi strain DF... 125 5e-27 ( P25202 ) RecName

  19. Dicty_cDB: Contig-U16102-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

  20. A theoretical framework for an access programme encompassing ...

    African Journals Online (AJOL)

    A theoretical framework for an access programme encompassing further education training: remedy for educational wastage? ... learners who have dropped out of school without completing their secondary-school education, there are the special needs of adult learners in the workplace that must be taken into consideration.

  1. Encompassing Sexual Medicine within Psychiatry: Pros and Cons

    Science.gov (United States)

    Segraves, Robert Taylor

    2010-01-01

    Objective: This article examines the positive and negative aspects of psychiatry encompassing sexual medicine within its purview. Methods: MEDLINE searches for the period between 1980 to the present were performed with the terms "psychiatry," "sexual medicine," and "sexual dysfunction." In addition, sexual medicine texts were reviewed for chapters…

  2. Sequence analysis and transcript identification within 1.5 MB of DNA deleted together with the NDP and MAO genes in atypical Norrie disease patients presenting with a profound phenotype.

    Science.gov (United States)

    Suárez-Merino, B; Bye, J; McDowall, J; Ross, M; Craig, I W

    2001-06-01

    Mutations at the Norrie disease gene locus, NDP, manifest in a broad range of defects. These range from a relatively mild, late-onset, exudative vitreoretinopathy to congenital blindness and sensorineural deafness combined, in some cases, with mental retardation. In addition, extensive deletions involving the NDP locus, located at Xp11.3, the adjacent monoamine oxidadase genes MAOA and MAOB, and additional material, result in a more severe pattern of symptoms. The phenotypes include all or some of the following; mental retardation, involuntary movements, hypertensive crises and hypogonadism. We extended an existing YAC contig to embrace the boundaries of three of the largest deletions and converted this into four PAC contigs. Computer analysis and experimental data have resulted in the identification of several putative loci, including a phosphatase inhibitor 2-like gene (dJ154.1) and a 250-bp sequence which resembles a homeobox domain (dA113.3), 1.2 Mb and 400 kb respectively from the MAO/NDP cluster. The pattern of expression of dJ154.1 suggests that it may represent an important factor contributing to the complex phenotypes of these deletion patients. Hum Mutat 17:523, 2001. Copyright 2001 Wiley-Liss, Inc.

  3. A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

    Energy Technology Data Exchange (ETDEWEB)

    Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

    1996-04-15

    We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

  4. INE: a rice genome database with an integrated map view.

    Science.gov (United States)

    Sakata, K; Antonio, B A; Mukai, Y; Nagasaki, H; Sakai, Y; Makino, K; Sasaki, T

    2000-01-01

    The Rice Genome Research Program (RGP) launched a large-scale rice genome sequencing in 1998 aimed at decoding all genetic information in rice. A new genome database called INE (INtegrated rice genome Explorer) has been developed in order to integrate all the genomic information that has been accumulated so far and to correlate these data with the genome sequence. A web interface based on Java applet provides a rapid viewing capability in the database. The first operational version of the database has been completed which includes a genetic map, a physical map using YAC (Yeast Artificial Chromosome) clones and PAC (P1-derived Artificial Chromosome) contigs. These maps are displayed graphically so that the positional relationships among the mapped markers on each chromosome can be easily resolved. INE incorporates the sequences and annotations of the PAC contig. A site on low quality information ensures that all submitted sequence data comply with the standard for accuracy. As a repository of rice genome sequence, INE will also serve as a common database of all sequence data obtained by collaborating members of the International Rice Genome Sequencing Project (IRGSP). The database can be accessed at http://www. dna.affrc.go.jp:82/giot/INE. html or its mirror site at http://www.staff.or.jp/giot/INE.html

  5. Physical mapping of the Bloom syndrome region by the identification of YAC and P1 clones from human chromosome 15 band q26.1

    Energy Technology Data Exchange (ETDEWEB)

    Straughen, J.; Groden, J. [Univ. of Cincinnati College of Medicine, OH (United States); Ciocci, S. [New York Blood Center, NY (United States)] [and others

    1996-07-01

    The gene for Bloom syndrome (BLM) has been mapped to human chromosome 15 band q26.1 by homozygosity mapping. Further refinement of the location of BLM has relied upon linkage-disequilibrium mapping and somatic intragenic recombination. In combination with these mapping approaches and to identify novel DNA markers and probes for the BLM candidate region, a contiguous representation of the 2-Mb region that contains the BLM gene was generated and is presented here. YAC and P1 clones from the region have been identified and ordered by using previously available genetic markers in the region along with newly developed sequence-tagged sites from radiation-restriction map of the 2-Mb region that allowed estimation of the distance between polymorphic microsatellite loci is also reported. This map and the DNA markers derived from it were instrumental in the recent identification of the BLM gene. 25 refs., 3 figs., 3 tabs.

  6. Physical mapping in highly heterozygous genomes: a physical contig map of the Pinot Noir grapevine cultivar

    Directory of Open Access Journals (Sweden)

    Jurman Irena

    2010-03-01

    Full Text Available Abstract Background Most of the grapevine (Vitis vinifera L. cultivars grown today are those selected centuries ago, even though grapevine is one of the most important fruit crops in the world. Grapevine has therefore not benefited from the advances in modern plant breeding nor more recently from those in molecular genetics and genomics: genes controlling important agronomic traits are practically unknown. A physical map is essential to positionally clone such genes and instrumental in a genome sequencing project. Results We report on the first whole genome physical map of grapevine built using high information content fingerprinting of 49,104 BAC clones from the cultivar Pinot Noir. Pinot Noir, as most grape varieties, is highly heterozygous at the sequence level. This resulted in the two allelic haplotypes sometimes assembling into separate contigs that had to be accommodated in the map framework or in local expansions of contig maps. We performed computer simulations to assess the effects of increasing levels of sequence heterozygosity on BAC fingerprint assembly and showed that the experimental assembly results are in full agreement with the theoretical expectations, given the heterozygosity levels reported for grape. The map is anchored to a dense linkage map consisting of 994 markers. 436 contigs are anchored to the genetic map, covering 342 of the 475 Mb that make up the grape haploid genome. Conclusions We have developed a resource that makes it possible to access the grapevine genome, opening the way to a new era both in grape genetics and breeding and in wine making. The effects of heterozygosity on the assembly have been analyzed and characterized by using several complementary approaches which could be easily transferred to the study of other genomes which present the same features.

  7. Genome scan identifies a locus affecting gamma-globin expression in human beta-cluster YAC transgenic mice

    Energy Technology Data Exchange (ETDEWEB)

    Lin, S.D.; Cooper, P.; Fung, J.; Weier, H.U.G.; Rubin, E.M.

    2000-03-01

    Genetic factors affecting post-natal g-globin expression - a major modifier of the severity of both b-thalassemia and sickle cell anemia, have been difficult to study. This is especially so in mice, an organism lacking a globin gene with an expression pattern equivalent to that of human g-globin. To model the human b-cluster in mice, with the goal of screening for loci affecting human g-globin expression in vivo, we introduced a human b-globin cluster YAC transgene into the genome of FVB mice . The b-cluster contained a Greek hereditary persistence of fetal hemoglobin (HPFH) g allele resulting in postnatal expression of human g-globin in transgenic mice. The level of human g-globin for various F1 hybrids derived from crosses between the FVB transgenics and other inbred mouse strains was assessed. The g-globin level of the C3HeB/FVB transgenic mice was noted to be significantly elevated. To map genes affecting postnatal g-globin expression, a 20 centiMorgan (cM) genome scan of a C3HeB/F VB transgenics [prime] FVB backcross was performed, followed by high-resolution marker analysis of promising loci. From this analysis we mapped a locus within a 2.2 cM interval of mouse chromosome 1 at a LOD score of 4.2 that contributes 10.4% of variation in g-globin expression level. Combining transgenic modeling of the human b-globin gene cluster with quantitative trait analysis, we have identified and mapped a murine locus that impacts on human g-globin expression in vivo.

  8. Dicty_cDB: Contig-U01541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

  9. Identification and characterization of a new multigene family in the human MHC: A candidate autoimmune disease susceptibility element (3.8-1)

    Energy Technology Data Exchange (ETDEWEB)

    Harris, J.M.; Venditti, C.P.; Chorney, M.J. [Pennsylvania State Univ. College of Medicine, Hershey, PA (United States)

    1994-09-01

    An association between idiopathic hemochromatosis (HFE) and the HLA-A3 locus has been previously well-established. In an attempt to identify potential HFE candidate genes, a genomic DNA fragment distal to the HLA-A9 breakpoint was used to screen a B cell cDNA library; a member (3.8-1) of a new multigene family, composed of five distinct genomic cross-reactive fragments, was identified. Clone 3.8-1 represents the 3{prime} end of 9.6 kb transcript which is expressed in multiple tissues including the spleen, thymus, lung and kidney. Sequencing and genome database analysis indicate that 3.8-1 is unique, with no homology to any known entries. The genomic residence of 3-8.1, defined by polymorphism analysis and physical mapping using YAC clones, appears to be absent from the genomes of higher primates, although four other cross-reactivities are maintained. The absence of this gene as well as other probes which map in the TNF to HLA-B interval, suggest that this portion of the human HMC, located between the Class I and Class III regions, arose in humans as the result of a post-speciation insertional event. The large size of the 3.8-1 gene and the possible categorization of 3.8-1 as a human-specific gene are significant given the genetic data that place an autoimmune susceptibility element for IDDM and myasthenia gravis in the precise region where this gene resides. In an attempt to isolate the 5{prime} end of this large transcript, we have constructed a cosmid contig which encompasses the genomic locus of this gene and are progressively isolating coding sequences by exon trapping.

  10. Production and reception of meaningful sound in Foville's 'encompassing convolution'.

    Science.gov (United States)

    Schiller, F

    1999-04-01

    In the history of neurology. Achille Louis Foville (1799-1879) is a name deserving to be remembered. In the course of time, his circonvolution d'enceinte of 1844 (surrounding the Sylvian fissure) became the 'convolution encompassing' every aspect of aphasiology, including amusia, ie., the localization in a coherent semicircle of semicircle of cerebral cortext serving the production and perception of language, song and instrumental music in health and disease.

  11. COCACOLA: binning metagenomic contigs using sequence COmposition, read CoverAge, CO-alignment and paired-end read LinkAge.

    Science.gov (United States)

    Lu, Yang Young; Chen, Ting; Fuhrman, Jed A; Sun, Fengzhu

    2017-03-15

    The advent of next-generation sequencing technologies enables researchers to sequence complex microbial communities directly from the environment. Because assembly typically produces only genome fragments, also known as contigs, instead of an entire genome, it is crucial to group them into operational taxonomic units (OTUs) for further taxonomic profiling and down-streaming functional analysis. OTU clustering is also referred to as binning. We present COCACOLA, a general framework automatically bin contigs into OTUs based on sequence composition and coverage across multiple samples. The effectiveness of COCACOLA is demonstrated in both simulated and real datasets in comparison with state-of-art binning approaches such as CONCOCT, GroopM, MaxBin and MetaBAT. The superior performance of COCACOLA relies on two aspects. One is using L 1 distance instead of Euclidean distance for better taxonomic identification during initialization. More importantly, COCACOLA takes advantage of both hard clustering and soft clustering by sparsity regularization. In addition, the COCACOLA framework seamlessly embraces customized knowledge to facilitate binning accuracy. In our study, we have investigated two types of additional knowledge, the co-alignment to reference genomes and linkage of contigs provided by paired-end reads, as well as the ensemble of both. We find that both co-alignment and linkage information further improve binning in the majority of cases. COCACOLA is scalable and faster than CONCOCT, GroopM, MaxBin and MetaBAT. The software is available at https://github.com/younglululu/COCACOLA . fsun@usc.edu. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

  12. Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barley (¤Hordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Jahoor, A.

    2002-01-01

    homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...... gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...

  13. Human Chromosome 21: Mapping of the chromosomes and cloning of cDNAs

    Energy Technology Data Exchange (ETDEWEB)

    Antonarakis, S.E.

    1991-09-01

    The objective of the research funded by DOE grant DE-FG02-89ER60857 from 6/15/89 to 8/31/91 was to contribute to the physical mapping of human chromosome 21 (HC21) by cloning large fragments of DNA into Yeast Artificial Chromosomes (YACs) and identify YACs that map on HC21. A total of 54 sequence tagged sites (STS) have been developed and mapped in our laboratory to HC21 and can be used as initial reference points for YAC identification and construction of overlapping clones. A small YAC library was constructed which is HC21 specific. DNA from somatic cell hybrid WAV17 or from flow-sorted HC21 was partially digested with EcoRI, ligated into vectors PJS97, PJS98, and YACs have been obtained with average size insert of more than 300 kb. This library has been deposited in D. Patterson's lab for the Joint YAC screening effort. Additional YAC libraries from ICI Pharmaceuticals or from Los Alamos National Laboratories have been screened with several STS and positive YACs have been identified. Work in progress includes screening of YAC libraries in order to construct overlapping clones, characterization of the cloning ends of YACs, characterization of additional STS and cloning of HC21 specific cDNAs. 15 refs., 2 figs., 5 tabs.

  14. Four-dimensional Hooke's law can encompass linear elasticity and inertia

    International Nuclear Information System (INIS)

    Antoci, S.; Mihich, L.

    1999-01-01

    The question is examined whether the formally straightforward extension of Hooke's time-honoured stress-strain relation to the four dimensions of special and of general relativity can make physical sense. The four-dimensional Hooke law is found able to account for the inertia of matter; in the flat-space, slow-motion approximation the field equations for the displacement four-vector field ξ i can encompass both linear elasticity and inertia. In this limit one just recovers the equations of motion of the classical theory of elasticity

  15. L’Anaphore associative: contigüité métonymique

    Directory of Open Access Journals (Sweden)

    Gemma Peña Martínez

    2008-04-01

    Full Text Available Cet article porte sur les rapports de contigüité exigés lors de la résolution des anaphores associatives. Il s’agit en général de relations métonymiques, car les différents rapports, à caractère notamment socioculturel, entre référent et marque anaphorique convergent dans un même cadre conceptuel, se faisant écho d’éléments ou caractéristiques du même domaine cognitif. L’anaphore associative reprenant ainsi un attribut concret du référent, nous envisageons donc une classification de ces marques anaphoriques d’après des rapports métonymiques, tels que partie à tout, objet à matière et caractéristique ou propriété à objet.

  16. Gene content and organization of a 281-kbp contig from the genome of the extremely thermophilic archaeon, Sulfolobus solfataricus P2

    NARCIS (Netherlands)

    Charlebois, R.; Confalonieri, F.; Curtis, B.; Doolittle, W.F.; Duguet, M.; Erauso, G.; Faguy, D.; Gaasterland, T.; Garrett, R.A.; Gordon, P.; Kozera, C.; Medina, N.; Oost, van der J.; Peng, X.; Ragan, M.; She, Q.; Singh, R.K.

    2000-01-01

    The sequence of a 281-kbp contig from the crenarchaeote Sulfolobus solfataricus P2 was determined and analysed. Notable features in this region include 29 ribosomal protein genes, 12 tRNA genes (four of which contain archaeal-type introns), operons encoding enzymes of histidine biosynthesis,

  17. Primary proton and helium spectra at energy range from 50 TeV to 1015 eV observed with the new Tibet AS core detector array

    Directory of Open Access Journals (Sweden)

    Huang Jing

    2013-06-01

    Full Text Available A new EAS hybrid experiment has been designed by constructing a YAC (Yangbajing Air shower Core detector array inside the existing Tibet-III air shower array. The first step of YAC, called “YAC-I” has been successfully carried out in 2009–2010 together with Tibet-III air-shower array. YAC-II has also been operated from 2011. Preliminary results of YAC-I and performance of YAC-II are presented in this paper. The primary proton and helium spectra at energy range from50 TeV to 1015 eV derived from YAC-I data based on QGSJET2 and SIBYLL2.1 are reported. The obtained P+He spectrum is smoothly connected with directobservation data below 100 TeV and also with our previously reported results at higher energies within statistical error s. Based on these results and the sharp kneeof all-particle energy spectrum observed by our experiment, the possible origin of the sharp knee is discussed. See the published papers.

  18. Full-length huntingtin levels modulate body weight by influencing insulin-like growth factor 1 expression

    DEFF Research Database (Denmark)

    Pouladi, Mahmoud A; Xie, Yuanyun; Skotte, Niels Henning

    2010-01-01

    of the IGF-1 pathway in mediating the effect of htt on body weight. IGF-1 expression was examined in transgenic mouse lines expressing different levels of FL wild-type (WT) htt (YAC18 mice), FL mutant htt (YAC128 and BACHD mice) and truncated mutant htt (shortstop mice). We demonstrate that htt influences...... body weight by modulating the IGF-1 pathway. Plasma IGF-1 levels correlate with body weight and htt levels in the transgenic YAC mice expressing human htt. The effect of htt on IGF-1 expression is independent of CAG size. No effect on body weight is observed in transgenic YAC mice expressing...... and decreases the body weight of YAC128 animals to WT levels. Furthermore, given the ubiquitous expression of IGF-1 within the central nervous system, we also examined the impact of FL htt levels on IGF-1 expression in different regions of the brain, including the striatum, cerebellum of YAC18, YAC128...

  19. Radiation hybrid mapping of human chromosome 18

    International Nuclear Information System (INIS)

    Francke, U.; Moon, A.J.; Chang, E.; Foellmer, B.; Strauss, B.; Haschke, A.; Chihlin Hsieh; Geigl, E.M.; Welch, S.

    1990-01-01

    The authors have generated a Chinese hamster V79/380-6 HPRT minus x human leukocyte hybrid cell line (18/V79) with chromosome 18 as the only human chromosome that is retained at high frequency without specific selection. Hybrid cells were selected in HAT medium, and 164 individual colonies were isolated. Of 110 colonies screened for human DNA by PCR amplification using a primer specific for human Alu repeats 67 (61%) were positive. These were expanded in culture for large-scale DNA preparations. Retesting expanded clones by PCR with Alu and LINE primers has revealed unique patterns of amplification products. In situ hybridization of biotin labelled total human DNA to metaphase spreads from various hybrids revealed the presence of one or more human DNA fragments integrated in hamster chromosomes. The authors have generated a resource that should allow the construction of a radiation map, to be compared with the YAC contig map also under construction in their laboratory

  20. Genomic Anatomy of a Premier Major Histocompatibility Complex Paralogous Region on Chromosome 1q21–q22

    Science.gov (United States)

    Shiina, Takashi; Ando, Asako; Suto, Yumiko; Kasai, Fumio; Shigenari, Atsuko; Takishima, Nobusada; Kikkawa, Eri; Iwata, Kyoko; Kuwano, Yuko; Kitamura, Yuka; Matsuzawa, Yumiko; Sano, Kazumi; Nogami, Masahiro; Kawata, Hisako; Li, Suyun; Fukuzumi, Yasuhito; Yamazaki, Masaaki; Tashiro, Hiroyuki; Tamiya, Gen; Kohda, Atsushi; Okumura, Katsuzumi; Ikemura, Toshimichi; Soeda, Eiichi; Mizuki, Nobuhisa; Kimura, Minoru; Bahram, Seiamak; Inoko, Hidetoshi

    2001-01-01

    Human chromosomes 1q21–q25, 6p21.3–22.2, 9q33–q34, and 19p13.1–p13.4 carry clusters of paralogous loci, to date best defined by the flagship 6p MHC region. They have presumably been created by two rounds of large-scale genomic duplications around the time of vertebrate emergence. Phylogenetically, the 1q21–25 region seems most closely related to the 6p21.3 MHC region, as it is only the MHC paralogous region that includes bona fide MHC class I genes, the CD1 and MR1 loci. Here, to clarify the genomic structure of this model MHC paralogous region as well as to gain insight into the evolutionary dynamics of the entire quadriplication process, a detailed analysis of a critical 1.7 megabase (Mb) region was performed. To this end, a composite, deep, YAC, BAC, and PAC contig encompassing all five CD1 genes and linking the centromeric +P5 locus to the telomeric KRTC7 locus was constructed. Within this contig a 1.1-Mb BAC and PAC core segment joining CD1D to FCER1A was fully sequenced and thoroughly analyzed. This led to the mapping of a total of 41 genes (12 expressed genes, 12 possibly expressed genes, and 17 pseudogenes), among which 31 were novel. The latter include 20 olfactory receptor (OR) genes, 9 of which are potentially expressed. Importantly, CD1, SPTA1, OR, and FCERIA belong to multigene families, which have paralogues in the other three regions. Furthermore, it is noteworthy that 12 of the 13 expressed genes in the 1q21–q22 region around the CD1 loci are immunologically relevant. In addition to CD1A-E, these include SPTA1, MNDA, IFI-16, AIM2, BL1A, FY and FCERIA. This functional convergence of structurally unrelated genes is reminiscent of the 6p MHC region, and perhaps represents the emergence of yet another antigen presentation gene cluster, in this case dedicated to lipid/glycolipid antigens rather than antigen-derived peptides. [The nucleotide sequence data reported in this paper have been submitted to the DDBJ, EMBL, and GenBank databases under

  1. From Balancing the Numbers to an Encompassing Business Case

    DEFF Research Database (Denmark)

    Labucay, Inéz

    2013-01-01

    and Horwitz 2007). The focus of the paper is on further developing and building on theoretical concepts of diversity. It also establishes links to non-mainstream theories like social network theory. After a short introduction to the model, the three stages of the model (Diversity concept, Diversity goals......, Diversity measurement) are presented in more detail, followed by a summary and conclusion on its applicability and relevance for diversity practitioners. An outlook on further research ensues. The paper aims at delineating an approach to building a more encompassing Business Case.......The Business Case of Diversity Management has evolved as the predominant concept underlying many diversity studies and practices in the field. In this line of reasoning, corporate bottom line results like an increased return on investment (ROI) are partially explained by the existence of Diversity...

  2. An all-encompassing study of an authentic court setting

    DEFF Research Database (Denmark)

    Christensen, Tina Paulsen

    necessarily be judged from a particular (subjective) perspective on the communicative event. In this paper I shall address the issue of interpreting quality in an all-encompassing perspective on an authentic Danish courtroom setting. The aim of the empirical case-based survey is unlike that of most existing...... but homogeneous. Several empirical studies, which have been carried out on this subject, have shown that different user groups have different expectations about the interpreted communicative event, which ceteris paribus means that user expectations are heterogeneous. The question is, whether the heterogeneity......, which are to be considered as expectancy norms projected and recommended by the specific legal system. In order to be able to answer this question, a questionnaire-based survey on specific quality criteria has been conducted within an authentic interpreter-mediated court setting, because, according...

  3. Empowering Youth to Take Charge of School Wellness

    Science.gov (United States)

    Hughes, Luanne J.; Savoca, LeeAnne; Grenci, Alexandra

    2015-01-01

    Youth Advisory Councils (YACs) ensure that students are represented in school wellness discussions. YACs empower students to present ideas, insights, and input on nutrition and physical activity; work alongside peers to assess wellness needs; and develop recommendations for enhancing/expanding the school wellness environment. YACs provide a…

  4. Construction and characterization of a yeast artificial chromosome library containing seven haploid human genome equivalents

    International Nuclear Information System (INIS)

    Albertsen, H.M.; Abderrahim, H.; Cann, H.M.; Dausset, J.; Le Paslier, D.; Cohen, D.

    1990-01-01

    Prior to constructing a library of yeast artificial chromosomes (YACs) containing very large human DNA fragments, the authors performed a series of preliminary experiments aimed at developing a suitable protocol. They found an inverse relationship between YAC insert size and transformation efficiency. Evidence of occasional rearrangement within YAC inserts was found resulting in clonally stable internal deletions or clonally unstable size variations. A protocol was developed for preparative electrophoretic enrichment of high molecular mass human DNA fragments from partial restriction digests and ligation with the YAC vector in agarose. A YAC library has been constructed from large fragments of DNA from an Epstein-Barr virus-transformed human lymphoblastoid cell line. The library presently contains 50,000 clones, 95% of which are greater than 250 kilobase pairs in size. The mean YAC size of the library, calculated from 132 randomly isolated clones, is 430 kilobase pairs. The library thus contains the equivalent of approximately seven haploid human genomes

  5. Área foliar del yacón (Smallanthus sonchifolius (Poep. & Endl. H. Rob. estimada mediante método indirecto.

    Directory of Open Access Journals (Sweden)

    Juan Francisco Seminario-Cunya

    2016-12-01

    Full Text Available El objetivo de este trabajo fue estimar el área foliar de ocho morfotipos de yacón mediante análisis de regresión lineal simple. La investigación se realizó entre los años 2014 y 2015, en el Programa de Raíces y Tubérculos Andinos de la Universidad Nacional de Cajamarca, Perú (7° 10’ 00’’ S, 78° 30’00’’ W, 2650 msnm. Se tomaron cien hojas de cada morfotipo, incluyendo hojas de los estratos basal, medio y terminal de plantas en plena oración. Las siluetas de las hojas frescas se dibujaron en papel y se midió el largo (L y ancho mayor de la lámina (W. El área medida (o real de la lámina se determinó con planímetro digital. Con el área medida (variable dependiente y los valores de largo, ancho, largo al cuadrado, ancho al cuadrado, largo x ancho y largo/ancho (como variables independientes, se realizó el análisis de regresión para cada morfotipo. En todos los morfotipos, excepto en dos, las mejores ecuaciones para estimar el área foliar, fueron aquellas en donde intervino el producto de L x W. La ecuación A= 20,41 + 0,4167 (L x W (r2 = 0,89 permitió estimar el área foliar de los ocho morfotipos en conjunto. El área del peciolo de los morfotipos en estudio signi có 15%, respecto del área total de la hoja.

  6. Genetic and physical analysis of a YAC contig spanning the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.; Hille, J.; Nijkamp, H.J.J.

    1998-01-01

    The Alternaria stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped on

  7. Genetic and physical analysis of a YAC contig spannig the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.J.F.; Hille, J.; Nijkamp, H.J.J.

    1999-01-01

    The Alternaria in stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped

  8. Automated integration of genomic physical mapping data via parallel simulated annealing

    Energy Technology Data Exchange (ETDEWEB)

    Slezak, T.

    1994-06-01

    The Human Genome Center at the Lawrence Livermore National Laboratory (LLNL) is nearing closure on a high-resolution physical map of human chromosome 19. We have build automated tools to assemble 15,000 fingerprinted cosmid clones into 800 contigs with minimal spanning paths identified. These islands are being ordered, oriented, and spanned by a variety of other techniques including: Fluorescence Insitu Hybridization (FISH) at 3 levels of resolution, ECO restriction fragment mapping across all contigs, and a multitude of different hybridization and PCR techniques to link cosmid, YAC, AC, PAC, and Pl clones. The FISH data provide us with partial order and distance data as well as orientation. We made the observation that map builders need a much rougher presentation of data than do map readers; the former wish to see raw data since these can expose errors or interesting biology. We further noted that by ignoring our length and distance data we could simplify our problem into one that could be readily attacked with optimization techniques. The data integration problem could then be seen as an M x N ordering of our N cosmid clones which ``intersect`` M larger objects by defining ``intersection`` to mean either contig/map membership or hybridization results. Clearly, the goal of making an integrated map is now to rearrange the N cosmid clone ``columns`` such that the number of gaps on the object ``rows`` are minimized. Our FISH partially-ordered cosmid clones provide us with a set of constraints that cannot be violated by the rearrangement process. We solved the optimization problem via simulated annealing performed on a network of 40+ Unix machines in parallel, using a server/client model built on explicit socket calls. For current maps we can create a map in about 4 hours on the parallel net versus 4+ days on a single workstation. Our biologists are now using this software on a daily basis to guide their efforts toward final closure.

  9. ScaffoldScaffolder: solving contig orientation via bidirected to directed graph reduction.

    Science.gov (United States)

    Bodily, Paul M; Fujimoto, M Stanley; Snell, Quinn; Ventura, Dan; Clement, Mark J

    2016-01-01

    The contig orientation problem, which we formally define as the MAX-DIR problem, has at times been addressed cursorily and at times using various heuristics. In setting forth a linear-time reduction from the MAX-CUT problem to the MAX-DIR problem, we prove the latter is NP-complete. We compare the relative performance of a novel greedy approach with several other heuristic solutions. Our results suggest that our greedy heuristic algorithm not only works well but also outperforms the other algorithms due to the nature of scaffold graphs. Our results also demonstrate a novel method for identifying inverted repeats and inversion variants, both of which contradict the basic single-orientation assumption. Such inversions have previously been noted as being difficult to detect and are directly involved in the genetic mechanisms of several diseases. http://bioresearch.byu.edu/scaffoldscaffolder. paulmbodily@gmail.com Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  10. Enhanced Store-Operated Calcium Entry Leads to Striatal Synaptic Loss in a Huntington's Disease Mouse Model.

    Science.gov (United States)

    Wu, Jun; Ryskamp, Daniel A; Liang, Xia; Egorova, Polina; Zakharova, Olga; Hung, Gene; Bezprozvanny, Ilya

    2016-01-06

    In Huntington's disease (HD), mutant Huntingtin (mHtt) protein causes striatal neuron dysfunction, synaptic loss, and eventual neurodegeneration. To understand the mechanisms responsible for synaptic loss in HD, we developed a corticostriatal coculture model that features age-dependent dendritic spine loss in striatal medium spiny neurons (MSNs) from YAC128 transgenic HD mice. Age-dependent spine loss was also observed in vivo in YAC128 MSNs. To understand the causes of spine loss in YAC128 MSNs, we performed a series of mechanistic studies. We previously discovered that mHtt protein binds to type 1 inositol (1,4,5)-trisphosphate receptor (InsP3R1) and increases its sensitivity to activation by InsP3. We now report that the resulting increase in steady-state InsP3R1 activity reduces endoplasmic reticulum (ER) Ca(2+) levels. Depletion of ER Ca(2+) leads to overactivation of the neuronal store-operated Ca(2+) entry (nSOC) pathway in YAC128 MSN spines. The synaptic nSOC pathway is controlled by the ER resident protein STIM2. We discovered that STIM2 expression is elevated in aged YAC128 striatal cultures and in YAC128 mouse striatum. Knock-down of InsP3R1 expression by antisense oligonucleotides or knock-down or knock-out of STIM2 resulted in normalization of nSOC and rescue of spine loss in YAC128 MSNs. The selective nSOC inhibitor EVP4593 was identified in our previous studies. We now demonstrate that EVP4593 reduces synaptic nSOC and rescues spine loss in YAC128 MSNs. Intraventricular delivery of EVP4593 in YAC128 mice rescued age-dependent striatal spine loss in vivo. Our results suggest EVP4593 and other inhibitors of the STIM2-dependent nSOC pathway as promising leads for HD therapeutic development. In Huntington's disease (HD) mutant Huntingtin (mHtt) causes early corticostriatal synaptic dysfunction and eventual neurodegeneration of medium spine neurons (MSNs) through poorly understood mechanisms. We report here that corticostriatal cocultures prepared from

  11. Scaffold filling, contig fusion and comparative gene order inference

    Directory of Open Access Journals (Sweden)

    Rounsley Steve

    2010-06-01

    Full Text Available Abstract Background There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Results Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. Conclusions The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  12. Scaffold filling, contig fusion and comparative gene order inference.

    Science.gov (United States)

    Muñoz, Adriana; Zheng, Chunfang; Zhu, Qian; Albert, Victor A; Rounsley, Steve; Sankoff, David

    2010-06-04

    There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  13. A post-assembly genome-improvement toolkit (PAGIT) to obtain annotated genomes from contigs.

    Science.gov (United States)

    Swain, Martin T; Tsai, Isheng J; Assefa, Samual A; Newbold, Chris; Berriman, Matthew; Otto, Thomas D

    2012-06-07

    Genome projects now produce draft assemblies within weeks owing to advanced high-throughput sequencing technologies. For milestone projects such as Escherichia coli or Homo sapiens, teams of scientists were employed to manually curate and finish these genomes to a high standard. Nowadays, this is not feasible for most projects, and the quality of genomes is generally of a much lower standard. This protocol describes software (PAGIT) that is used to improve the quality of draft genomes. It offers flexible functionality to close gaps in scaffolds, correct base errors in the consensus sequence and exploit reference genomes (if available) in order to improve scaffolding and generating annotations. The protocol is most accessible for bacterial and small eukaryotic genomes (up to 300 Mb), such as pathogenic bacteria, malaria and parasitic worms. Applying PAGIT to an E. coli assembly takes ∼24 h: it doubles the average contig size and annotates over 4,300 gene models.

  14. Disease-toxicant interactions in manganese exposed Huntington disease mice: early changes in striatal neuron morphology and dopamine metabolism.

    Directory of Open Access Journals (Sweden)

    Jennifer L Madison

    Full Text Available YAC128 Huntington's disease (HD transgenic mice accumulate less manganese (Mn in the striatum relative to wild-type (WT littermates. We hypothesized that Mn and mutant Huntingtin (HTT would exhibit gene-environment interactions at the level of neurochemistry and neuronal morphology. Twelve-week-old WT and YAC128 mice were exposed to MnCl(2-4H(2O (50 mg/kg on days 0, 3 and 6. Striatal medium spiny neuron (MSN morphology, as well as levels of dopamine (DA and its metabolites (which are known to be sensitive to Mn-exposure, were analyzed at 13 weeks (7 days from initial exposure and 16 weeks (28 days from initial exposure. No genotype-dependent differences in MSN morphology were apparent at 13 weeks. But at 16 weeks, a genotype effect was observed in YAC128 mice, manifested by an absence of the wild-type age-dependent increase in dendritic length and branching complexity. In addition, genotype-exposure interaction effects were observed for dendritic complexity measures as a function of distance from the soma, where only YAC128 mice were sensitive to Mn exposure. Furthermore, striatal DA levels were unaltered at 13 weeks by genotype or Mn exposure, but at 16 weeks, both Mn exposure and the HD genotype were associated with quantitatively similar reductions in DA and its metabolites. Interestingly, Mn exposure of YAC128 mice did not further decrease DA or its metabolites versus YAC128 vehicle exposed or Mn exposed WT mice. Taken together, these results demonstrate Mn-HD disease-toxicant interactions at the onset of striatal dendritic neuropathology in YAC128 mice. Our results identify the earliest pathological change in striatum of YAC128 mice as being between 13 to 16 weeks. Finally, we show that mutant HTT suppresses some Mn-dependent changes, such as decreased DA levels, while it exacerbates others, such as dendritic pathology.

  15. End-to-end network models encompassing terrestrial, wireless, and satellite components

    Science.gov (United States)

    Boyarko, Chandler L.; Britton, John S.; Flores, Phil E.; Lambert, Charles B.; Pendzick, John M.; Ryan, Christopher M.; Shankman, Gordon L.; Williams, Ramon P.

    2004-08-01

    Development of network models that reflect true end-to-end architectures such as the Transformational Communications Architecture need to encompass terrestrial, wireless and satellite component to truly represent all of the complexities in a world wide communications network. Use of best-in-class tools including OPNET, Satellite Tool Kit (STK), Popkin System Architect and their well known XML-friendly definitions, such as OPNET Modeler's Data Type Description (DTD), or socket-based data transfer modules, such as STK/Connect, enable the sharing of data between applications for more rapid development of end-to-end system architectures and a more complete system design. By sharing the results of and integrating best-in-class tools we are able to (1) promote sharing of data, (2) enhance the fidelity of our results and (3) allow network and application performance to be viewed in the context of the entire enterprise and its processes.

  16. Report of the fifth international workshop on human X chromosome mapping

    Energy Technology Data Exchange (ETDEWEB)

    Willard, H.F.; Cremers, F.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Schlessinger, D.

    1994-12-31

    A high-quality integrated genetic and physical map of the X chromosome from telomere to telomere, based primarily on YACs formatted with probes and STSs, is increasingly close to reality. At the Fifth International X Chromosome Workshop, organized by A.M. Poustka and D. Schlessinger in Heidelberg, Germany, April 24--27, 1994, substantial progress was recorded on extension and refinement of the physical map, on the integration of genetic and cytogenetic data, on attempts to use the map to direct gene searches, and on nascent large-scale sequencing efforts. This report summarizes physical and genetic mapping information presented at the workshop and/or published since the reports of the fourth International X Chromosome Workshop. The principle aim of the workshop was to derive a consensus map of the chromosome, in terms of physical contigs emphasizing the location of genes and microsatellite markers. The resulting map is presented and updates previous versions. This report also updates the list of highly informative microsatellites. The text highlights the working state of the map, the genes known to reside on the X, and the progress toward integration of various types of data.

  17. Fine mapping of the EDA gene: A translocation breakpoint is associated with a CpG island that is transcribed

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Montonen, O. [Univ. of Helsinki (Finland)] [and others

    1996-01-01

    In order to identify the gene for human X-linked anhidrotic ectodermal dysplasia (EDA), a translocation breakpoint in a female with t(X;1)(q13.1;p36.3) and EDA (patient AK) was finely mapped. The EDA region contains five groups of rare-cutter restriction sites that define CpG islands. The two more centromeric of these islands are associated with transcripts of 3.5 kb and 1.8 kb. The third CpG island maps within <1 kb of the translocation breakpoint in patient AK, as indicated by a genomic rearrangement, and {approximately}100 kb centromeric from another previously mapped translocation breakpoint (patient AnLy). Northern analysis with a probe from this CpG island detected an {approximately}6-kb mRNA in several fetal tissues tested. An extended YAC contig of 1,200 kb with an average of fivefold coverage was constructed. The two most telomeric CpG islands map 350 kb telomeric of the two translocations. Taken together, the results suggest that the CpG island just proximal of the AK translocation breakpoint lies at the 5{prime} end of a candidate gene for EDA. 26 refs., 4 figs., 1 tab.

  18. Deletion of Xpter encompassing the SHOX gene and PAR1 region in familial patients with Leri-Weill Dyschondrosteosis syndrome.

    Science.gov (United States)

    Mutesa, L; Vanbellinghen, J F; Hellin, A C; Segers, K; Jamar, M; Pierquin, G; Bours, V

    2009-01-01

    Heterozygote deletions or mutations of pseudoautosomal 1 region (PAR1) encompassing the short stature homeobox-containing (SHOX) gene cause Leri-Weill Dyschondrosteosis (LWD), which is a dominantly inherited osteochondroplasia characterized by short stature with mesomelic shortening of the upper and lower limbs and Madelung deformity of the wrists. SHOX is expressed by both sex chromosomes in males and females and plays an important role in bone growth and development. Clinically, the LWD expression is variable and more severe in females than males due to sex differences in oestrogen levels. Here, we report two familial cases of LWD with a large Xp terminal deletion (approximately 943 kb) of distal PAR1 encompassing the SHOX gene. In addition, the proband had mental retardation which appeared to be from recessive inheritance in the family.

  19. A base composition analysis of natural patterns for the preprocessing of metagenome sequences.

    Science.gov (United States)

    Bonham-Carter, Oliver; Ali, Hesham; Bastola, Dhundy

    2013-01-01

    On the pretext that sequence reads and contigs often exhibit the same kinds of base usage that is also observed in the sequences from which they are derived, we offer a base composition analysis tool. Our tool uses these natural patterns to determine relatedness across sequence data. We introduce spectrum sets (sets of motifs) which are permutations of bacterial restriction sites and the base composition analysis framework to measure their proportional content in sequence data. We suggest that this framework will increase the efficiency during the pre-processing stages of metagenome sequencing and assembly projects. Our method is able to differentiate organisms and their reads or contigs. The framework shows how to successfully determine the relatedness between these reads or contigs by comparison of base composition. In particular, we show that two types of organismal-sequence data are fundamentally different by analyzing their spectrum set motif proportions (coverage). By the application of one of the four possible spectrum sets, encompassing all known restriction sites, we provide the evidence to claim that each set has a different ability to differentiate sequence data. Furthermore, we show that the spectrum set selection having relevance to one organism, but not to the others of the data set, will greatly improve performance of sequence differentiation even if the fragment size of the read, contig or sequence is not lengthy. We show the proof of concept of our method by its application to ten trials of two or three freshly selected sequence fragments (reads and contigs) for each experiment across the six organisms of our set. Here we describe a novel and computationally effective pre-processing step for metagenome sequencing and assembly tasks. Furthermore, our base composition method has applications in phylogeny where it can be used to infer evolutionary distances between organisms based on the notion that related organisms often have much conserved code.

  20. Study on bystander effect and associated mechanism mediated through culture medium

    International Nuclear Information System (INIS)

    Tu Xumin; Lei Suwen; Zhang Zhixing; Lv Huimin

    2005-01-01

    Objective: To study the bystander effect and associated mechanism mediated through the irradiated cell culture medium. Methods: Splenic natural killer (NK) cells were obtained from healthy male ICR strain mice. Culture medium irradiated with different doses of 60 Co γ-rays was used for culturing Yac-I lymphoma cells. The degree of injury of the latter by activated NK cells was observed. A part of the culture media were pretreated with 1% DMSO, a scavenger of reactive oxygen species (ROS), in order to investigate the possible mechanism of a radiation-induced bystander response. Results: Severer injury was induced in Yac-I cells cultured in the media pre-irradiated with different doses of γ-rays than that in Yac-I cells cultured in unirradiated medium, as shown by increased sensitivity to murine splenic NK cells (P<0.01). Culturing Yac-I cells in DMSO-pretreated medium considerably reduced the activation of NK cells, especially in 0.25 Gy and 0.5 Gy γ-irradiated media. Therefore, it can be expected that DMSO can partly suppress ROS-induced bystander effect. Conclusion: The irradiated culture medium of Yac-I cells can trigger bystander effect. ROS likely plays an important role in radiation-induced bystander effect that can be partly suppressed by pretreatment with DMSO. (authors)

  1. Sequencing of BAC pools by different next generation sequencing platforms and strategies

    Directory of Open Access Journals (Sweden)

    Scholz Uwe

    2011-10-01

    Full Text Available Abstract Background Next generation sequencing of BACs is a viable option for deciphering the sequence of even large and highly repetitive genomes. In order to optimize this strategy, we examined the influence of read length on the quality of Roche/454 sequence assemblies, to what extent Illumina/Solexa mate pairs (MPs improve the assemblies by scaffolding and whether barcoding of BACs is dispensable. Results Sequencing four BACs with both FLX and Titanium technologies revealed similar sequencing accuracy, but showed that the longer Titanium reads produce considerably less misassemblies and gaps. The 454 assemblies of 96 barcoded BACs were improved by scaffolding 79% of the total contig length with MPs from a non-barcoded library. Assembly of the unmasked 454 sequences without separation by barcodes revealed chimeric contig formation to be a major problem, encompassing 47% of the total contig length. Masking the sequences reduced this fraction to 24%. Conclusion Optimal BAC pool sequencing should be based on the longest available reads, with barcoding essential for a comprehensive assessment of both repetitive and non-repetitive sequence information. When interest is restricted to non-repetitive regions and repeats are masked prior to assembly, barcoding is non-essential. In any case, the assemblies can be improved considerably by scaffolding with non-barcoded BAC pool MPs.

  2. Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

    DEFF Research Database (Denmark)

    Basse, P; Hokland, P; Heron, I

    1988-01-01

    The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...... extent, the bone, skin, and muscle. The only organs that could arrest the LV-injected tumor cells were the lungs and the liver. In the lungs clearance of YAC-1 cells began immediately after the cells were arrested. However, the rate of clearance could be almost abrogated by pretreatment of the recipients...... with anti-asialo GM1 antiserum, which destroys most of the NK cells in vivo and strongly depresses the in vitro NK cell activity. In contrast, YAC-1 cells arrested in the liver were not cleared from this organ during the first 1-2 hours after arrest. After this delay clearance of the cells commenced...

  3. Dantrolene is neuroprotective in Huntington's disease transgenic mouse model

    Directory of Open Access Journals (Sweden)

    Chen Xi

    2011-11-01

    Full Text Available Abstract Background Huntington's disease (HD is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs. Our group has previously demonstrated that calcium (Ca2+ signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128. Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2 and spinocerebellar ataxia 3 (SCA3 mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. Results The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Conclusions Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that Ryan

  4. Dantrolene is neuroprotective in Huntington's disease transgenic mouse model.

    Science.gov (United States)

    Chen, Xi; Wu, Jun; Lvovskaya, Svetlana; Herndon, Emily; Supnet, Charlene; Bezprozvanny, Ilya

    2011-11-25

    Huntington's disease (HD) is a progressive neurodegenerative disorder caused by a polyglutamine expansion in the Huntingtin protein which results in the selective degeneration of striatal medium spiny neurons (MSNs). Our group has previously demonstrated that calcium (Ca2+) signaling is abnormal in MSNs from the yeast artificial chromosome transgenic mouse model of HD (YAC128). Moreover, we demonstrated that deranged intracellular Ca2+ signaling sensitizes YAC128 MSNs to glutamate-induced excitotoxicity when compared to wild type (WT) MSNs. In previous studies we also observed abnormal neuronal Ca2+ signaling in neurons from spinocerebellar ataxia 2 (SCA2) and spinocerebellar ataxia 3 (SCA3) mouse models and demonstrated that treatment with dantrolene, a ryanodine receptor antagonist and clinically relevant Ca2+ signaling stabilizer, was neuroprotective in experiments with these mouse models. The aim of the current study was to evaluate potential beneficial effects of dantrolene in experiments with YAC128 HD mouse model. The application of caffeine and glutamate resulted in increased Ca2+ release from intracellular stores in YAC128 MSN cultures when compared to WT MSN cultures. Pre-treatment with dantrolene protected YAC128 MSNs from glutamate excitotoxicty, with an effective concentration of 100 nM and above. Feeding dantrolene (5 mg/kg) twice a week to YAC128 mice between 2 months and 11.5 months of age resulted in significantly improved performance in the beam-walking and gait-walking assays. Neuropathological analysis revealed that long-term dantrolene feeding to YAC128 mice significantly reduced the loss of NeuN-positive striatal neurons and reduced formation of Httexp nuclear aggregates. Our results support the hypothesis that deranged Ca2+ signaling plays an important role in HD pathology. Our data also implicate the RyanRs as a potential therapeutic target for the treatment of HD and demonstrate that RyanR inhibitors and Ca2+ signaling stabilizers such as

  5. Fate of tumor cells injected into left ventricle of heart in BALB/c mice: role of natural killer cells

    DEFF Research Database (Denmark)

    Basse, P; Hokland, P; Heron, I

    1988-01-01

    The arrest, retention, and elimination (i.e., clearance) of radiolabeled YAC-1 lymphoma cells injected either iv or into the left ventricle (LV) of the heart were studied in male BALB/c mice, with special emphasis on the role of natural killer (NK) cells. After iv injection YAC-1 cells were...

  6. Detection of a Usp-like gene in Calotropis procera plant from the de novo assembled genome contigs of the high-throughput sequencing dataset

    KAUST Repository

    Shokry, Ahmed M.

    2014-02-01

    The wild plant species Calotropis procera (C. procera) has many potential applications and beneficial uses in medicine, industry and ornamental field. It also represents an excellent source of genes for drought and salt tolerance. Genes encoding proteins that contain the conserved universal stress protein (USP) domain are known to provide organisms like bacteria, archaea, fungi, protozoa and plants with the ability to respond to a plethora of environmental stresses. However, information on the possible occurrence of Usp in C. procera is not available. In this study, we uncovered and characterized a one-class A Usp-like (UspA-like, NCBI accession No. KC954274) gene in this medicinal plant from the de novo assembled genome contigs of the high-throughput sequencing dataset. A number of GenBank accessions for Usp sequences were blasted with the recovered de novo assembled contigs. Homology modelling of the deduced amino acids (NCBI accession No. AGT02387) was further carried out using Swiss-Model, accessible via the EXPASY. Superimposition of C. procera USPA-like full sequence model on Thermus thermophilus USP UniProt protein (PDB accession No. Q5SJV7) was constructed using RasMol and Deep-View programs. The functional domains of the novel USPA-like amino acids sequence were identified from the NCBI conserved domain database (CDD) that provide insights into sequence structure/function relationships, as well as domain models imported from a number of external source databases (Pfam, SMART, COG, PRK, TIGRFAM). © 2014 Académie des sciences.

  7. Comparative mapping in the beige-satin region of mouse chromosome 13

    Energy Technology Data Exchange (ETDEWEB)

    Perou, C.M.; Pryor, R.; Kaplan, J. [Univ. of Utah School of Medicine, Salt Lake City, UT (United States)] [and others

    1997-01-15

    The proximal end of mouse chromosome (Chr) 13 contains regions conserved on human chromosomes 1q42-q44, 6p23-p21, and 7p22-p13. This region also contains mutations that may be models for human disease, including beige (human Chediak-Higashi syndrome). An interspecific backcross of SB/Le and Mus spretus mice was used to generate a molecular genetic linkage map of mouse chromosome 13 with an emphasis on the proximal region including beige (bg) and satin (sa). This map provides the gene order of the two phenotypic markers bg and sa relative to restriction fragment length polymorphisms and simple sequence length polymorphisms in 131 backcross animals. In parallel, we have created a physical map of the region using Nidogen (Nid) as a molecular starting point for cloning a YAC contig that was used to identify the beige gene. The physical map provides the fine-structure order of genes and anonymous DNA fragments that was not resolved by the genetic linkage mapping. The results show that the bg region of mouse Chr 13 is highly conserved on human Chr 1q42-q44 and provide a starting point for a complete functional analysis of the entire bg-sa interval. 37 refs., 4 figs., 1 tab.

  8. Giant panda BAC library construction and assembly of a 650-kb contig spanning major histocompatibility complex class II region

    Directory of Open Access Journals (Sweden)

    Pan Hui-Juan

    2007-09-01

    Full Text Available Abstract Background Giant panda is rare and endangered species endemic to China. The low rates of reproductive success and infectious disease resistance have severely hampered the development of captive and wild populations of the giant panda. The major histocompatibility complex (MHC plays important roles in immune response and reproductive system such as mate choice and mother-fetus bio-compatibility. It is thus essential to understand genetic details of the giant panda MHC. Construction of a bacterial artificial chromosome (BAC library will provide a new tool for panda genome physical mapping and thus facilitate understanding of panda MHC genes. Results A giant panda BAC library consisting of 205,800 clones has been constructed. The average insert size was calculated to be 97 kb based on the examination of 174 randomly selected clones, indicating that the giant panda library contained 6.8-fold genome equivalents. Screening of the library with 16 giant panda PCR primer pairs revealed 6.4 positive clones per locus, in good agreement with an expected 6.8-fold genomic coverage of the library. Based on this BAC library, we constructed a contig map of the giant panda MHC class II region from BTNL2 to DAXX spanning about 650 kb by a three-step method: (1 PCR-based screening of the BAC library with primers from homologous MHC class II gene loci, end sequences and BAC clone shotgun sequences, (2 DNA sequencing validation of positive clones, and (3 restriction digest fingerprinting verification of inter-clone overlapping. Conclusion The identifications of genes and genomic regions of interest are greatly favored by the availability of this giant panda BAC library. The giant panda BAC library thus provides a useful platform for physical mapping, genome sequencing or complex analysis of targeted genomic regions. The 650 kb sequence-ready BAC contig map of the giant panda MHC class II region from BTNL2 to DAXX, verified by the three-step method, offers a

  9. A new bidirectional heteroassociative memory encompassing correlational, competitive and topological properties.

    Science.gov (United States)

    Chartier, Sylvain; Giguère, Gyslain; Langlois, Dominic

    2009-01-01

    In this paper, we present a new recurrent bidirectional model that encompasses correlational, competitive and topological model properties. The simultaneous use of many classes of network behaviors allows for the unsupervised learning/categorization of perceptual patterns (through input compression) and the concurrent encoding of proximities in a multidimensional space. All of these operations are achieved within a common learning operation, and using a single set of defining properties. It is shown that the model can learn categories by developing prototype representations strictly from exposition to specific exemplars. Moreover, because the model is recurrent, it can reconstruct perfect outputs from incomplete and noisy patterns. Empirical exploration of the model's properties and performance shows that its ability for adequate clustering stems from: (1) properly distributing connection weights, and (2) producing a weight space with a low dispersion level (or higher density). In addition, since the model uses a sparse representation (k-winners), the size of topological neighborhood can be fixed, and no longer requires a decrease through time as was the case with classic self-organizing feature maps. Since the model's learning and transmission parameters are independent from learning trials, the model can develop stable fixed points in a constrained topological architecture, while being flexible enough to learn novel patterns.

  10. An origin-deficient yeast artificial chromosome triggers a cell cycle checkpoint.

    Science.gov (United States)

    van Brabant, A J; Buchanan, C D; Charboneau, E; Fangman, W L; Brewer, B J

    2001-04-01

    Checkpoint controls coordinate entry into mitosis with the completion of DNA replication. Depletion of nucleotide precursors by treatment with the drug hydroxyurea triggers such a checkpoint response. However, it is not clear whether the signal for this hydroxyurea-induced checkpoint pathway is the presence of unreplicated DNA, or rather the persistence of single-stranded or damaged DNA. In a yeast artificial chromosome (YAC) we have engineered an approximately 170 kb region lacking efficient replication origins that allows us to explore the specific effects of unreplicated DNA on cell cycle progression. Replication of this YAC extends the length of S phase and causes cells to engage an S/M checkpoint. In the absence of Rad9 the YAC becomes unstable, undergoing deletions within the origin-free region.

  11. Delineating Rearrangements in Single Yeast Artificial Chromosomes by Quantitative DNA Fiber Mapping

    Energy Technology Data Exchange (ETDEWEB)

    Weier, Heinz-Ulrich G.; Greulich-Bode, Karin M.; Wu, Jenny; Duell, Thomas

    2009-09-18

    Cloning of large chunks of human genomic DNA in recombinant systems such as yeast or bacterial artificial chromosomes has greatly facilitated the construction of physical maps, the positional cloning of disease genes or the preparation of patient-specific DNA probes for diagnostic purposes. For this process to work efficiently, the DNA cloning process and subsequent clone propagation need to maintain stable inserts that are neither deleted nor otherwise rearranged. Some regions of the human genome; however, appear to have a higher propensity than others to rearrange in any host system. Thus, techniques to detect and accurately characterize such rearrangements need to be developed. We developed a technique termed 'Quantitative DNA Fiber Mapping (QDFM)' that allows accurate tagging of sequence elements of interest with near kilobase accuracy and optimized it for delineation of rearrangements in recombinant DNA clones. This paper demonstrates the power of this microscopic approach by investigating YAC rearrangements. In our examples, high-resolution physical maps for regions within the immunoglobulin lambda variant gene cluster were constructed for three different YAC clones carrying deletions of 95 kb and more. Rearrangements within YACs could be demonstrated unambiguously by pairwise mapping of cosmids along YAC DNA molecules. When coverage by YAC clones was not available, distances between cosmid clones were estimated by hybridization of cosmids onto DNA fibers prepared from human genomic DNA. In addition, the QDFM technology provides essential information about clone stability facilitating closure of the maps of the human genome as well as those of model organisms.

  12. Identification of the first PAR1 deletion encompassing upstream SHOX enhancers in a family with idiopathic short stature.

    Science.gov (United States)

    Benito-Sanz, Sara; Aza-Carmona, Miriam; Rodríguez-Estevez, Amaya; Rica-Etxebarria, Ixaso; Gracia, Ricardo; Campos-Barros, Angel; Heath, Karen E

    2012-01-01

    Short stature homeobox-containing gene, MIM 312865 (SHOX) is located within the pseudoautosomal region 1 (PAR1) of the sex chromosomes. Mutations in SHOX or its downstream transcriptional regulatory elements represent the underlying molecular defect in ~60% of Léri-Weill dyschondrosteosis (LWD) and ~5-15% of idiopathic short stature (ISS) patients. Recently, three novel enhancer elements have been identified upstream of SHOX but to date, no PAR1 deletions upstream of SHOX have been observed that only encompass these enhancers in LWD or ISS patients. We set out to search for genetic alterations of the upstream SHOX regulatory elements in 63 LWD and 100 ISS patients with no known alteration in SHOX or the downstream enhancer regions using a specifically designed MLPA assay, which covers the PAR1 upstream of SHOX. An upstream SHOX deletion was identified in an ISS proband and her affected father. The deletion was confirmed and delimited by array-CGH, to extend ~286 kb. The deletion included two of the upstream SHOX enhancers without affecting SHOX. The 13.3-year-old proband had proportionate short stature with normal GH and IGF-I levels. In conclusion, we have identified the first PAR1 deletion encompassing only the upstream SHOX transcription regulatory elements in a family with ISS. The loss of these elements may result in SHOX haploinsufficiency because of decreased SHOX transcription. Therefore, this upstream region should be included in the routine analysis of PAR1 in patients with LWD, LMD and ISS.

  13. Cis-Acting Determinants Affecting Centromere Function, Sister-Chromatid Cohesion and Reciprocal Recombination during Meiosis in Saccharomyces Cerevisiae

    OpenAIRE

    Sears, D. D.; Hegemann, J. H.; Shero, J. H.; Hieter, P.

    1995-01-01

    We have employed a system that utilizes homologous pairs of human DNA-derived yeast artificial chromosomes (YACs) as marker chromosomes to assess the specific role (s) of conserved centromere DNA elements (CDEI, CDEII and CDEIII) in meiotic chromosome disjunction fidelity. Thirteen different centromere (CEN) mutations were tested for their effects on meiotic centromere function. YACs containing a wild-type CEN DNA sequence segregate with high fidelity in meiosis I (99% normal segregation) and...

  14. Myeloid- and lymphoid-specific breakpoint cluster regions in chromosome band 13q14 in acute leukemia.

    Science.gov (United States)

    Coignet, L J; Lima, C S; Min, T; Streubel, B; Swansbury, J; Telford, N; Swanton, S; Bowen, A; Nagai, M; Catovsky, D; Fonatsch, C; Dyer, M J

    1999-07-01

    Abnormalities of chromosome band 13q14 occur in hematologic malignancies of all lineages and at all stages of differentiation. Unlike other chromosomal translocations, which are usually specific for a given lineage, the chromosomal translocation t(12;13)(p12;q14) has been observed in both B-cell and T-cell precursor acute lymphoblastic leukemia (BCP-, TCP-ALL), in differentiated and undifferentiated acute myeloblastic leukemia (AML), and in chronic myeloid leukemia (CML) at progression to blast crisis. The nature of these translocations and their pathologic consequences remain unknown. To begin to define the gene(s) involved on chromosome 13, we have performed fluorescence in situ hybridization (FISH) using a panel of YACs from the region, on a series of 10 cases of acute leukemia with t(12;13)(p12;q14) and 1 case each with "variant" translocations including t(12;13)(q21;q14), t(10;13)(q24;q14) and t(9;13)(p21;q14). In 8/13 cases/cell lines, the 13q14 break fell within a single 1.4 Mb CEPH MegaYAC. This YAC fell immediately telomeric of the forkhead (FKHR) gene, which is disrupted in the t(2;13)(q35;q14) seen in pediatric alveolar rhabdomyosarcoma. Seven of the 8 cases with breaks in this YAC were AML. In 4/13 cases, the 13q14 break fell within a 1.7-Mb YAC located about 3 Mb telomeric of the retinoblastoma (RB1) gene: all 4 cases were ALL. One case of myelodysplastic syndrome exhibited a break within 13q12, adjacent to the BRCA2 gene. These data indicate the presence of myeloid- and lymphoid-specific breakpoint cluster regions within chromosome band 13q14 in acute leukemia.

  15. Cultural respect encompassing simulation training: being heard about health through broadband

    Directory of Open Access Journals (Sweden)

    Phyllis Min-yu Lau

    2016-04-01

    Full Text Available Background. Cultural Respect Encompassing Simulation Training (CREST is a learning program that uses simulation to provide health professional students and practitioners with strategies to communicate sensitively with culturally and linguistically diverse (CALD patients. It consists of training modules with a cultural competency evaluation framework and CALD simulated patients to interact with trainees in immersive simulation scenarios. The aim of this study was to test the feasibility of expanding the delivery of CREST to rural Australia using live video streaming; and to investigate the fidelity of cultural sensitivity – defined within the process of cultural competency which includes awareness, knowledge, skills, encounters and desire – of the streamed simulations. Design and Methods. In this mixed-methods evaluative study, health professional trainees were recruited at three rural academic campuses and one rural hospital to pilot CREST sessions via live video streaming and simulation from the city campus in 2014. Cultural competency, teaching and learning evaluations were conducted. Results. Forty-five participants rated 26 reliable items before and after each session and reported statistically significant improvement in 4 of 5 cultural competency domains, particularly in cultural skills (P<0.05. Qualitative data indicated an overall acknowledgement amongst participants of the importance of communication training and the quality of the simulation training provided remotely by CREST. Conclusions. Cultural sensitivity education using live video-streaming and simulation can contribute to health professionals’ learning and is effective in improving cultural competency. CREST has the potential to be embedded within health professional curricula across Australian universities to address issues of health inequalities arising from a lack of cultural sensitivity training.

  16. Active role of a human genomic insert in replication of a yeast artificial chromosome.

    Science.gov (United States)

    van Brabant, A J; Fangman, W L; Brewer, B J

    1999-06-01

    Yeast artificial chromosomes (YACs) are a common tool for cloning eukaryotic DNA. The manner by which large pieces of foreign DNA are assimilated by yeast cells into a functional chromosome is poorly understood, as is the reason why some of them are stably maintained and some are not. We examined the replication of a stable YAC containing a 240-kb insert of DNA from the human T-cell receptor beta locus. The human insert contains multiple sites that serve as origins of replication. The activity of these origins appears to require the yeast ARS consensus sequence and, as with yeast origins, additional flanking sequences. In addition, the origins in the human insert exhibit a spacing, a range of activation efficiencies, and a variation in times of activation during S phase similar to those found for normal yeast chromosomes. We propose that an appropriate combination of replication origin density, activation times, and initiation efficiencies is necessary for the successful maintenance of YAC inserts.

  17. Evaluation of stress tolerance and fermentative behavior of indigenous Saccharomyces cerevisiae

    Directory of Open Access Journals (Sweden)

    Cíntia Lacerda Ramos

    2013-09-01

    Full Text Available Sixty six indigenous Saccharomyces cerevisiae strains were evaluated in stressful conditions (temperature, osmolarity, sulphite and ethanol tolerance and also ability to flocculate. Eighteen strains showed tolerant characteristics to these stressful conditions, growing at 42 ºC, in 0.04% sulphite, 1 mol L-1 NaCl and 12% ethanol. No flocculent characteristics were observed. These strains were evaluated according to their fermentative performance in sugar cane juice. The conversion factors of substrates into ethanol (Yp/s, glycerol (Yg/s and acetic acid (Yac/s, were calculated. The highest values of Yp/s in sugar cane juice fermentation were obtained by four strains, one isolated from fruit (0.46 and the others from sugar cane (0.45, 0.44 and 0.43. These values were higher than the value obtained using traditional yeast (0.38 currently employed in the Brazilian bioethanol industry. The parameters Yg/s and Yac/s were low for all strains. The UFLA FW221 presented the higher values for parameter related to bioethanol production. Thus, it was tested in co-culture with Lactobacillus fermentum. Besides this, a 20-L vessel for five consecutive batches of fermentation was performed. This strain was genetically stable and remained viable during all batches, producing high amounts of ethanol. The UFLA FW221 isolated from fruit was suitable to produce bioethanol in sugar cane juice. Therefore, the study of the biodiversity of yeasts from different environmental can reveal strains with desired characteristics to industrial applications.

  18. A contig-based strategy for the genome-wide discovery of microRNAs without complete genome resources.

    Directory of Open Access Journals (Sweden)

    Jun-Zhi Wen

    Full Text Available MicroRNAs (miRNAs are important regulators of many cellular processes and exist in a wide range of eukaryotes. High-throughput sequencing is a mainstream method of miRNA identification through which it is possible to obtain the complete small RNA profile of an organism. Currently, most approaches to miRNA identification rely on a reference genome for the prediction of hairpin structures. However, many species of economic and phylogenetic importance are non-model organisms without complete genome sequences, and this limits miRNA discovery. Here, to overcome this limitation, we have developed a contig-based miRNA identification strategy. We applied this method to a triploid species of edible banana (GCTCV-119, Musa spp. AAA group and identified 180 pre-miRNAs and 314 mature miRNAs, which is three times more than those were predicted by the available dataset-based methods (represented by EST+GSS. Based on the recently published miRNA data set of Musa acuminate, the recall rate and precision of our strategy are estimated to be 70.6% and 92.2%, respectively, significantly better than those of EST+GSS-based strategy (10.2% and 50.0%, respectively. Our novel, efficient and cost-effective strategy facilitates the study of the functional and evolutionary role of miRNAs, as well as miRNA-based molecular breeding, in non-model species of economic or evolutionary interest.

  19. Familial X/Y Translocation Encompassing ARSE in Two Moroccan Siblings with Sensorineural Deafness.

    Science.gov (United States)

    Amasdl, Saadia; Smaili, Wiam; Natiq, Abdelhafid; Hassani, Amale; Sbiti, Aziza; Agadr, Aomar; Sanlaville, Damien; Sefiani, Abdelaziz

    2017-01-01

    Unbalanced translocations involving X and Y chromosomes are rare and associated with a contiguous gene syndrome. The clinical phenotype is heterogeneous including mainly short stature, chondrodysplasia punctata, ichthyosis, hypogonadism, and intellectual disability. Here, we report 2 brothers with peculiar gestalt, short stature, and hearing loss, who harbor an X/Y translocation. Physical examination, brainstem acoustic potential evaluation, bone age, hormonal assessment, and X-ray investigations were performed. Because of their dysmorphic features, karyotyping, FISH, and aCGH were carried out. The probands had short stature, hypertelorism, midface hypoplasia, sensorineural hearing loss, normal intelligence as well as slight radial and ulnar bowing with brachytelephalangy. R-banding identified a derivative X chromosome with an abnormally expanded short arm. The mother was detected as a carrier of the same aberrant X chromosome. aCGH disclosed a 3.1-Mb distal deletion of chromosome region Xp22.33pter. This interval encompasses several genes, especially the short stature homeobox (SHOX) and arylsulfatase (ARSE) genes. The final karyotype of the probands was: 46,Y,der(X),t(X;Y)(p22;q12).ish der(X)(DXYS129-,DXYS153-)mat.arr[hg19] Xp22.33(61091_2689408)×1mat,Xp22.33(2701273_3258404)×0mat,Yq11.222q12 (21412851_59310245)×2. Herein, we describe a Moroccan family with a maternally inherited X/Y translocation and discuss the genotype-phenotype correlations according to the deleted genes. © 2017 S. Karger AG, Basel.

  20. Chromosome region-specific libraries for human genome analysis. Final progress report, 1 March 1991--28 February 1994

    Energy Technology Data Exchange (ETDEWEB)

    Kao, F.T.

    1994-04-01

    The objectives of this grant proposal include (1) development of a chromosome microdissection and PCR-mediated microcloning technology, (2) application of this microtechnology to the construction of region-specific libraries for human genome analysis. During this grant period, the authors have successfully developed this microtechnology and have applied it to the construction of microdissection libraries for the following chromosome regions: a whole chromosome 21 (21E), 2 region-specific libraries for the long arm of chromosome 2, 2q35-q37 (2Q1) and 2q33-q35 (2Q2), and 4 region-specific libraries for the entire short arm of chromosome 2, 2p23-p25 (2P1), 2p21-p23 (2P2), 2p14-p16 (wP3) and 2p11-p13 (2P4). In addition, 20--40 unique sequence microclones have been isolated and characterized for genomic studies. These region-specific libraries and the single-copy microclones from the library have been used as valuable resources for (1) isolating microsatellite probes in linkage analysis to further refine the disease locus; (2) isolating corresponding clones with large inserts, e.g. YAC, BAC, P1, cosmid and phage, to facilitate construction of contigs for high resolution physical mapping; and (3) isolating region-specific cDNA clones for use as candidate genes. These libraries are being deposited in the American Type Culture Collection (ATCC) for general distribution.

  1. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles

    Directory of Open Access Journals (Sweden)

    Boussaha Mekki

    2006-05-01

    Full Text Available Abstract Background The Fragile Histidine Triad gene (FHIT is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. Results The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. Conclusion A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis

  2. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT) tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles.

    Science.gov (United States)

    Uboldi, Cristina; Guidi, Elena; Roperto, Sante; Russo, Valeria; Roperto, Franco; Di Meo, Giulia Pia; Iannuzzi, Leopoldo; Floriot, Sandrine; Boussaha, Mekki; Eggen, André; Ferretti, Luca

    2006-05-23

    The Fragile Histidine Triad gene (FHIT) is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis, especially of vesical papillomavirus-associated cancers of

  3. Constraining eye movement in individuals with Parkinson's disease during walking turns.

    Science.gov (United States)

    Ambati, V N Pradeep; Saucedo, Fabricio; Murray, Nicholas G; Powell, Douglas W; Reed-Jones, Rebecca J

    2016-10-01

    Walking and turning is a movement that places individuals with Parkinson's disease (PD) at increased risk for fall-related injury. However, turning is an essential movement in activities of daily living, making up to 45 % of the total steps taken in a given day. Hypotheses regarding how turning is controlled suggest an essential role of anticipatory eye movements to provide feedforward information for body coordination. However, little research has investigated control of turning in individuals with PD with specific consideration for eye movements. The purpose of this study was to examine eye movement behavior and body segment coordination in individuals with PD during walking turns. Three experimental groups, a group of individuals with PD, a group of healthy young adults (YAC), and a group of healthy older adults (OAC), performed walking and turning tasks under two visual conditions: free gaze and fixed gaze. Whole-body motion capture and eye tracking characterized body segment coordination and eye movement behavior during walking trials. Statistical analysis revealed significant main effects of group (PD, YAC, and OAC) and visual condition (free and fixed gaze) on timing of segment rotation and horizontal eye movement. Within group comparisons, revealed timing of eye and head movement was significantly different between the free and fixed gaze conditions for YAC (p  0.05). In addition, while intersegment timings (reflecting segment coordination) were significantly different for YAC and OAC during free gaze (p training programs for those with PD, possibly promoting better coordination during turning and potentially reducing the risk of falls.

  4. A segment of the apospory-specific genomic region is highly microsyntenic not only between the apomicts Pennisetum squamulatum and buffelgrass, but also with a rice chromosome 11 centromeric-proximal genomic region.

    Science.gov (United States)

    Gualtieri, Gustavo; Conner, Joann A; Morishige, Daryl T; Moore, L David; Mullet, John E; Ozias-Akins, Peggy

    2006-03-01

    Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory.

  5. A Segment of the Apospory-Specific Genomic Region Is Highly Microsyntenic Not Only between the Apomicts Pennisetum squamulatum and Buffelgrass, But Also with a Rice Chromosome 11 Centromeric-Proximal Genomic Region1[W

    Science.gov (United States)

    Gualtieri, Gustavo; Conner, Joann A.; Morishige, Daryl T.; Moore, L. David; Mullet, John E.; Ozias-Akins, Peggy

    2006-01-01

    Bacterial artificial chromosome (BAC) clones from apomicts Pennisetum squamulatum and buffelgrass (Cenchrus ciliaris), isolated with the apospory-specific genomic region (ASGR) marker ugt197, were assembled into contigs that were extended by chromosome walking. Gene-like sequences from contigs were identified by shotgun sequencing and BLAST searches, and used to isolate orthologous rice contigs. Additional gene-like sequences in the apomicts' contigs were identified by bioinformatics using fully sequenced BACs from orthologous rice contigs as templates, as well as by interspecies, whole-contig cross-hybridizations. Hierarchical contig orthology was rapidly assessed by constructing detailed long-range contig molecular maps showing the distribution of gene-like sequences and markers, and searching for microsyntenic patterns of sequence identity and spatial distribution within and across species contigs. We found microsynteny between P. squamulatum and buffelgrass contigs. Importantly, this approach also enabled us to isolate from within the rice (Oryza sativa) genome contig Rice A, which shows the highest microsynteny and is most orthologous to the ugt197-containing C1C buffelgrass contig. Contig Rice A belongs to the rice genome database contig 77 (according to the current September 12, 2003, rice fingerprint contig build) that maps proximal to the chromosome 11 centromere, a feature that interestingly correlates with the mapping of ASGR-linked BACs proximal to the centromere or centromere-like sequences. Thus, relatedness between these two orthologous contigs is supported both by their molecular microstructure and by their centromeric-proximal location. Our discoveries promote the use of a microsynteny-based positional-cloning approach using the rice genome as a template to aid in constructing the ASGR toward the isolation of genes underlying apospory. PMID:16415213

  6. AcEST: [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL2194Contig1 771 2 Adiantum capillus-veneris contig: CL2194contig1 sequence. Link to clone list...apillus-veneris contig: CL2194contig1 sequence. Link to clone list Link to clone list Clone ID BP915172 DK95

  7. Deletion 1q43 encompassing only CHRM3 in a patient with autistic disorder.

    Science.gov (United States)

    Petersen, Andrea Klunder; Ahmad, Ausaf; Shafiq, Mustafa; Brown-Kipphut, Brigette; Fong, Chin-To; Anwar Iqbal, M

    2013-02-01

    Deletions on the distal portion of the long arm of chromosome 1 result in complex and highly variable clinical phenotypes which include intellectual disability, autism, seizures, microcephaly/craniofacial dysmorphology, corpus callosal agenesis/hypogenesis, cardiac and genital anomalies, hand and foot abnormalities and short stature. Genotype-phenotype correlation reported a minimum region of 2 Mb at 1q43-q44. We report on a 3 ½ year old male patient diagnosed with autistic disorder who has social withdrawal, eating problems, repetitive stereotypic behaviors including self-injurious head banging and hair pulling, and no seizures, anxiety, or mood swings. Array comparative genomic hybridization (aCGH) showed an interstitial deletion of 473 kb at 1q43 region (239,412,391-239,885,394; NCBI build37/hg19) harboring only CHRM3 (Acetylcholine Receptor, Muscarinic, 3; OMIM: 118494). Recently, another case with a de novo interstitial deletion of 911 kb at 1q43 encompassing three genes including CHRM3 was reported. The M3 muscarinic receptor influences a multitude of central and peripheral nervous system processes via its interaction with acetylcholine and may be an important modulator of behavior, learning and memory. We propose CHRM3 as a candidate gene responsible for our patient's specific phenotype as well as the overlapping phenotypic features of other patients with 1q43 or 1q43-q44 deletions. Copyright © 2013. Published by Elsevier Masson SAS.

  8. Genetic and physical maps around the sex-determining M-locus of the dioecious plant asparagus.

    Science.gov (United States)

    Telgmann-Rauber, Alexa; Jamsari, Ari; Kinney, Michael S; Pires, J Chris; Jung, Christian

    2007-09-01

    Asparagus officinalis L. is a dioecious plant. A region called the M-locus located on a pair of homomorphic sex chromosomes controls the sexual dimorphism in asparagus. The aim of this work was to clone the region determining sex in asparagus from its position in the genome. The structure of the region encompassing M should be investigated and compared to the sex-determining regions in other dioecious model species. To establish an improved basis for physical mapping, a high-resolution genetic map was enriched with AFLP markers closely linked to the target locus by carrying out a bulked segregant analysis. By screening a BAC library with AFLP- and STS-markers followed by chromosome walking, a physical map with eight contigs could be established. However, the gaps between the contigs could not be closed due to a plethora of repetitive elements. Surprisingly, two of the contigs on one side of the M-locus did not overlap although they have been established with two markers, which mapped in a distance as low as 0.25 cM flanking the sex locus. Thus, the clustering of the markers indicates a reduced recombination frequency within the M-region. On the opposite side of the M-locus, a contig was mapped in a distance of 0.38 cM. Four closely linked BAC clones were partially sequenced and 64 putative ORFs were identified. Interestingly, only 25% of the ORFs showed sequence similarity to known proteins and ESTs. In addition, an accumulation of repetitive sequences and a low gene density was revealed in the sex-determining region of asparagus. Molecular cytogenetic and sequence analysis of BACs flanking the M-locus indicate that the BACs contain highly repetitive sequences that localize to centromeric and pericentromeric locations on all asparagus chromosomes, which hindered the localization of the M-locus to the single pair of sex chromosomes. We speculate that dioecious Silene, papaya and Asparagus species may represent three stages in the evolution of XX, XY sex

  9. Dicty_cDB: CHA362 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA362 (Link to dictyBase) - - - Contig-U15579-1 | Contig-U156... library) Clone ID CHA362 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U155...79-1 | Contig-U15687-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...XACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVT...GNPPCLINPINCTSTDPCIFSYCENGVCI PTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVP

  10. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  11. A Scaffold Analysis Tool Using Mate-Pair Information in Genome Sequencing

    Directory of Open Access Journals (Sweden)

    Pan-Gyu Kim

    2008-01-01

    Full Text Available We have developed a Windows-based program, ConPath, as a scaffold analyzer. ConPath constructs scaffolds by ordering and orienting separate sequence contigs by exploiting the mate-pair information between contig-pairs. Our algorithm builds directed graphs from link information and traverses them to find the longest acyclic graphs. Using end read pairs of fixed-sized mate-pair libraries, ConPath determines relative orientations of all contigs, estimates the gap size of each adjacent contig pair, and reports wrong assembly information by validating orientations and gap sizes. We have utilized ConPath in more than 10 microbial genome projects, including Mannheimia succiniciproducens and Vibro vulnificus, where we verified contig assembly and identified several erroneous contigs using the four types of error defined in ConPath. Also, ConPath supports some convenient features and viewers that permit investigation of each contig in detail; these include contig viewer, scaffold viewer, edge information list, mate-pair list, and the printing of complex scaffold structures.

  12. Groundwater-Surface water interaction in agricultural watershed that encompasses dense network of High Capacity wells

    Science.gov (United States)

    Talib, A.; Desai, A. R.

    2017-12-01

    The Central Sands region of Wisconsin is characterized by productive trout streams, lakes, farmland and forest. However, stream channelization, past wetland drainage, and ground water withdrawals have disrupted the hydrology of this Central Sands region. Climatically driven conditions in last decade (2000-2008) alone are unable to account for the severely depressed water levels. Increased interception and evapotranspiration from afforested areas in central sand Wisconsin may also be culprit for reduced water recharge. Hence, there is need to study the cumulative effects of changing precipitation patterns, groundwater withdrawals, and forest evapotranspiration to improve projections of the future of lake levels and water availability in this region. Here, the SWAT-MODFLOW coupled model approach was applied at large spatio-temporal scale. The coupled model fully integrates a watershed model (SWAT) with a groundwater flow model (MODFLOW). Surface water and ground water flows were simulated integratively at daily time step to estimate the groundwater discharge to the stream network in Central Sands that encompasses high capacity wells. The model was calibrated (2010-2013) and validated (2014-2017) based on streamflow, groundwater extraction, and water table elevation. As the long-term trends in some of the primary drivers is presently ambiguous in Central Sands under future climate, as is the case for total precipitation or timing of precipitation, we relied on a sensitivity student to quantitatively access how primary and secondary drivers may influence future net groundwater recharge. We demonstrate how such an approach could then be coupled with decision-making models to evaluate the effectiveness of groundwater withdrawal policies under a changing climate.

  13. Primary care for young adult cancer survivors: an international perspective

    DEFF Research Database (Denmark)

    Hølge-Hazelton, Bibi; Blake-Gumbs, Lyla; Miedema, Baujke

    2010-01-01

    health insurance in Denmark, The Netherlands, and Canada but not in the US. Once the YAC has completed acute treatment and follow-up care, they often return to the care of the FPs who may potentially be expected to deal with and take action upon any possible medical, mental health, and psychosocial...... issues the YA cancer patient may present with. The role of the FP in follow-up care seems to be very limited. CONCLUSIONS: YACs in the western world seem to have comparable medical and psychosocial problems. However, the nature of health insurance is such that it impacts differently on the care...... continuing medical education (CME) initiatives, and an enhanced cooperative effort between those delivering and coordinating cancer care....

  14. High Potential Source for Biomass Degradation Enzyme Discovery and Environmental Aspects Revealed through Metagenomics of Indian Buffalo Rumen

    Directory of Open Access Journals (Sweden)

    K. M. Singh

    2014-01-01

    Full Text Available The complex microbiomes of the rumen functions as an effective system for plant cell wall degradation, and biomass utilization provide genetic resource for degrading microbial enzymes that could be used in the production of biofuel. Therefore the buffalo rumen microbiota was surveyed using shot gun sequencing. This metagenomic sequencing generated 3.9 GB of sequences and data were assembled into 137270 contiguous sequences (contigs. We identified potential 2614 contigs encoding biomass degrading enzymes including glycoside hydrolases (GH: 1943 contigs, carbohydrate binding module (CBM: 23 contigs, glycosyl transferase (GT: 373 contigs, carbohydrate esterases (CE: 259 contigs, and polysaccharide lyases (PE: 16 contigs. The hierarchical clustering of buffalo metagenomes demonstrated the similarities and dissimilarity in microbial community structures and functional capacity. This demonstrates that buffalo rumen microbiome was considerably enriched in functional genes involved in polysaccharide degradation with great prospects to obtain new molecules that may be applied in the biofuel industry.

  15. A Novel Yeast Genomics Method for Identifying New Breast Cancer Susceptibility Genes

    National Research Council Canada - National Science Library

    Brown, J. M; Brown, James A

    2007-01-01

    ...) a hallmark of most breast cancers when deleted. Using a collection of yeast strains carrying the deletion of a unique open reading frame, we have transfected a yeast artificial chromosome (YAC...

  16. An experimental study on the low-dose radiosensitivity of tumor cell lines

    International Nuclear Information System (INIS)

    Kim, Min Sook; Koh, Kwang Joon

    1994-01-01

    The purpose of this study was to aid in the radiation therapy of head and neck cancer patients. For this study, radiation survival curves were generated for B16, MG-63 and YAC-1 cell lines using semiautomated MTT assay and Dye Exclusion Assay. Irradiation of 2, 4, 6, 8, 10 Gy were delivered at room temperature at a dose rate of 210.2 cGy/min using 60 COγ-ray irradiator ALDORADO 8. The viable cells were determined for each radiation dose and compared to control values. The obtained results were as follows: 1. The was significantly different absorbance at 10 Gy on B16 cell line in MTT assay (P<0.05). 2. There was significantly different absorbance at 4, 6, 8, 10 Gy on MG-63 cell line in MTT assay (P<0.05). 3. YAC-1 cell line was more sensitive than B16 or MG-63 cell line to all doses of radiation (P<0.05). 4. There was significantly different absorbance among all tumor cell lines except between B16 and MG-63 cell line at 2 Gy in MTT assay (P<0.05). 5. Good correlation was obtained between MTT assay and DEA (P<0.05). The efficient of correlation of B16, MG-63 and YAC-1 cell line was 0.845-0.824 and 0.906, respectively.

  17. Enhanced lysis of herpes simplex virus type 1-infected mouse cell lines by NC and NK effectors

    Energy Technology Data Exchange (ETDEWEB)

    Colmenares, C.; Lopez, C.

    1986-05-01

    Spontaneously cytotoxic murine lymphocytes lysed certain cell types infected by herpes simplex virus type 1 (HSV-1) better than uninfected cells. Although HSV-1 adsorbed to the surface of all the target cells, those in which the virus replicated more efficiently were lysed to a greater extent. As targets, the authors used cell lines that, when uninfected, were spontaneously lysed by NK cells (YAC-1) or by NC cells (WEHI-164). They also used a fibroblastoid cell line (M50) and a monocytic tumor line (PU51R), which were not spontaneously killed. NK cells lysed HSV-1-infected YAC cells better than uninfected cells, and an NC-like activity selectively lysed HSV-1-infected WEHI cells. These findings were consistent with the results of experiments performed to define the role of interferon in induction of virus-augmented cytolysis. Increased lysis of YAC-HSV and PU51R-HSV was entirely due to interferon activation and was completely abolished by performing the /sup 51/Cr-release assay in the presence of anti-interferon serum. The data show that HSV-1 infection of NK/NC targets induces increased cytotoxity, but the effector cell responsible for lysis is determined by the uninfected target, or by an interaction between the virus and target cell, rather than by a viral determinant alone.

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB568 (Link to dictyBase) - G23244 DDB0217993 Contig-U02062-1...ary VF (Link to library) Clone ID VFB568 (Link to dictyBase) Atlas ID - NBRP ID G23244 dictyBase ID DDB02179...93 Link to Contig Contig-U02062-1 | Contig-U11831-1 Original site URL http://dict...TELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDRD...STELLY NNFYNTAEPITDEIIGFDLRKYLNFELFTYDYILGRELNQYNNSGCSGCSGCSSSSSSSS SSGGDDGRKNNKKYITQFDTILKELIKQLSFNICTNFSDR

  19. Dicty_cDB: SHE365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE365 (Link to dictyBase) - G23163 DDB0185626 Contig-U11298-1...ary SH (Link to library) Clone ID SHE365 (Link to dictyBase) Atlas ID - NBRP ID G23163 dictyBase ID DDB01856...26 Link to Contig Contig-U11298-1 | Contig-U13252-1 Original site URL http://dict...VEIAFSDKTPSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDE...PSIAVEAIRLVSIMSTL DLLDESDVQKICTLYLVDQPEISKAAGGLIFSKYLLSTQTKIDTTLSNIINSTSAASTTS GQHARKKSKTTNLTSADLDEQQQQQISSQ

  20. Structure, expression profile and phylogenetic inference of chalcone isomerase-like genes from the narrow-leafed lupin (Lupinus angustifolius L. genome

    Directory of Open Access Journals (Sweden)

    Łucja ePrzysiecka

    2015-04-01

    Full Text Available Lupins, like other legumes, have a unique biosynthesis scheme of 5-deoxy-type flavonoids and isoflavonoids. A key enzyme in this pathway is chalcone isomerase (CHI, a member of CHI-fold protein family, encompassing subfamilies of CHI1, CHI2, CHI-like (CHIL, and fatty acid-binding (FAP proteins. Here, two Lupinus angustifolius (narrow-leafed lupin CHILs, LangCHIL1 and LangCHIL2, were identified and characterized using DNA fingerprinting, cytogenetic and linkage mapping, sequencing and expression profiling. Clones carrying CHIL sequences were assembled into two contigs. Full gene sequences were obtained from these contigs, and mapped in two L. angustifolius linkage groups by gene-specific markers. Bacterial artificial chromosome fluorescence in situ hybridization approach confirmed the localization of two LangCHIL genes in distinct chromosomes. The expression profiles of both LangCHIL isoforms were very similar. The highest level of transcription was in the roots of the third week of plant growth; thereafter, expression declined. The expression of both LangCHIL genes in leaves and stems was similar and low. Comparative mapping to reference legume genome sequences revealed strong syntenic links; however, LangCHIL2 contig had a much more conserved structure than LangCHIL1. LangCHIL2 is assumed to be an ancestor gene, whereas LangCHIL1 probably appeared as a result of duplication. As both copies are transcriptionally active, questions arise concerning their hypothetical functional divergence. Screening of the narrow-leafed lupin genome and transcriptome with CHI-fold protein sequences, followed by Bayesian inference of phylogeny and cross-genera synteny survey, identified representatives of all but one (CHI1 main subfamilies. They are as follows: two copies of CHI2, FAPa2 and CHIL, and single copies of FAPb and FAPa1. Duplicated genes are remnants of whole genome duplication which is assumed to have occurred after the divergence of Lupinus, Arachis

  1. Fluorescence in situ hybridization evaluation of chromosome deletion patterns in prostate cancer.

    Science.gov (United States)

    Huang, S F; Xiao, S; Renshaw, A A; Loughlin, K R; Hudson, T J; Fletcher, J A

    1996-11-01

    Various nonrandom chromosomal aberrations have been identified in prostate carcinoma. These aberrations include deletions of several chromosome regions, particularly the chromosome 8 short arm. Large-scale numerical aberrations, reflected in aberrant DNA ploidy, are also found in a minority of cases. However, it is unclear whether prostate carcinomas contain aberrations of certain chromosome regions that are deleted frequently in other common types of cancer. In this study, we performed dual-color fluorescence in situ hybridization on intact nuclei from touch preparations of 16 prostate cancers. Chromosome copy number was determined using pericentromeric probes, whereas potential chromosome arm deletions were evaluated using yeast artificial chromosome (YAC) and P1 probes. Two YAC probes targeted chromosome 8 short arm regions known to be deleted frequently in prostate cancer. Other YACs and P1s were for chromosome regions, including 1p22, 3p14, 6q21, 9p21, and 22q12, that are deletion targets in a variety of cancers although not extensively studied in prostate cancer. Hybridization efficiencies and signal intensities were excellent for both repeat sequence (alpha-satellite) and single, copy (YAC and P1) fluorescence in situ hybridization probes. Of 16 prostate cancers, 11 had clonal aberrations of 1 or more of the 13 chromosome regions evaluated, and 10 cases (62.5%) had 8p deletions, including 4 cases with 8p deletion in virtually all cells and aneuploidy in only a subset of those deleted cells. Deletions at 3p14, 6q21, and 22q12 were identified in 2, 1, and 1 case, respectively, and each of those cases had a similarly sized cell population with 8p deletion. These studies confirm 8p deletion in the majority of prostate carcinomas. 8p deletions appear to be early events in prostate tumorigenesis, often antedating aneuploidy. Fluorescence in situ hybridization strategies incorporating pericentromeric and single-copy regional chromosome probes offer a powerful and

  2. Dicty_cDB: SSE149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

  3. Clinical and molecular characterization of duplications encompassing the human SHOX gene reveal a variable effect on stature.

    Science.gov (United States)

    Thomas, N Simon; Harvey, John F; Bunyan, David J; Rankin, Julia; Grigelioniene, Giedre; Bruno, Damien L; Tan, Tiong Y; Tomkins, Susan; Hastings, Robert

    2009-07-01

    Deletions of the SHOX gene are well documented and cause disproportionate short stature and variable skeletal abnormalities. In contrast interstitial SHOX duplications limited to PAR1 appear to be very rare and the clinical significance of the only case report in the literature is unclear. Mapping of this duplication has now shown that it includes the entire SHOX gene but little flanking sequence and so will not encompass any of the long-range enhancers required for SHOX transcription. We now describe the clinical and molecular characterization of three additional cases. The duplications all included the SHOX coding sequence but varied in the amount of flanking sequence involved. The probands were ascertained for a variety of reasons: hypotonia and features of Asperger syndrome, Leri-Weill dyschondrosteosis (LWD), and a family history of cleft palate. However, the presence of a duplication did not correlate with any of these features or with evidence of skeletal abnormality. Remarkably, the proband with LWD had inherited both a SHOX deletion and a duplication. The effect of the duplications on stature was variable: height appeared to be elevated in some carriers, particularly in those with the largest duplications, but was still within the normal range. SHOX duplications are likely to be under ascertained and more cases need to be identified and characterized in detail in order to accurately determine their phenotypic consequences.

  4. Dicty_cDB: VFB330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB330 (Link to dictyBase) - G22107 DDB0216429 Contig-U02054-1...ary VF (Link to library) Clone ID VFB330 (Link to dictyBase) Atlas ID - NBRP ID G22107 dictyBase ID DDB02164...29 Link to Contig Contig-U02054-1 | Contig-U16357-1 Original site URL http://dict...d Amino Acid sequence *k*k*NKMKLDPKALRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGY...LRYLSKDDFRTLVAVEMGMKNHELVPVSLICTIANLKYGGTKKSIQ TLHKFKLLFHDGRNYDGYKLTYLGYDFLALKTLVSRGVCSYVGNQIGVGKESDIYIVAND

  5. Dicty_cDB: SSB171 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB171 (Link to dictyBase) ssb171 - - Contig-U02783-1 SSB171F ...nk to dictyBase) Atlas ID ssb171 NBRP ID - dictyBase ID - Link to Contig Contig-U02783-1 Original site URL h

  6. SNP markers retrieval for a non-model species: a practical approach

    Directory of Open Access Journals (Sweden)

    Shahin Arwa

    2012-01-01

    Full Text Available Abstract Background SNP (Single Nucleotide Polymorphism markers are rapidly becoming the markers of choice for applications in breeding because of next generation sequencing technology developments. For SNP development by NGS technologies, correct assembly of the huge amounts of sequence data generated is essential. Little is known about assembler's performance, especially when dealing with highly heterogeneous species that show a high genome complexity and what the possible consequences are of differences in assemblies on SNP retrieval. This study tested two assemblers (CAP3 and CLC on 454 data from four lily genotypes and compared results with respect to SNP retrieval. Results CAP3 assembly resulted in higher numbers of contigs, lower numbers of reads per contig, and shorter average read lengths compared to CLC. Blast comparisons showed that CAP3 contigs were highly redundant. Contrastingly, CLC in rare cases combined paralogs in one contig. Redundant and chimeric contigs may lead to erroneous SNPs. Filtering for redundancy can be done by blasting selected SNP markers to the contigs and discarding all the SNP markers that show more than one blast hit. Results on chimeric contigs showed that only four out of 2,421 SNP markers were selected from chimeric contigs. Conclusion In practice, CLC performs better in assembling highly heterogeneous genome sequences compared to CAP3, and consequently SNP retrieval is more efficient. Additionally a simple flow scheme is suggested for SNP marker retrieval that can be valid for all non-model species.

  7. Process for assembly and transformation into Saccharomyces cerevisiae of a synthetic yeast artificial chromosome containing a multigene cassette to express enzymes that enhance xylose utilization designed for an automated pla

    Science.gov (United States)

    A yeast artificial chromosome (YAC) containing a multigene cassette for expression of enzymes that enhance xylose utilization (xylose isomerase [XI] and xylulokinase [XKS]) was constructed and transformed into Saccharomyces cerevisiae to demonstrate feasibility as a stable protein expression system ...

  8. Small mosaic deletion encompassing the snoRNAs and SNURF-SNRPN results in an atypical Prader-Willi syndrome phenotype.

    Science.gov (United States)

    Anderlid, Britt-Marie; Lundin, Johanna; Malmgren, Helena; Lehtihet, Mikael; Nordgren, Ann

    2014-02-01

    Genetic analyses were performed in a male patient with suspected Prader-Willi syndrome who presented with hypogonadism, excessive eating, central obesity, small hands and feet and cognition within the low normal range. However, he had no neonatal hypotonia or feeding problems during infancy. Chromosome analysis showed a normal male karyotype. Further analysis with array-CGH identified a mosaic 847 kb deletion in 15q11-q13, including SNURF-SNRPN, the snoRNA gene clusters SNORD116 (HBII-85), SNORD115, (HBII-52), SNORD109 A and B (HBII-438A and B), SNORD64 (HBII-13), and NPAP1 (C15ORF2). MLPA confirmed the deletion and the results were compatible with a paternal origin. Metaphase-FISH verified the mosaicism with the deletion present in 58% of leukocytes analyzed. Three smaller deletions in this region have previously been reported in patients with Prader-Willi syndrome phenotype. All three deletions included SNORD116, but only two encompassed parts of SNURF-SNRPN, implicating SNORD116 as the major contributor to the Prader-Willi phenotype. Our case adds further information about genotype-phenotype correlation and supports the hypothesis that SNORD116 plays a major role in the pathogenesis of Prader-Willi syndrome. Furthermore, it examplifies diagnostic difficulties in atypical cases and illustrates the need for additional testing methods when Prader-Willi syndrome is suspected. © 2013 Wiley Periodicals, Inc.

  9. Metagenomic insights into the rumen microbial fibrolytic enzymes in Indian crossbred cattle fed finger millet straw.

    Science.gov (United States)

    Jose, V Lyju; Appoothy, Thulasi; More, Ravi P; Arun, A Sha

    2017-12-01

    The rumen is a unique natural habitat, exhibiting an unparalleled genetic resource of fibrolytic enzymes of microbial origin that degrade plant polysaccharides. The objectives of this study were to identify the principal plant cell wall-degrading enzymes and the taxonomic profile of rumen microbial communities that are associated with it. The cattle rumen microflora and the carbohydrate-active enzymes were functionally classified through a whole metagenomic sequencing approach. Analysis of the assembled sequences by the Carbohydrate-active enzyme analysis Toolkit identified the candidate genes encoding fibrolytic enzymes belonging to different classes of glycoside hydrolases(11,010 contigs), glycosyltransferases (6366 contigs), carbohydrate esterases (4945 contigs), carbohydrate-binding modules (1975 contigs), polysaccharide lyases (480 contigs), and auxiliary activities (115 contigs). Phylogenetic analysis of CAZyme encoding contigs revealed that a significant proportion of CAZymes were contributed by bacteria belonging to genera Prevotella, Bacteroides, Fibrobacter, Clostridium, and Ruminococcus. The results indicated that the cattle rumen microbiome and the CAZymes are highly complex, structurally similar but compositionally distinct from other ruminants. The unique characteristics of rumen microbiota and the enzymes produced by resident microbes provide opportunities to improve the feed conversion efficiency in ruminants and serve as a reservoir of industrially important enzymes for cellulosic biofuel production.

  10. Enhancement of antibody-dependent cellular cytotoxicity of cetuximab by a chimeric protein encompassing interleukin-15.

    Science.gov (United States)

    Ochoa, Maria Carmen; Minute, Luna; López, Ascensión; Pérez-Ruiz, Elisabeth; Gomar, Celia; Vasquez, Marcos; Inoges, Susana; Etxeberria, Iñaki; Rodriguez, Inmaculada; Garasa, Saray; Mayer, Jan-Peter Andreas; Wirtz, Peter; Melero, Ignacio; Berraondo, Pedro

    2018-01-01

    Enhancement of antibody-dependent cellular cytotoxicity (ADCC) may potentiate the antitumor efficacy of tumor-targeted monoclonal antibodies. Increasing the numbers and antitumor activity of NK cells is a promising strategy to maximize the ADCC of standard-of-care tumor-targeted antibodies. For this purpose, we have preclinically tested a recombinant chimeric protein encompassing the sushi domain of the IL15Rα, IL-15, and apolipoprotein A-I (Sushi-IL15-Apo) as produced in CHO cells. The size-exclusion purified monomeric fraction of this chimeric protein was stable and retained the IL-15 and the sushi domain bioactivity as measured by CTLL-2 and Mo-7e cell proliferation and STAT5 phosphorylation in freshly isolated human NK and CD8 + T cells. On cell cultures, Sushi-IL15-Apo increases NK cell proliferation and survival as well as spontaneous and antibody-mediated cytotoxicity. Scavenger receptor class B type I (SR-B1) is the receptor for ApoA-I and is expressed on the surface of tumor cells. SR-B1 can adsorb the chimeric protein on tumor cells and can transpresent IL-15 to NK and CD8 + T cells. A transient NK-humanized murine model was developed to test the increase of ADCC attained by the chimeric protein in vivo . The EGFR + human colon cancer cell line HT-29 was intraperitoneally inoculated in immune-deficient Rag2 -/- γc -/- mice that were reconstituted with freshly isolated PBMCs and treated with the anti-EGFR mAb cetuximab. The combination of the Sushi-IL15-Apo protein and cetuximab reduced the number of remaining tumor cells in the peritoneal cavity and delayed tumor engraftment in the peritoneum. Furthermore, Sushi-IL15-Apo increased the anti-tumor effect of a murine anti-EGFR mAb in Rag1 -/- mice bearing subcutaneous MC38 colon cancer transfected to express EGFR. Thus, Sushi-IL15-Apo is a potent tool to increase the number and the activation of NK cells to promote the ADCC activity of antibodies targeting tumor antigens.

  11. The soybean-Phytophthora resistance locus Rps1-k encompasses coiled coil-nucleotide binding-leucine rich repeat-like genes and repetitive sequences

    Directory of Open Access Journals (Sweden)

    Bhattacharyya Madan K

    2008-03-01

    Full Text Available Abstract Background A series of Rps (resistance to Pytophthora sojae genes have been protecting soybean from the root and stem rot disease caused by the Oomycete pathogen, Phytophthora sojae. Five Rps genes were mapped to the Rps1 locus located near the 28 cM map position on molecular linkage group N of the composite genetic soybean map. Among these five genes, Rps1-k was introgressed from the cultivar, Kingwa. Rps1-k has been providing stable and broad-spectrum Phytophthora resistance in the major soybean-producing regions of the United States. Rps1-k has been mapped and isolated. More than one functional Rps1-k gene was identified from the Rps1-k locus. The clustering feature at the Rps1-k locus might have facilitated the expansion of Rps1-k gene numbers and the generation of new recognition specificities. The Rps1-k region was sequenced to understand the possible evolutionary steps that shaped the generation of Phytophthora resistance genes in soybean. Results Here the analyses of sequences of three overlapping BAC clones containing the 184,111 bp Rps1-k region are reported. A shotgun sequencing strategy was applied in sequencing the BAC contig. Sequence analysis predicted a few full-length genes including two Rps1-k genes, Rps1-k-1 and Rps1-k-2. Previously reported Rps1-k-3 from this genomic region 1 was evolved through intramolecular recombination between Rps1-k-1 and Rps1-k-2 in Escherichia coli. The majority of the predicted genes are truncated and therefore most likely they are nonfunctional. A member of a highly abundant retroelement, SIRE1, was identified from the Rps1-k region. The Rps1-k region is primarily composed of repetitive sequences. Sixteen simple repeat and 63 tandem repeat sequences were identified from the locus. Conclusion These data indicate that the Rps1 locus is located in a gene-poor region. The abundance of repetitive sequences in the Rps1-k region suggested that the location of this locus is in or near a

  12. The canine sarcoglycan delta gene: BAC clone contig assembly, chromosome assignment and interrogation as a candidate gene for dilated cardiomyopathy in Dobermann dogs.

    Science.gov (United States)

    Stabej, P; Leegwater, P A J; Imholz, S; Versteeg, S A; Zijlstra, C; Stokhof, A A; Domanjko-Petriè, A; van Oost, B A

    2005-01-01

    Dilated cardiomyopathy (DCM) is a common disease of the myocardium recognized in human, dog and experimental animals. Genetic factors are responsible for a large proportion of cases in humans, and 17 genes with DCM causing mutations have been identified. The genetic origin of DCM in the Dobermann dogs has been suggested, but no disease genes have been identified to date. In this paper, we describe the characterization and evaluation of the canine sarcoglycan delta (SGCD), a gene implicated in DCM in human and hamster. Bacterial artificial chromosomes (BACs) containing the canine SGCD gene were isolated with probes for exon 3 and exons 4-8 and were characterized by Southern blot analysis. BAC end sequences were obtained for four BACs. Three of the BACs overlapped and could be ordered relative to each other and the end sequences of all four BACs could be anchored on the preliminary assembly of the dog genome sequence (www. ensembl.org). One of the BACs of the partial contig was localized by fluorescent in situ hybridization to canine chromosome 4q22, in agreement with the dog genome sequence. Two highly informative polymorphic microsatellite markers in intron 7 of the SGCD gene were identified. In 25 DCM-affected and 13 non DCM-affected dogs seven different haplotypes could be distinguished. However, no association between any of the SGCD variants and the disease locus was apparent.

  13. Chromosome breakage in Prader-Willi and Angelman syndrome deletions may involve recombination between a repeat at the proximal and distal breakpoints

    Energy Technology Data Exchange (ETDEWEB)

    Amos-Landgraf J.; Nicholls, R.D. [Case Western Reserve Univ., Cleveland, OH (United States); Gottlieb, W. [Univ. of Florida, Gainesville, FL (United States)] [and others

    1994-09-01

    Prader-Willi (PWS) and Angelman (AS) syndromes most commonly arise from large deletions of 15q11-q13. Deletions in PWS are paternal in origin, while those in AS are maternal in origin, clearly demonstrating genomic imprinting in these clinically distinct neurobehavioural disorders. In at least 90% of PWS and AS deletion patients, the same 4 Mb region within 15q11-q13 is deleted with breakpoints clustering in single YAC clones at the proximal and distal ends. To study the mechanism of chromosome breakage in PWS and AS, we have previously isolated 25 independent clones from these three YACs using Alu-vector PCR. Four clones were selected that appear to detect a low copy repeat that is located in the proximal and distal breakpoint regions of chromosome 15q11-q13. Three clones detect the same 4 HindIII bands in genomic DNA, all from 15q11-q13, with differing intensities for the probes located at the proximal or distal breakpoints region, respectively. This suggests that these probes detect related members of a low-copy repeat at either location. Moreover, the 254RL2 probe detects a novel HindIII band in two unrelated PWS deletion patients, suggesting that this may represent a breakpoint fragment, with recombination occurring within a similar interval in both patients. A fourth clone, 318RL3 detects 5 bands in HindIII-digested genomic DNA, all from 15q11-q13. This YAC endclone itself is not deleted in PWS and AS deletion patients, as seen by an invariant strong band. Two other strong bands are variably intact or deleted in different PWS or AS deletion patients, suggesting a relationship of this sequence to the breakpoints. Moreover, PCR using 318RL3 primers from the distal 93C9 YAC led to the isolation of a related clone with 96% identity, demonstrating the existence of a low-copy repeat with members close to the proximal and distal breakpoints. Taken together, our data suggest a complex, low-copy repeat with members at both the proximal and distal boundaries.

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB882 (Link to dictyBase) - - - Contig-U13884-1 VFB882E (Link...) Clone ID VFB882 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13884-1 Ori... m_ : 1.00 48.0 %: cytoplasmic 44.0 %: nuclear 4.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  15. The Norrie disease gene maps to a 150 kb region on chromosome Xp11.3.

    Science.gov (United States)

    Sims, K B; Lebo, R V; Benson, G; Shalish, C; Schuback, D; Chen, Z Y; Bruns, G; Craig, I W; Golbus, M S; Breakefield, X O

    1992-05-01

    Norrie disease is a human X-linked recessive disorder of unknown etiology characterized by congenital blindness, sensory neural deafness and mental retardation. This disease gene was previously linked to the DXS7 (L1.28) locus and the MAO genes in band Xp11.3. We report here fine physical mapping of the obligate region containing the Norrie disease gene (NDP) defined by a recombination and by the smallest submicroscopic chromosomal deletion associated with Norrie disease identified to date. Analysis, using in addition two overlapping YAC clones from this region, allowed orientation of the MAOA and MAOB genes in a 5'-3'-3'-5' configuration. A recombination event between a (GT)n polymorphism in intron 2 of the MAOB gene and the NDP locus, in a family previously reported to have a recombination between DXS7 and NDP, delineates a flanking marker telomeric to this disease gene. An anonymous DNA probe, dc12, present in one of the YACs and in a patient with a submicroscopic deletion which includes MAOA and MAOB but not L1.28, serves as a flanking marker centromeric to the disease gene. An Alu-PCR fragment from the right arm of the MAO YAC (YMAO.AluR) is not deleted in this patient and also delineates the centromeric extent of the obligate disease region. The apparent order of these loci is telomere ... DXS7-MAOA-MAOB-NDP-dc12-YMAO.AluR ... centromere. Together these data define the obligate region containing the NDP gene to a chromosomal segment less than 150 kb.

  16. Dicty_cDB: SHA665 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA665 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SHA665Z 676 - - - - Show SHA665 Library SH (Link to library) Clone ID SHA665 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...TQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...ACWNLLEPMHR NYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGY SGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICT

  17. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

  19. Dicty_cDB: VHJ417 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHJ417 (Link to dictyBase) - G23450 DDB0202154 Contig-U12507-1...brary) Clone ID VHJ417 (Link to dictyBase) Atlas ID - NBRP ID G23450 dictyBase ID DDB0202154 Link to Contig ...Contig-U12507-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHJ4-...LLSAVSDSSVQSLSSSI--- ---IDEIKQSVFGATAIIGQSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN...QSKYIMEGQLSLLKGVVASTKKDLFIYLFKDCIICTEINSN YQKDGSNNNNNNNNNNSNNSNSNSSSNNSGSNNSSNNNSPNNLTPKKQTFKSLSTSSSTP NNLSQ

  20. Dicty_cDB: CHK172 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHK172 (Link to dictyBase) - - - Contig-U11104-1 - (Link to Or...iginal site) CHK172F 626 - - - - - - Show CHK172 Library CH (Link to library) Clone ID CHK172 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11104-1 Original site URL http://dictycdb.b...HEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYTRASKAYIHLAQYDQAASII VRGLVFDPRN...KMDHEECKTQGNNYFKQSQYMDAIRCYTQAIELSNGTIA AYYGNRAAAYLAICTKSSLQDSIKDSLKAIELERSFIKGYT

  1. Dicty_cDB: VFH641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum

  2. Dicty_cDB: CHA557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA557 (Link to dictyBase) - - - Contig-U15635-1 - (Link to Or...iginal site) CHA557F 620 - - - - - - Show CHA557 Library CH (Link to library) Clone ID CHA557 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15635-1 Original site URL http://dictycdb.b...HSIEIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGTGTDLPLL KWLEKYTFPVESKFKD...EIGKVEILPNSLIGIDEDGVIQHMKSN YEDLKQLEKDVTMICTDNGINEQESVIDMGNKFLIPGFIDTHAHAPQYHNAGT

  3. Dicty_cDB: SLA117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF

  4. Dicty_cDB: SHE695 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE695 (Link to dictyBase) - G22060 DDB0217012 Contig-U12072-1...brary) Clone ID SHE695 (Link to dictyBase) Atlas ID - NBRP ID G22060 dictyBase ID DDB0217012 Link to Contig ...Contig-U12072-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SH/SHE6-...CPISDCSDHGYCDTSIGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMN...IGKC NCDSSHQGAGCEMDLVSCPTSNKAICSGWGTCNNQTGICTCDANRVGSDCSGISCPVPNC NGNGNCDTTVGQCSCDPSHQGANCEMNFVSCPTPNRSVCSGWGTCNNQTGICT

  5. A physical map of the heterozygous grapevine 'Cabernet Sauvignon' allows mapping candidate genes for disease resistance

    Directory of Open Access Journals (Sweden)

    Scalabrin Simone

    2008-06-01

    Full Text Available Abstract Background Whole-genome physical maps facilitate genome sequencing, sequence assembly, mapping of candidate genes, and the design of targeted genetic markers. An automated protocol was used to construct a Vitis vinifera 'Cabernet Sauvignon' physical map. The quality of the result was addressed with regard to the effect of high heterozygosity on the accuracy of contig assembly. Its usefulness for the genome-wide mapping of genes for disease resistance, which is an important trait for grapevine, was then assessed. Results The physical map included 29,727 BAC clones assembled into 1,770 contigs, spanning 715,684 kbp, and corresponding to 1.5-fold the genome size. Map inflation was due to high heterozygosity, which caused either the separation of allelic BACs in two different contigs, or local mis-assembly in contigs containing BACs from the two haplotypes. Genetic markers anchored 395 contigs or 255,476 kbp to chromosomes. The fully automated assembly and anchorage procedures were validated by BAC-by-BAC blast of the end sequences against the grape genome sequence, unveiling 7.3% of chimerical contigs. The distribution across the physical map of candidate genes for non-host and host resistance, and for defence signalling pathways was then studied. NBS-LRR and RLK genes for host resistance were found in 424 contigs, 133 of them (32% were assigned to chromosomes, on which they are mostly organised in clusters. Non-host and defence signalling genes were found in 99 contigs dispersed without a discernable pattern across the genome. Conclusion Despite some limitations that interfere with the correct assembly of heterozygous clones into contigs, the 'Cabernet Sauvignon' physical map is a useful and reliable intermediary step between a genetic map and the genome sequence. This tool was successfully exploited for a quick mapping of complex families of genes, and it strengthened previous clues of co-localisation of major NBS-LRR clusters and

  6. Dicty_cDB: SFH450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH450 (Link to dictyBase) - - - Contig-U13857-1 SFH450F (Link... to Original site) SFH450F 623 - - - - - - Show SFH450 Library SF (Link to library) Clone ID SFH450 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13857-1 Original site URL http://dict...IMIIFLCLEATFDQPYHSIGGFIIVCSGYQLGQGIAGGAFSGIIPDVVHPSQSGI ASGWLGVGFSLGLLIGTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICT...GTILFGTLLEVKNVIHTWYLYGATIAFLGISALITICTMHEDSND EWSFDGSLPSFFKSLHLPSSIYFNFYWVLITRFFNTLGIYMIFSFLLYFATDIIGQTNLM T

  7. Dicty_cDB: SFH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH236 (Link to dictyBase) - G00315 DDB0191340 Contig-U16349-1...brary) Clone ID SFH236 (Link to dictyBase) Atlas ID - NBRP ID G00315 dictyBase ID DDB0191340 Link to Contig ...Contig-U16349-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFH2-...VDCVTNSSDASCTNFQYPLANITADINNL CGSMPYMPVCTIQQSCNQESSTSGICDPFSILGDSCLHDMPGMSG--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT...ii yvvaclicqfvpfnnhviknpqqvvfvihsqflvivvfticqa*vv--- ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTC

  8. Dicty_cDB: SFC488 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC488 (Link to dictyBase) - - - Contig-U10843-1 SFC488F (Link... to Original site) SFC488F 556 - - - - - - Show SFC488 Library SF (Link to library) Clone ID SFC488 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...ETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLLLDPMVKLPLITRMRMAKD...yhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQAQ SASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFRKE VAIMSKIFHPNIVLFLGACTSTPGKLMICT

  9. Dicty_cDB: CFH353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH353 (Link to dictyBase) - - - Contig-U16205-1 CFH353Z (Link... to Original site) - - CFH353Z 625 - - - - Show CFH353 Library CF (Link to library) Clone ID CFH353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dict...RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIRVELKP...: ---RDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKNGGDASTDGVQRDLLPI VEGCMVSTKYGQIDTSRILFIASGAFHNTKPSDLISELQGRLPIR

  10. Dicty_cDB: SFF779 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF779 (Link to dictyBase) - - - Contig-U16255-1 SFF779Z (Link... to Original site) - - SFF779Z 731 - - - - Show SFF779 Library SF (Link to library) Clone ID SFF779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...NATCSSLNCNAQQMSCKYVXQACHETSCCPDIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLA...DIPQCQIPATGGGPATGSATGQGTSGG TPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSH

  11. Dicty_cDB: SHL605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL605 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) SHL605F 632 - - - - - - Show SHL605 Library SH (Link to library) Clone ID SHL605 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...VDLIRGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQK LTYIQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICT...KRIGYLAASQSFNEGTDVIVLATHQIRKDFL SSNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL RPAFPKLREKLDDPE

  12. Dicty_cDB: CHD753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD753 (Link to dictyBase) - - - Contig-U15579-1 - (Link to Or...iginal site) - - CHD753Z 650 - - - - Show CHD753 Library CH (Link to library) Clone ID CHD753 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dictycdb.b...---IQACGPDNNYQCEFVDKICNTTNDKCLVESCEIGFGCLAIPKNCNDNDPCTTDHCDP AIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICT...NPRGNPPCLINPINCTSTDPCIFSYCEN GVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTVPPRPTP TPLPADPPPYDLEEGCLV

  13. Dicty_cDB: CFG115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

  14. Dicty_cDB: SSA581 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA581 (Link to dictyBase) - - - Contig-U12576-1 SSA581Z (Link... to Original site) - - SSA581Z 504 - - - - Show SSA581 Library SS (Link to library) Clone ID SSA581 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dict...SARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT DEDI...QHASARPLGVAMILIGIDDELGPQLFKVDPAGVFTGYKATAAGEK EQESTNFLEKKFKSNPQLSKDETIQMAISTLQSVLGADLKSSDLEIGICTMDNRKFVIMT D

  15. Dicty_cDB: SFI222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI222 (Link to dictyBase) - - - Contig-U13893-1 - (Link to Or...iginal site) - - SFI222Z 716 - - - - Show SFI222 Library SF (Link to library) Clone ID SFI222 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dictycdb.b...LLSIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT...SIVQLLMGEIPERNTFS QKQLKIALKPYFHLTEAVRVGDLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKK LNTAYSRISFNDICT

  16. Dicty_cDB: SLE232 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE232 (Link to dictyBase) - - - Contig-U16255-1 SLE232F (Link... to Original site) SLE232F 614 - - - - - - Show SLE232 Library SL (Link to library) Clone ID SLE232 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...PSSGFTDFIPSNATCSSLNCNAQQMSCKYVQQACHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST ...CHETSCCPDIPQC QIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSST TGSHTTTGGSTTGSHTTTGGSTTGSHTTTGGSA

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC278 (Link to dictyBase) - - - Contig-U13504-1 VFC278E (Link... Clone ID VFC278 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13504-1 Original site URL http://dict...0.0 %: mitochondrial 4.0 %: plasma membrane >> prediction for VFC278 is cyt 5' end seq. ID VFC278F 5' end se

  18. Dicty_cDB: VFJ144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ144 (Link to dictyBase) - - - Contig-U12576-1 - (Link to Or...iginal site) - - VFJ144Z 698 - - - - Show VFJ144 Library VF (Link to library) Clone ID VFJ144 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12576-1 Original site URL http://dictycdb.b...IGIDDELGPQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Translated A...PQLFKVDPAGVFTGYKATAAGEKEQESTNFLEKK FKSNPQLSKDETIQMAISTLQSVLGADLKPSDLEIGICTMDNRKFVIMTDED Frame B: ---givrkyl*

  19. Complete re-sequencing of a 2Mb topological domain encompassing the FTO/IRXB genes identifies a novel obesity-associated region upstream of IRX5

    DEFF Research Database (Denmark)

    Hunt, Lilian E; Noyvert, Boris; Bhaw-Rosun, Leena

    2015-01-01

    BACKGROUND: Association studies have identified a number of loci that contribute to an increased body mass index (BMI), the strongest of which is in the first intron of the FTO gene on human chromosome 16q12.2. However, this region is both non-coding and under strong linkage disequilibrium, making...... it recalcitrant to functional interpretation. Furthermore, the FTO gene is located within a complex cis-regulatory landscape defined by a topologically associated domain that includes the IRXB gene cluster, a trio of developmental regulators. Consequently, at least three genes in this interval have been...... implicated in the aetiology of obesity. METHODS: Here, we sequence a 2 Mb region encompassing the FTO, RPGRIP1L and IRXB cluster genes in 284 individuals from a well-characterised study group of Danish men containing extremely overweight young adults and controls. We further replicate our findings both...

  20. Molecular cloning of the papillary renal cell carcinoma-associated translocation (X;1)(p11;q21) breakpoint

    NARCIS (Netherlands)

    Weterman, MAJ; Janssen, [No Value; Janssen, HAP; vandenBerg, E; Fisher, SE; Craig, [No Value; vanKessel, AG

    1996-01-01

    A combination of Southern blot analysis on a panel of tumor-derived somatic cell hybrids and fluorescence in situ hybridization techniques was used to map YACs, cosmids and DNA markers from the Xp11.2 region relative to the X chromosome breakpoint of the renal cell carcinoma-associated

  1. Dicty_cDB: SHI867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT

  2. Dicty_cDB: FC-AJ15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT

  3. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  4. Dicty_cDB: SLB394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB394 (Link to dictyBase) - G24120 DDB0184167BP Contig-U13982... (Link to library) Clone ID SLB394 (Link to dictyBase) Atlas ID - NBRP ID G24120 dictyBase ID DDB0184167BP L...ink to Contig Contig-U13982-1 Original site URL http://dictycdb.biol.tsukuba.ac.j...2 Translated Amino Acid sequence TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT...e B: TDTNPKEPSNVESIITTSEVTPSPPPSTTTSTTTNATTTITTSQPQANIIGGKRSRKDDE IISIQEALNDQLEEEKNLLEEAKEQEQEDWGDESICT

  5. Dicty_cDB: SHI777 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI777 (Link to dictyBase) - - - Contig-U12085-1 - (Link to Or...iginal site) SHI777F 332 - - - - - - Show SHI777 Library SH (Link to library) Clone ID SHI777 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12085-1 Original site URL http://dictycdb.b...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk...IKEIIQHAKEYGIRVELEIDMPGHAYSWGIGYPS VLPANFSHSIQCQPSICTNK***ikknk*kk*kniylkikkkx*kk

  6. Dicty_cDB: VHB478 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHB478 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHB478Z 556 - - - - Show VHB478 Library VH (Link to library) Clone ID VHB478 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...cid sequence ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSGQLYNSQITT...xxcxlf*trknp*kyfrkkmdsqqkrfxr*xfn*vhlsl sgxy Frame C: ---ASGSVVXQCSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT

  7. Dicty_cDB: SHF448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB533 (Link to dictyBase) - G02515 DDB0218082 Contig-U10369-1...brary) Clone ID VFB533 (Link to dictyBase) Atlas ID - NBRP ID G02515 dictyBase ID DDB0218082 Link to Contig ...Contig-U10369-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-... %: cytoskeletal 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> predict

  9. Dicty_cDB: SFC123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  10. Dicty_cDB: SHL102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk

  11. First report of a deletion encompassing an entire exon in the homogentisate 1,2-dioxygenase gene causing alkaptonuria.

    Science.gov (United States)

    Zouheir Habbal, Mohammad; Bou-Assi, Tarek; Zhu, Jun; Owen, Renius; Chehab, Farid F

    2014-01-01

    Alkaptonuria is often diagnosed clinically with episodes of dark urine, biochemically by the accumulation of peripheral homogentisic acid and molecularly by the presence of mutations in the homogentisate 1,2-dioxygenase gene (HGD). Alkaptonuria is invariably associated with HGD mutations, which consist of single nucleotide variants and small insertions/deletions. Surprisingly, the presence of deletions beyond a few nucleotides among over 150 reported deleterious mutations has not been described, raising the suspicion that this gene might be protected against the detrimental mechanisms of gene rearrangements. The quest for an HGD mutation in a proband with AKU revealed with a SNP array five large regions of homozygosity (5-16 Mb), one of which includes the HGD gene. A homozygous deletion of 649 bp deletion that encompasses the 72 nucleotides of exon 2 and surrounding DNA sequences in flanking introns of the HGD gene was unveiled in a proband with AKU. The nature of this deletion suggests that this in-frame deletion could generate a protein without exon 2. Thus, we modeled the tertiary structure of the mutant protein structure to determine the effect of exon 2 deletion. While the two β-pleated sheets encoded by exon 2 were missing in the mutant structure, other β-pleated sheets are largely unaffected by the deletion. However, nine novel α-helical coils substituted the eight coils present in the native HGD crystal structure. Thus, this deletion results in a deleterious enzyme, which is consistent with the proband's phenotype. Screening for mutations in the HGD gene, particularly in the Middle East, ought to include this exon 2 deletion in order to determine its frequency and uncover its origin.

  12. First report of a deletion encompassing an entire exon in the homogentisate 1,2-dioxygenase gene causing alkaptonuria.

    Directory of Open Access Journals (Sweden)

    Mohammad Zouheir Habbal

    Full Text Available Alkaptonuria is often diagnosed clinically with episodes of dark urine, biochemically by the accumulation of peripheral homogentisic acid and molecularly by the presence of mutations in the homogentisate 1,2-dioxygenase gene (HGD. Alkaptonuria is invariably associated with HGD mutations, which consist of single nucleotide variants and small insertions/deletions. Surprisingly, the presence of deletions beyond a few nucleotides among over 150 reported deleterious mutations has not been described, raising the suspicion that this gene might be protected against the detrimental mechanisms of gene rearrangements. The quest for an HGD mutation in a proband with AKU revealed with a SNP array five large regions of homozygosity (5-16 Mb, one of which includes the HGD gene. A homozygous deletion of 649 bp deletion that encompasses the 72 nucleotides of exon 2 and surrounding DNA sequences in flanking introns of the HGD gene was unveiled in a proband with AKU. The nature of this deletion suggests that this in-frame deletion could generate a protein without exon 2. Thus, we modeled the tertiary structure of the mutant protein structure to determine the effect of exon 2 deletion. While the two β-pleated sheets encoded by exon 2 were missing in the mutant structure, other β-pleated sheets are largely unaffected by the deletion. However, nine novel α-helical coils substituted the eight coils present in the native HGD crystal structure. Thus, this deletion results in a deleterious enzyme, which is consistent with the proband's phenotype. Screening for mutations in the HGD gene, particularly in the Middle East, ought to include this exon 2 deletion in order to determine its frequency and uncover its origin.

  13. Dicty_cDB: FC-BR21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-BR21 (Link to dictyBase) - - - Contig-U15384-1 | Contig-U16443-1 FC-BR2...1P (Link to Original site) FC-BR21F 551 FC-BR21Z 122 FC-BR21P 673 - - Show FC-BR21 Library FC (L...ink to library) Clone ID FC-BR21 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Cont...ig-U15384-1 | Contig-U16443-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BR/FC-BR2...1Q.Seq.d/ Representative seq. ID FC-BR21P (Link to Original site) Representative DNA sequence >FC-BR21 (FC-BR2

  14. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  15. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  16. Dicty_cDB: AFJ353 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ353 (Link to dictyBase) - - - Contig-U10972-1 AFJ353P (Link... to Original site) AFJ353F 592 AFJ353Z 580 AFJ353P 1172 - - Show AFJ353 Library AF (Link to library) Clone ID AFJ353 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...SISTGLPNLSGGKINTNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICT...TNVYSSLGNIGSGMNGSSTKDDSVSPTKKSTDHQP RKPMTKSVSMSSIGLN--- ---NYLIQSFLKQFSPEVNQFVCDAIMGNIEEICTHKVGCTVVNRCIDNANP

  17. Dicty_cDB: SFA408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFA408 (Link to dictyBase) - - - Contig-U10972-1 SFA408P (Link... to Original site) SFA408F 509 SFA408Z 686 SFA408P 1195 - - Show SFA408 Library SF (Link to library) Clone ID SFA408 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10972-1 Original site URL http://dict...YLSXDQVESIIASIKGKVIQLSKDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYVVQHL ...KDNKGNYLIQSFLKQFSPEVNQFV CDAIMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKITEHSLKLVQDQFGNYV

  18. Dicty_cDB: SLG821 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLG821 (Link to dictyBase) - - - Contig-U15540-1 SLG821P (Link... to Original site) SLG821F 638 SLG821Z 554 SLG821P 1192 - - Show SLG821 Library SL (Link to library) Clone ID SLG821 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...MSPSSPICLPESPMGAQHWESGL--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT...*--- ---IDDKTGIFDSQRFLAFNNPQAMSKYESYRIYIHPSLGYSGNAKRFKQQPDVNEKALI LDGNVYDGHLNPIYNCKICT

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB866 (Link to dictyBase) - - - Contig-U16349-1 VFB866Z (Link... to Original site) - - VFB866Z 631 - - - - Show VFB866 Library VF (Link to library) Clone ID VFB866 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...ce ---SSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMP DMSQCANWTKMCSSSGQLYNSQITSDYCVASVADAVPIMRMYFH...RGCLHAIELTCSYALMLVAMTFNVALFFAV Translated Amino Acid sequence (All Frames) Frame A: ---SSVDSISNLPTTMQLFAGIKSICT

  20. Dicty_cDB: VHL364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL364 (Link to dictyBase) - - - Contig-U16205-1 - (Link to Or...iginal site) - - VHL364Z 668 - - - - Show VHL364 Library VH (Link to library) Clone ID VHL364 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16205-1 Original site URL http://dictycdb.b...mino Acid sequence ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN GGDASTDGVQRDLLPIVEGCMVSTKYGQ...itwyh*tyrrgykf*lxys*r*nscfrysrh*ktfk Frame B: ---KKVTIAEAKEIFEKQYRDLYTVSQDVTKLAIQSAEQNGIVFLDEIDKICTSRESIKN G

  1. Dicty_cDB: VHK472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK472 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHK472Z 392 - - - - Show VHK472 Library VH (Link to library) Clone ID VHK472 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b....10 Translated Amino Acid sequence ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSPTTT...wstlqlsnhirllcrlcc*rrsnhenvlshwylglypl*ilgtk n*psicwfmv Frame B: ---CSSVDSISNLPTXMQLFAGIKSICTEMAMDGCEKCSGNSP

  2. Dicty_cDB: CFJ816 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFJ816 (Link to dictyBase) - - - Contig-U16255-1 CFJ816P (Link... to Original site) CFJ816F 562 CFJ816Z 721 CFJ816P 1263 - - Show CFJ816 Library CF (Link to library) Clone ID CFJ816 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTT...PATGSATGQGTSGGTPGSCDKV NCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTTTGGSTTGSHTTTG GSTTGSHTTTGGSTTGSHTTTGGS

  3. Dicty_cDB: CFI686 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI686 (Link to dictyBase) - - - Contig-U15579-1 CFI686P (Link... to Original site) CFI686F 185 CFI686Z 445 CFI686P 610 - - Show CFI686 Library CF (Link to library) Clone ID CFI686 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT PTVTPT...LVXXCXIGFGCXAIXKNCNXNDPXXXDXCDXXIGCYYDKFDXCXACN XVDTCXXNDLCXXRECNXRGXPPCLINPINCXSXDPCIFSYCENGVCIXTYICTPTPSVT

  4. Dicty_cDB: VHA365 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA365 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHA365Z 352 - - - - Show VHA365 Library VH (Link to library) Clone ID VHA365 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...TTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTT sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...wfmv Frame C: ---QLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS SSGQLY

  5. Dicty_cDB: VFF110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

  6. Dicty_cDB: SLE110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

  7. Dicty_cDB: SSB322 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB322 (Link to dictyBase) - - - Contig-U03539-1 SSB322Z (Link... to Original site) - - SSB322Z 393 - - - - Show SSB322 Library SS (Link to library) Clone ID SSB322 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03539-1 Original site URL http://dict...KGKXYILQDKQYKERGVGTIRVNKDLEEKXRIIMNAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfil...NAD GSKKNILNVNIFPKMKVTSPNEKTLTFIAFEDDKICTFVLIAKPEEIKNFSTVINKQISS LEVA*nfilkkkk Homology vs CSM-cDNA Score E

  8. Dicty_cDB: AHB126 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHB126 (Link to dictyBase) - - - Contig-U16336-1 AHB126P (Link... to Original site) AHB126F 598 AHB126Z 500 AHB126P 1078 - - Show AHB126 Library AH (Link to library) Clone ID AHB126 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...RGIRNHKKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT...KKNETKFINQCINEIKEELKGDMQKKTVAVQKLTYIQMLGFDI SWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQSEAYLAL NCLSNICT

  9. Dicty_cDB: VHC776 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC776 (Link to dictyBase) - - - Contig-U15722-1 VHC776P (Link... to Original site) VHC776F 593 VHC776Z 895 VHC776P 1468 - - Show VHC776 Library VH (Link to library) Clone ID VHC776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...CDNNTGNCTCHNEXFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDN...XFGNSCEFTRCP LDCSTPNGTCDNNXGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCDNEHIGN GCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTK

  10. Dicty_cDB: VHK477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK477 (Link to dictyBase) - - - Contig-U11536-1 VHK477P (Link... to Original site) VHK477F 685 VHK477Z 794 VHK477P 1459 - - Show VHK477 Library VH (Link to library) Clone ID VHK477 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11536-1 Original site URL http://dict...QIGTYSFEGKFIKKAIINGNRIVTINN KLLNENQLNSNSTITKEKDSSNQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAI...NQLSSFISIEIPHYDSNVLLDPSFSVLLDSNESYKNSEN SICTSKKSSKLTTAQIIAIVIVSVVFVIILALFIIVKFSKS

  11. Dicty_cDB: SFD793 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD793 (Link to dictyBase) - - - Contig-U16255-1 SFD793P (Link... to Original site) SFD793F 660 SFD793Z 689 SFD793P 1349 - - Show SFD793 Library SF (Link to library) Clone ID SFD793 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...ATCSSLNCNAQQMSCKYVQQACHETSC CPDIPQCQIPATGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTT...TGGGPATGSATGQGTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSS SSSSSSTTGSHTTTGGSTTGSHTTTGGSTTG

  12. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  13. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  14. Dicty_cDB: VFL117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT

  15. Dicty_cDB: VHC263 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHC263 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHC263Z 429 - - - - Show VHC263 Library VH (Link to library) Clone ID VHC263 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...ATGG ACTCCCAAC sequence update 2002. 9.10 Translated Amino Acid sequence ---QLFAGIKSICT...kyfrkkmdsq Frame B: ---QLFAGIKSICTXMAMDGCEKCSGNSPTTTCDVLPVYSSLCMAMPDMSQCANWTKMCS

  16. Dicty_cDB: VHO201 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO201 (Link to dictyBase) - - - Contig-U12425-1 VHO201P (Link... to Original site) VHO201F 596 VHO201Z 398 VHO201P 974 - - Show VHO201 Library VH (Link to library) Clone ID VHO201 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12425-1 Original site URL http://dict...SGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICTNALYDLFLAASDQINFQQCKENGFEVLKKLINS...CKREXMELRIPTFVSNILNTLFLHSLGVEGLFRISGSQMEIQNRRGIVNLGDYSTSR DDNPHVLTVLLKQFLRDLPEPICT

  17. Dicty_cDB: AFI379 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI379 (Link to dictyBase) - - - Contig-U08795-1 AFI379P (Link... to Original site) AFI379F 645 AFI379Z 836 AFI379P 1471 - - Show AFI379 Library AF (Link to library) Clone ID AFI379 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGL...KIFCYYYFYYHKMALVLPIFATENTLLVTENDL GRGFSVDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLS YGLMSGKIMGEYL

  18. Dicty_cDB: SFH459 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFH459 (Link to dictyBase) - - - Contig-U16336-1 SFH459P (Link... to Original site) SFH459F 606 SFH459Z 728 SFH459P 1334 - - Show SFH459 Library SF (Link to library) Clone ID SFH459 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...KTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKT...TVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTH

  19. Dicty_cDB: CHR591 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR591 (Link to dictyBase) - - - Contig-U11865-1 CHR591P (Link... to Original site) CHR591F 557 CHR591Z 706 CHR591P 1243 - - Show CHR591 Library CH (Link to library) Clone ID CHR591 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11865-1 Original site URL http://dict... IDPYEIQQNKQSNNSNSNSNRNLTPNSSSPTNQRKNKQEDDDDESKLDDESDLNERFQKV VLRFREFPSLDTNLYRLQEICT...DLNERFQKV VLRFREFPSLDTNLYRLQEICTDLLHISQDFIHTVKTYGRIIIEERYLKEKTIQSRSIGG H--- ---RK

  20. Dicty_cDB: SFF125 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT

  1. Dicty_cDB: VHL434 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL434 (Link to dictyBase) - - - Contig-U16336-1 VHL434P (Link... to Original site) VHL434F 546 VHL434Z 778 VHL434P 1304 - - Show VHL434 Library VH (Link to library) Clone ID VHL434 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...EVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPES-- - --...GFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLS SNQSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFL

  2. Dicty_cDB: CHN802 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHN802 (Link to dictyBase) - - - Contig-U16336-1 CHN802P (Link... to Original site) CHN802F 543 CHN802Z 788 CHN802P 1311 - - Show CHN802 Library CH (Link to library) Clone ID CHN802 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dict...ASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIFLRYPESL...NETKFINQCINEIKEELKGDMQKKTVAVQKLTY IQMLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSN QSEAYLALNCLSNICT

  3. Dicty_cDB: AFJ513 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ513 (Link to dictyBase) - G20675 DDB0218542 Contig-U10004-1...brary) Clone ID AFJ513 (Link to dictyBase) Atlas ID - NBRP ID G20675 dictyBase ID DDB0218542 Link to Contig ...Contig-U10004-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFJ5-...LLVNLVV VNDSGDIEPDTIIPLVDG--- ---SCFECSLXAFPPQVSYAICTIANTPRVPEHCIQWALLFGLQDATLEKPFDPKQFDND NPDHMNWLFECAKKRAE...r*r*rll*ti*ncycrfrfnrskkmd*wfis*fsc ck**w*y*trynhsig*ww--- ---SCFECSLXAFPPQVSYAICT

  4. Dicty_cDB: SLA340 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA340 (Link to dictyBase) - - - Contig-U16510-1 - (Link to Or...iginal site) - - SLA340Z 466 - - - - Show SLA340 Library SL (Link to library) Clone ID SLA340 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16510-1 Original site URL http://dictycdb.b.... 2 Translated Amino Acid sequence ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICTISICIIFICIICSNYS CNYNCNYSCNYN...qpqlqlqlqlqpqpqlqpqlqpq lplkfnqktffikyhynnffnnnsikk*y*kspffl Frame C: ---CGKPSPIPTCTRKLSPISICIIKLCPIFICITKLCSIYICT

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB676 (Link to dictyBase) - - - Contig-U12091-1 VFB676E (Link...) Clone ID VFB676 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12091-1 Ori...NA, complete cds. 2155 0.0 1 U66525 |U66525.1 Dictyostelium discoideum ORFveg114 ...toplasmic 16.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VF

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB713 (Link to dictyBase) - - - Contig-U16602-1 VFB713F (Link... to Original site) VFB713F 471 - - - - - - Show VFB713 Library VF (Link to library) Clone ID VFB713 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...ar 12.0 %: cytoplasmic 8.0 %: vacuolar 8.0 %: mitochondrial 8.0 %: endoplasmic reticulum >> predict

  7. Dicty_cDB: AFN878 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFN878 (Link to dictyBase) - - - Contig-U15540-1 AFN878P (Link... to Original site) AFN878F 592 AFN878Z 531 AFN878P 1123 - - Show AFN878 Library AF (Link to library) Clone ID AFN878 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dict...D VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPLYFHFTLTNPLTNEVVLQSLINVNVK...YESYRIYIHPSLGYSGNAKRFKQQPD VNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANPHAKGKVLLVKNNILTRVKDG GFTLSLKPMCCSGHNSHIPL

  8. Dicty_cDB: AFL122 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL122 (Link to dictyBase) - - - Contig-U11144-1 AFL122P (Link... to Original site) AFL122F 837 AFL122Z 711 AFL122P 1538 - - Show AFL122 Library AF (Link to library) Clone ID AFL122 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11144-1 Original site URL http://dict...GPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICTIHQPRSNIYDM FDNLLLLGDGNTIYYGKANKALEYFNANGYHCSEKTNPADFFLDLINTQVEDQADSD...TLNFYAQLKMPRDVPLKEKLQRVQDIIDEMGLNRCADTLVGTADNKIRGISGGERR RVTISIELLTGPSVILLDEPTSGLDASTSFYVMSALKKLAKSGRTIICT

  9. Dicty_cDB: VHH831 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH831 (Link to dictyBase) - - - Contig-U15722-1 VHH831P (Link... to Original site) VHH831F 586 VHH831Z 930 VHH831P 1496 - - Show VHH831 Library VH (Link to library) Clone ID VHH831 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...HFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCSTKHGICDNDSGNCKCDTQTKGLTCEESRLLIESLDSINS KGGTINIIGYFGNTT...STPNGTCDNNTGNCTCHNEHFGNG CEFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTC DNEHIGNGCEIKFIECKHKCST

  10. Dicty_cDB: CFE262 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING

  11. Isolation of a candidate gene for Norrie disease by positional cloning

    NARCIS (Netherlands)

    Berger, W.; Meindl, A.; van de Pol, T. J.; Cremers, F. P.; Ropers, H. H.; Döerner, C.; Monaco, A.; Bergen, A. A.; Lebo, R.; Warburg, M.

    1992-01-01

    The gene for Norrie disease, an X-linked disorder characterized by progressive atrophy of the eyes, mental disturbances and deafness, has been mapped to chromosome Xp11.4 close to DXS7 and the monoamine oxidase (MAO) genes. By subcloning a YAC with a 640 kilobases (kb) insert which spans the

  12. Genome-wide SNP identification by high-throughput sequencing and selective mapping allows sequence assembly positioning using a framework genetic linkage map

    Directory of Open Access Journals (Sweden)

    Xu Xiangming

    2010-12-01

    Full Text Available Abstract Background Determining the position and order of contigs and scaffolds from a genome assembly within an organism's genome remains a technical challenge in a majority of sequencing projects. In order to exploit contemporary technologies for DNA sequencing, we developed a strategy for whole genome single nucleotide polymorphism sequencing allowing the positioning of sequence contigs onto a linkage map using the bin mapping method. Results The strategy was tested on a draft genome of the fungal pathogen Venturia inaequalis, the causal agent of apple scab, and further validated using sequence contigs derived from the diploid plant genome Fragaria vesca. Using our novel method we were able to anchor 70% and 92% of sequences assemblies for V. inaequalis and F. vesca, respectively, to genetic linkage maps. Conclusions We demonstrated the utility of this approach by accurately determining the bin map positions of the majority of the large sequence contigs from each genome sequence and validated our method by mapping single sequence repeat markers derived from sequence contigs on a full mapping population.

  13. [Reconstruction of long polynucleotide sequences from fragments using the Iskra-226 personal computer

    Science.gov (United States)

    Kostetskiĭ, P V; Dobrova, I E

    1988-04-01

    An algorithm for reconstructing long DNA sequences, i.e. arranging all overlapping gel readings in the contigs, and the corresponding BASIC programme for personal computer "Iskra-226" (USSR) are described. The contig construction begins with the search for all fragments overlapping the basic (longest) one follower by determination of coordinates of 5' ends of the overlapping fragments. Then the gel reading with minimal 5' end coordinate and the gel reading with maximal 3' end coordinate are selected and used as basic ones at the next assembly steps. The procedure is finished when no gel reading overlapping the basic one can be found. All gel readings entered the contig are ignored at the next steps of the assembly. Finally, one or several contigs consisted of DNA fragments are obtained. Effectiveness of the algorithm was tested on a model based on the multiple assembly of the nucleotide sequence, encoding the Na, K-ATPase alpha-subunit of pig kidney. The programme does not call for user's participation and can comprise contigs up to 10,000 nucleotides long.

  14. Dicty_cDB: CHA851 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHA851 (Link to dictyBase) - - - Contig-U16368-1 - (Link to Or...iginal site) CHA851F 614 - - - - - - Show CHA851 Library CH (Link to library) Clone ID CHA851 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dictycdb.b...TCCXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT...nly*skttgttttllnlcraiism*srwn dlysstkqlyqy*ipmlpis--- Frame C: VRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNCGPGYICT

  15. Dicty_cDB: SFF103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF103 (Link to dictyBase) - - - Contig-U11967-1 SFF103Z (Link... to Original site) - - SFF103Z 655 - - - - Show SFF103 Library SF (Link to library) Clone ID SFF103 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11967-1 Original site URL http://dict...nslated Amino Acid sequence ---rgsf*FLKIIITLLAYKIICTPNHMHLTRGNHETTDMNRFYGFQGEVVAKYSEMVFD LFSELFNWFPLAFVLDESF...*rkrlsnr**wfshhcflc skll*siw*swliykynxdkikittxklxtsexppmhsqk Frame C: ---rgsf*FLKIIITLLAYKIICT

  16. Dicty_cDB: VHA622 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA622 (Link to dictyBase) - - - Contig-U15767-1 VHA622P (Link... to Original site) VHA622F 458 VHA622Z 778 VHA622P 1216 - - Show VHA622 Library VH (Link to library) Clone ID VHA622 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...HVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLP QGNCSNTPVDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTCQPSTGQCEYSD...qisnqkmrenlf*lrelsnqilikkkefqf*ivwmpmil*ik rqelvgqmvlsiflxitklviqnlpnlvk--- ---ACNEDEKXITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICT

  17. Dicty_cDB: CHF177 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF177 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - CHF177Z 395 - - - - Show CHF177 Library CH (Link to library) Clone ID CHF177 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...LLLWDVQGFPCXFAVEG GQCIDPSSLKVGGKYSFIAFSTCRXKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Translated Amino A...XKFDNQKIHDCDWIIQGPTTPSXCANCGKICTSKCT TNYCDRDXQT Homology vs CSM-cDNA Score E Sequences producing significant

  18. Dicty_cDB: VFJ256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

  19. Dicty_cDB: AFF341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF341 (Link to dictyBase) - - - Contig-U15579-1 AFF341P (Link... to Original site) AFF341F 158 AFF341Z 283 AFF341P 441 - - Show AFF341 Library AF (Link to library) Clone ID AFF341 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...GCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICTPTPSVTPTVTPXVTXTVT Translated Amino Aci...*fliikkk--- ---DHCDPAIGCYYDKFDNCDACNAVDXCITNDLCFPRECNPRGNPPCLINPINCTSTDP CIFSYCENGVCIPTYICT

  20. Dicty_cDB: CFF487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFF487 (Link to dictyBase) - - - Contig-U15579-1 CFF487P (Link... to Original site) CFF487F 143 CFF487Z 518 CFF487P 661 - - Show CFF487 Library CF (Link to library) Clone ID CFF487 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...CFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTPTVTPTVTPTVTPTVTPTVTPTVTPTPTTTPTPSPTTV Translated Amino A...ESCEIGFGCLAIPKNCNDNDPCTTDHCD PAIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGNPPCLINPINCTSTDPCIFSYCE NGVCIPTYICTPTPSVTP

  1. Dicty_cDB: CHI134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHI134 (Link to dictyBase) - - - Contig-U11723-1 CHI134P (Link... to Original site) CHI134F 581 CHI134Z 736 CHI134P 1297 - - Show CHI134 Library CH (Link to library) Clone ID CHI134 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11723-1 Original site URL http://dict...gl*kta*g*IIMESNKSSSHGDVSTSPSFLNNHHQFNNGGDIIPKKKKNRIMHVG SYEVGKTLGNGTFGKVKLGTNICTK...PVIEAPKTRRMSLDSR MLNGDQQSLVEKNQHMASPRTSKGIFKXSTTTTKSPEKTIIELKRSLEESGLFTKKKGPY LXLCFDEDNSVKFQIEIVKICNLDLTGIQLKRLSGDTWKYKDICT

  2. Dicty_cDB: VFM148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFM148 (Link to dictyBase) - - - Contig-U08795-1 VFM148P (Link... to Original site) VFM148F 479 VFM148Z 710 VFM148P 1169 - - Show VFM148 Library VF (Link to library) Clone ID VFM148 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U08795-1 Original site URL http://dict...YYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVRSITDSNKLTLINDQESLTSALNVSGELSLSYGLMS GKIMGEYLDTSSS...(All Frames) Frame A: iylflnqk*fv*ITNNYFFYFLKIFCYYYFYYHKMALVLPIFATENTLLVTENDLGRGFS VDDNGANAKKSNVYICTKEDMTTVR

  3. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB590 (Link to dictyBase) - - - Contig-U09552-1 VFB590P (Link... to Original site) VFB590F 225 VFB590Z 118 VFB590P 343 - - Show VFB590 Library VF (Link to library) Clone ID VFB590 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Original site URL http://dict...ed Amino Acid sequence IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEEXKT...--- ---riyqinkvvmxhxlhn*lxvaxivxlgxvnvkihvexix Frame C: IAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT

  4. Dicty_cDB: CHC113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS

  5. Dicty_cDB: VHP253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP253 (Link to dictyBase) - - - Contig-U16349-1 - (Link to Or...iginal site) - - VHP253Z 355 - - - - Show VHP253 Library VH (Link to library) Clone ID VHP253 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dictycdb.b...CTTGGGTACCAAGAACTGACCGTCAATTTGCTGGTTCATGGTTTGC sequence update 2002. 9.10 Translated Amino Acid sequence ---MQLFAGIKSICT...VPIMRMYFHTGILDYILFKSWVPRTDRQFAGSWF Translated Amino Acid sequence (All Frames) Frame A: ---MQLFAGIKSICTEMAMD

  6. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  7. Dicty_cDB: AFA460 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFA460 (Link to dictyBase) - - - Contig-U15574-1 AFA460Z (Link... to Original site) - - AFA460Z 170 - - - - Show AFA460 Library AF (Link to library) Clone ID AFA460 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...date 2001. 6. 2 Translated Amino Acid sequence ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK T...it* Frame B: ---QIHQTIQVVKITLSSASSSSSSSSSSILNKTRICTYINSNSTHSLXXNIYKYKLPK Frame C:

  8. Dicty_cDB: VHM522 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHM522 (Link to dictyBase) - - - Contig-U15767-1 VHM522P (Link... to Original site) VHM522F 575 VHM522Z 747 VHM522P 1302 - - Show VHM522 Library VH (Link to library) Clone ID VHM522 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...PV--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCEDKGKCLVGTC...rtrf q*cklss--- ---ITHVQVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTP VDCGANDEDKCKTWSCDPTKGGCQSTPVVCE

  9. Dicty_cDB: VHE138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE138 (Link to dictyBase) - - - Contig-U15767-1 VHE138P (Link... to Original site) VHE138F 569 VHE138Z 621 VHE138P 1170 - - Show VHE138 Library VH (Link to library) Clone ID VHE138 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...FVDNQAGDSXSAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQGF NDVSYP--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICT...rsi*i**fkllpn*rtrf q*ckls--- ---QVTCGGCETCSYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCG ANDEDKCKTWSCDPTKGG

  10. Dicty_cDB: VHD652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD652 (Link to dictyBase) - - - Contig-U15722-1 VHD652P (Link... to Original site) VHD652F 573 VHD652Z 707 VHD652P 1260 - - Show VHD652 Library VH (Link to library) Clone ID VHD652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...NYTIPCGSNSNNVLCGSYHSTVPRKYLSLGFVNGSTHSYSKDGLMITYISQDTTNDNDC KRYTTNV--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT...i*vlflql viilflvvvivimycvdhiiqlfhasifhwdllmavhiviaktd***hiyhriqqmimia kdiqqm*--- ---LVIIILVIVHAIMNILVMVVNSLNAHSIVQPPNGTCDINSGICT

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB603 (Link to dictyBase) - - - Contig-U16505-1 VFB603Z (Link... to Original site) - - VFB603Z 496 - - - - Show VFB603 Library VF (Link to library) Clone ID VFB603 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16505-1 Original site URL http://dict...al 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VF

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC221 (Link to dictyBase) - - - Contig-U09438-1 VFC221Z (Link... to Original site) - - VFC221Z 496 - - - - Show VFC221 Library VF (Link to library) Clone ID VFC221 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09438-1 Original site URL http://dict... mitochondrial 8.0 %: peroxisomal 4.0 %: cytoskeletal 4.0 %: Golgi >> prediction for VFC221 is cyt 5' end se

  13. Dicty_cDB: VHL663 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHL663 (Link to dictyBase) - - - Contig-U15767-1 VHL663P (Link... to Original site) VHL663F 574 VHL663Z 702 VHL663P 1256 - - Show VHL663 Library VH (Link to library) Clone ID VHL663 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...WPDGFKYFFVDNQAGDSESAKSGKNLPIQRDIELNWNGEAYEYSNSNYFPINGQG FNDVSYPV--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGILDGLPQG...ik rqelvgqmvlsifl*itklviqnlpnlvkifqfkeiss*igmekhmniviqitsqltdkv smm*aiq--- ---SYATGKCEPDSSLCNDNNICTIDICVHEGI

  14. SIS: a program to generate draft genome sequence scaffolds for prokaryotes

    Directory of Open Access Journals (Sweden)

    Dias Zanoni

    2012-05-01

    Full Text Available Abstract Background Decreasing costs of DNA sequencing have made prokaryotic draft genome sequences increasingly common. A contig scaffold is an ordering of contigs in the correct orientation. A scaffold can help genome comparisons and guide gap closure efforts. One popular technique for obtaining contig scaffolds is to map contigs onto a reference genome. However, rearrangements that may exist between the query and reference genomes may result in incorrect scaffolds, if these rearrangements are not taken into account. Large-scale inversions are common rearrangement events in prokaryotic genomes. Even in draft genomes it is possible to detect the presence of inversions given sufficient sequencing coverage and a sufficiently close reference genome. Results We present a linear-time algorithm that can generate a set of contig scaffolds for a draft genome sequence represented in contigs given a reference genome. The algorithm is aimed at prokaryotic genomes and relies on the presence of matching sequence patterns between the query and reference genomes that can be interpreted as the result of large-scale inversions; we call these patterns inversion signatures. Our algorithm is capable of correctly generating a scaffold if at least one member of every inversion signature pair is present in contigs and no inversion signatures have been overwritten in evolution. The algorithm is also capable of generating scaffolds in the presence of any kind of inversion, even though in this general case there is no guarantee that all scaffolds in the scaffold set will be correct. We compare the performance of sis, the program that implements the algorithm, to seven other scaffold-generating programs. The results of our tests show that sis has overall better performance. Conclusions sis is a new easy-to-use tool to generate contig scaffolds, available both as stand-alone and as a web server. The good performance of sis in our tests adds evidence that large

  15. Can Static Habitat Protection Encompass Critical Areas for Highly Mobile Marine Top Predators? Insights from Coastal East Africa.

    Directory of Open Access Journals (Sweden)

    Sergi Pérez-Jorge

    Full Text Available Along the East African coast, marine top predators are facing an increasing number of anthropogenic threats which requires the implementation of effective and urgent conservation measures to protect essential habitats. Understanding the role that habitat features play on the marine top predator' distribution and abundance is a crucial step to evaluate the suitability of an existing Marine Protected Area (MPA, originally designated for the protection of coral reefs. We developed species distribution models (SDM on the IUCN data deficient Indo-Pacific bottlenose dolphin (Tursiops aduncus in southern Kenya. We followed a comprehensive ecological modelling approach to study the environmental factors influencing the occurrence and abundance of dolphins while developing SDMs. Through the combination of ensemble prediction maps, we defined recurrent, occasional and unfavourable habitats for the species. Our results showed the influence of dynamic and static predictors on the dolphins' spatial ecology: dolphins may select shallow areas (5-30 m, close to the reefs (< 500 m and oceanic fronts (< 10 km and adjacent to the 100 m isobath (< 5 km. We also predicted a significantly higher occurrence and abundance of dolphins within the MPA. Recurrent and occasional habitats were identified on large percentages on the existing MPA (47% and 57% using presence-absence and abundance models respectively. However, the MPA does not adequately encompass all occasional and recurrent areas and within this context, we propose to extend the MPA to incorporate all of them which are likely key habitats for the highly mobile species. The results from this study provide two key conservation and management tools: (i an integrative habitat modelling approach to predict key marine habitats, and (ii the first study evaluating the effectiveness of an existing MPA for marine mammals in the Western Indian Ocean.

  16. Conundrums with penumbras: the right to privacy encompasses non-gamete providers who create preembryos with the intent to become parents.

    Science.gov (United States)

    Dillon, Lainie M C

    2003-05-01

    To date, five state high courts have resolved disputes over frozen preembryos. These disputes arose during divorce proceedings between couples who had previously used assisted reproduction and cryopreserved excess preembryos. In each case, one spouse wished to have the preembryos destroyed, while the other wanted to be able to use or donate them in the future. The parties in these cases invoked the constitutional right to privacy to argue for dispositional control over the preembryos; two of the five cases were resolved by relying on this right. The constitutional right to privacy protects intimate decisions involving procreation, marriage, and family life. However, when couples use donated sperm or ova to create preembryos, a unique circumstance arises: one spouse--the gamete provider--is genetically related to the preembryos and the other is not. If courts resolve frozen preembryo disputes that involve non-gamete providers based on the constitutional right to privacy, they should find that the constitutional right to privacy encompasses the interests of both gamete and non-gamete providers. Individuals who create preembryos with the intent to become a parent have made an intimate decision involving procreation, marriage, and family life that falls squarely within the the right to privacy. In such cases, the couple together made the decision to create a family through the use of assisted reproduction, and the preembryos would not exist but for that joint decision. Therefore, gamete and non-gamete providers should be afforded equal constitutional protection in disputes over frozen preembryos.

  17. Dicty_cDB: SHI251 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHI251 (Link to dictyBase) - - - Contig-U11819-1 - (Link to Or...iginal site) SHI251F 125 - - - - - - Show SHI251 Library SH (Link to library) Clone ID SHI251 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11819-1 Original site URL http://dictycdb.b...XX sequence update 2002.10.25 Translated Amino Acid sequence ilfqilkistnk**IKNYYVNRVYEIIIIINICT...YKKK--- Translated Amino Acid sequence (All Frames) Frame A: ilfqilkistnk**IKNYYVNRVYEIIIIINICT

  18. Dicty_cDB: SLJ344 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT TGGSTTGSHTTTGGSTTGSHTTTG---...li tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT

  19. Dicty_cDB: SFC534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC534 (Link to dictyBase) - - - Contig-U15579-1 SFC534P (Link... to Original site) SFC534F 158 SFC534Z 334 SFC534P 492 - - Show SFC534 Library SF (Link to library) Clone ID SFC534 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...fiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT...lfiyl**hymni*klenif*KLENIIKKRNKLIFNYKKK--- ---DPXIGCYYDKFDNCDACNAVDTCITNDLCFPRECNPRGXPPCLINPINCTSTDPCIF SYCENGVCIPTYICT

  20. Dicty_cDB: VHH756 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH756 (Link to dictyBase) - - - Contig-U15767-1 VHH756P (Link... to Original site) VHH756F 658 VHH756Z 686 VHH756P 1324 - - Show VHH756 Library VH (Link to library) Clone ID VHH756 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15767-1 Original site URL http://dict...YEYSNSNYFPINGQGF NDVSYPVPRGYVPISGESWTSMSTSTSLKGNNYNFC--- ---DSSLCNDNNICTIDICVHEGILDGLPQGNCSNTPVDCGANDEDKCKTW...*psw*fricqiw*kssnskryrvklewrsi*i**fkllpn*rtrfq *cklssskrlctnfwrildinvnfnfikg**l*fl--- ---DSSLCNDNNICTIDICVHE

  1. Dicty_cDB: SHD573 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD573 (Link to dictyBase) - - - Contig-U11503-1 SHD573E (Link...Clone ID SHD573 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...LFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGALWITSENINNENN NYTI...ststtts ax***d*eyyhcysyfgldl Frame C: fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCGFNN EPICTSLKD...vegicus clone CH230-428C17, WORKING DRAFT SEQUENCE, 3 unordered pieces. 48 3e-12 3 AC116984 |AC116984.2 Dict

  2. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB760 (Link to dictyBase) - - - Contig-U12286-1 VFB760P (Link... to Original site) VFB760F 474 VFB760Z 691 VFB760P 1165 - - Show VFB760 Library VF (Link to library) Clone ID VFB760 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12286-1 Original site URL http://dict...CCACTTAATTCCAGAAGG sequence update 2001. 6. 1 Translated Amino Acid sequence LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICT...cmfllqsfxnplnsrr Frame C: LLAYWNKCQVNSCDKTTGNCKPENLKCPDRSNECLKNTGCDDLTGCKYVSICTDS

  3. Dicty_cDB: VSK196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK196 (Link to dictyBase) - - - Contig-U10274-1 VSK196P (Link... to Original site) VSK196F 423 VSK196Z 453 VSK196P 876 - - Show VSK196 Library VS (Link to library) Clone ID VSK196 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10274-1 Original site URL http://dict...TTATNAACAATTAAAAAAAA sequence update 2001. 3.22 Translated Amino Acid sequence kdgklvslkdfikdqkpivlyfypkdetsict...*NKIX--- ---KLKVGDQAPDFTCPDKDGKLVSLKDFIKDQKPIVLYFYPKDETSICTKEACEFRDKY QKFIEAGADVI

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB670 (Link to dictyBase) - - - Contig-U16447-1 VFB670Z (Link... to Original site) - - VFB670Z 541 - - - - Show VFB670 Library VF (Link to library) Clone ID VFB670 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16447-1 Original site URL http://dict... 0.00 m_ : 1.00 44.0 %: nuclear 28.0 %: cytoplasmic 16.0 %: cytoskeletal 8.0 %: peroxisomal 4.0 %: mitochondrial >> predict

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB779 (Link to dictyBase) - - - Contig-U15331-1 VFB779P (Link... to Original site) VFB779F 328 VFB779Z 402 VFB779P 730 - - Show VFB779 Library VF (Link to library) Clone ID VFB779 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15331-1 Original site URL http://dict...cuolar 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB779 i

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB893 (Link to dictyBase) - - - Contig-U15009-1 VFB893P (Link... to Original site) VFB893F 337 VFB893Z 727 VFB893P 1064 - - Show VFB893 Library VF (Link to library) Clone ID VFB893 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15009-1 Original site URL http://dict... 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFB893

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB615 (Link to dictyBase) - - - Contig-U16602-1 VFB615F (Link... to Original site) VFB615F 636 - - - - - - Show VFB615 Library VF (Link to library) Clone ID VFB615 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16602-1 Original site URL http://dict...0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB615 is cyt 5' end seq. ID VFB615F

  8. A SYNOVIAL SARCOMA WITH A COMPLEX T(X/18/5/4) AND A BREAK IN THE ORNITHINE AMINOTRANSFERASE (OAT)LI CLUSTER ON XP11.2

    NARCIS (Netherlands)

    WEGHUIS, DO; STOEPKER, MEJ; DELEEUW, B; VANDENBERG, E; SUIJKERBUIJK, RF; MOLENAAR, WM; DEJONG, B; VANKESSEL, AG

    The initial cytogenetic analysis of a biphasic synovial sarcoma revealed complex anomalies involving six different chromosomes: 46,Y,t(X;18;5;4)(p11;q11;p13;q12),t(2;5)(q35;q11). After fluorescence in situ hybridization (FISH) analysis, using chromosome X-specific plasmid library and YAC probes, the

  9. A synovial sarcoma with a complex t(X;18;5;4) and a break in the ornithine aminotransferase (OAT)L1 cluster on Xp11.2.

    NARCIS (Netherlands)

    Weghuis, D Olde; Stoepker, M E; Leeuw, B de; van den Berg, Eva; Suijkerbuijk, R F; Molenaar, W M; Jong, B de; Kessel, A Geurts van

    1994-01-01

    The initial cytogenetic analysis of a biphasic synovial sarcoma revealed complex anomalies involving six different chromosomes: 46,Y,t(X;18;5;4)(p11;q11;p13;q12),t(2;5)(q35;q11). After fluorescence in situ hybridization (FISH) analysis, using chromosome X-specific plasmid library and YAC probes, the

  10. PAVE: Program for assembling and viewing ESTs

    Directory of Open Access Journals (Sweden)

    Bomhoff Matthew

    2009-08-01

    Full Text Available Abstract Background New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. Results The PAVE (Program for Assembling and Viewing ESTs assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. Conclusion The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  11. PAVE: program for assembling and viewing ESTs.

    Science.gov (United States)

    Soderlund, Carol; Johnson, Eric; Bomhoff, Matthew; Descour, Anne

    2009-08-26

    New sequencing technologies are rapidly emerging. Many laboratories are simultaneously working with the traditional Sanger ESTs and experimenting with ESTs generated by the 454 Life Science sequencers. Though Sanger ESTs have been used to generate contigs for many years, no program takes full advantage of the 5' and 3' mate-pair information, hence, many tentative transcripts are assembled into two separate contigs. The new 454 technology has the benefit of high-throughput expression profiling, but introduces time and space problems for assembling large contigs. The PAVE (Program for Assembling and Viewing ESTs) assembler takes advantage of the 5' and 3' mate-pair information by requiring that the mate-pairs be assembled into the same contig and joined by n's if the two sub-contigs do not overlap. It handles the depth of 454 data sets by "burying" similar ESTs during assembly, which retains the expression level information while circumventing time and space problems. PAVE uses MegaBLAST for the clustering step and CAP3 for assembly, however it assembles incrementally to enforce the mate-pair constraint, bury ESTs, and reduce incorrect joins and splits. The PAVE data management system uses a MySQL database to store multiple libraries of ESTs along with their metadata; the management system allows multiple assemblies with variations on libraries and parameters. Analysis routines provide standard annotation for the contigs including a measure of differentially expressed genes across the libraries. A Java viewer program is provided for display and analysis of the results. Our results clearly show the benefit of using the PAVE assembler to explicitly use mate-pair information and bury ESTs for large contigs. The PAVE assembler provides a software package for assembling Sanger and/or 454 ESTs. The assembly software, data management software, Java viewer and user's guide are freely available.

  12. 454 sequencing of pooled BAC clones on chromosome 3H of barley

    Directory of Open Access Journals (Sweden)

    Yamaji Nami

    2011-05-01

    Full Text Available Abstract Background Genome sequencing of barley has been delayed due to its large genome size (ca. 5,000Mbp. Among the fast sequencing systems, 454 liquid phase pyrosequencing provides the longest reads and is the most promising method for BAC clones. Here we report the results of pooled sequencing of BAC clones selected with ESTs genetically mapped to chromosome 3H. Results We sequenced pooled barley BAC clones using a 454 parallel genome sequencer. A PCR screening system based on primer sets derived from genetically mapped ESTs on chromosome 3H was used for clone selection in a BAC library developed from cultivar "Haruna Nijo". The DNA samples of 10 or 20 BAC clones were pooled and used for shotgun library development. The homology between contig sequences generated in each pooled library and mapped EST sequences was studied. The number of contigs assigned on chromosome 3H was 372. Their lengths ranged from 1,230 bp to 58,322 bp with an average 14,891 bp. Of these contigs, 240 showed homology and colinearity with the genome sequence of rice chromosome 1. A contig annotation browser supplemented with query search by unique sequence or genetic map position was developed. The identified contigs can be annotated with barley cDNAs and reference sequences on the browser. Homology analysis of these contigs with rice genes indicated that 1,239 rice genes can be assigned to barley contigs by the simple comparison of sequence lengths in both species. Of these genes, 492 are assigned to rice chromosome 1. Conclusions We demonstrate the efficiency of sequencing gene rich regions from barley chromosome 3H, with special reference to syntenic relationships with rice chromosome 1.

  13. Fine mapping of Best`s macular dystrophy localises the gene in close proximity to, but distinct from, the D115480/ROM1

    Energy Technology Data Exchange (ETDEWEB)

    Graff, C.; Ahlbom, B.E.; Anneren, G. [University Hospital, Uppsala (Sweden)] [and others

    1994-09-01

    Best`s macular dystrophy (BMD) is an autosomal dominant disease characterized by accumulation of lipofuscin beneath the pigment epithelium of the macula, leading to early-onset impairment of central vision. The gene has previously been mapped to 11q13. Based on DNA from 191 people from a large 12-generation family, the gene now has been mapped to a 1.5 cM interval between the markers Fc{epsilon}RI and D11S480/ROM1. By disequilibrium analysis the gene was estimated to be 0.321 cM centromeric to the marker D11S480. Since this on average corresponds to 300 kb, the gene may be at a distance contained in YAC molecules. To physically characterize this region, YAC clones positive for markers flanking BMD have been identified. Sequence analysis of the candidate gene ROM1 did not reveal any mutation. However, one recombination between intragenic ROM1 polymorphisms and BMD was detected, which make it highly unlikely that mutations in ROM1 are causing BMD.

  14. Use of arbitrary DNA primers, polyacrylamide gel electrophoresis and silver staining for identity testing, gene discovery and analysis of gene expression

    International Nuclear Information System (INIS)

    Gresshoff, P.

    1998-01-01

    To understand chemically-induced genomic differences in soybean mutants differing in their ability to enter the nitrogen-fixing symbiosis involving Bradyrhizobium japonicum, molecular techniques were developed to aid the map-based, or positional, cloning. DNA marker technology involving single arbitrary primers was used to enrich regional RFLP linkage data. Molecular techniques, including two-dimensional pulse field gel electrophoresis, were developed to ascertain the first physical mapping in soybean, leading to the conclusion that in the region of marker pA-36 on linkage group H, 1 cM equals about 500 cM. High molecular weight DNA was isolated and cloned into yeast or bacterial artificial chromosomes (YACs/ BACs). YACs were used to analyze soybean genome structure, revealing that over half of the genome contains repetitive DNA. Genetic and molecular tools are now available to facilitate the isolation of plant genes directly involved in symbiosis. The further characterization of these genes, along with the determination of the mechanisms that lead to the mutation, will be of value to other plants and induced mutation research. (author)

  15. Dicty_cDB: SHA393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  16. Dicty_cDB: SFE109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFE109 (Link to dictyBase) - - - Contig-U10771-1 SFE109P (Link... to Original site) SFE109F 197 SFE109Z 630 SFE109P 827 - - Show SFE109 Library SF (Link to library) Clone ID SFE109 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10771-1 Original site URL http://dict...anslated Amino Acid sequence elnykfhftlnttqiei*inknfllflf*fffyfqi*iqlcfilkllllptiink*INKI FLKKK--- ---VTTSQCESLIQAGVDGLRVGMGVGSICT...fkfnsvsy*nyyyyqpslink*ik ff*kk--- ---VTTSQCESLIQAGVDGLRVGMGVGSICTTQEVMACGRPQATAVFKCALYSSQYNVPI IADGGIRTIGHII

  17. Dicty_cDB: SFL482 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFL482 (Link to dictyBase) - - - Contig-U15494-1 SFL482P (Link... to Original site) SFL482F 434 SFL482Z 394 SFL482P 828 - - Show SFL482 Library SF (Link to library) Clone ID SFL482 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15494-1 Original site URL http://dict...cftclww*qmcqmcp*qnrscfln*rtknr*nclqeatkrfkt ker*EIIQINVVININHFLLIKKK--- ---ICTHIEKMVQRLTYRRRLSYRTTSNATKIVKTP...KQQK DLKQKKDKKSSK*m Translated Amino Acid sequence (All Frames) Frame A: icthiekmvqrltyrrrlsyrttsnatkivktpgg

  18. Dicty_cDB: SSL592 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSL592 (Link to dictyBase) - - - Contig-U14332-1 SSL592E (Link... to Original site) - - - - - - SSL592E 244 Show SSL592 Library SS (Link to library) Clone ID SSL592 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14332-1 Original site URL http://dict...ence niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k Translated Amino Acid...kqncitl*ikkinllkk Frame C: niyi*IYMFLTLIHLWTSKNTVIIFICTLNGI*ik*nnvkniyi*iyn*kkkkkklkn*h lvdlnktv*lyk*kkliy*k

  19. Dicty_cDB: CHN208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo

  20. Dicty_cDB: VSK446 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK446 (Link to dictyBase) - - - Contig-U15105-1 VSK446E (Link... Clone ID VSK446 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15105-1 Original site URL http://dict... r... 269 4e-71 AF402813_1( AF402813 |pid:none) Ictalurus punctatus 40S ribosomal ... 269 4e-71 FJ196315_1( ....00 84.0 %: cytoplasmic 12.0 %: mitochondrial 4.0 %: nuclear >> prediction for VSK446 is cyt 5' end seq. ID

  1. Dicty_cDB: SLH678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3

  2. Dicty_cDB: VHA386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA386 (Link to dictyBase) - - - Contig-U11201-1 - (Link to Or...iginal site) - - VHA386Z 730 - - - - Show VHA386 Library VH (Link to library) Clone ID VHA386 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11201-1 Original site URL http://dictycdb.b...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08646 |L08646.1 Dict...19 1 CX835130 |AF255664_1 major vault protein [Ictalurus punctatus], mRNA sequenc

  3. Dicty_cDB: SLD420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB689 (Link to dictyBase) - - - Contig-U16603-1 VFB689P (Link... to Original site) VFB689F 476 VFB689Z 663 VFB689P 1139 - - Show VFB689 Library VF (Link to library) Clone ID VFB689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...mbrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> prediction for VFB689 is cyt 5' end seq. ID

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB593 (Link to dictyBase) - - - Contig-U02438-1 VFB593E (Link...) Clone ID VFB593 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02438-1 Ori...0.009 6 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-25...sequence. 46 0.031 2 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 m...ap 4657875-4914984 strain AX4, complete sequence. 34 0.051 14 AC116960 |AC116960.2 Dictyostelium discoideum

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB551 (Link to dictyBase) - - - Contig-U16449-1 VFB551P (Link... to Original site) VFB551F 194 VFB551Z 178 VFB551P 372 - - Show VFB551 Library VF (Link to library) Clone ID VFB551 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16449-1 Original site URL http://dict...0 %: cytoplasmic 16.0 %: cytoskeletal 12.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: endoplasmic reticulum >> predict

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB490 (Link to dictyBase) - - - Contig-U16603-1 VFB490P (Link... to Original site) VFB490F 588 VFB490Z 683 VFB490P 1271 - - Show VFB490 Library VF (Link to library) Clone ID VFB490 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: extracellular, including cell wall 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB838 (Link to dictyBase) - - - Contig-U14973-1 VFB838P (Link... to Original site) VFB838F 562 VFB838Z 443 VFB838P 1005 - - Show VFB838 Library VF (Link to library) Clone ID VFB838 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14973-1 Original site URL http://dict...plasmic 12.0 %: Golgi 12.0 %: nuclear 4.0 %: plasma membrane 4.0 %: vesicles of secretory system 4.0 %: peroxisomal >> predict

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB625 (Link to dictyBase) - - - Contig-U13825-1 VFB625P (Link... to Original site) VFB625F 492 VFB625Z 685 VFB625P 1177 - - Show VFB625 Library VF (Link to library) Clone ID VFB625 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict... %: cytoplasmic 16.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane >> prediction for VFB625 is mit 5

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB677 (Link to dictyBase) - G02518 DDB0188526 Contig-U02066-1...brary) Clone ID VFB677 (Link to dictyBase) Atlas ID - NBRP ID G02518 dictyBase ID DDB0188526 Link to Contig ...Contig-U02066-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...nfnytrgccsygdl*wy*gtr*tih*kdr*lwcassfenfndtictit mfnr**sstwfeilskrsih*rgikc*hd*nh..._25( AC116960 |pid:none) Dictyostelium discoideum chromoso... 90 2e-16 CP001276_520( CP001276 |pid:none) The

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB742 (Link to dictyBase) - - - Contig-U14919-1 VFB742P (Link... to Original site) VFB742F 590 VFB742Z 468 VFB742P 1058 - - Show VFB742 Library VF (Link to library) Clone ID VFB742 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14919-1 Original site URL http://dict...mbrane 4.0 %: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB742 is cyt 5' end seq. ID VFB742

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB817 (Link to dictyBase) - - - Contig-U16229-1 VFB817P (Link... to Original site) VFB817F 504 VFB817Z 193 VFB817P 697 - - Show VFB817 Library VF (Link to library) Clone ID VFB817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16229-1 Original site URL http://dict...%: peroxisomal 4.0 %: endoplasmic reticulum >> prediction for VFB817 is cyt 5' end seq. ID VFB817F 5' end se

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB720 (Link to dictyBase) - - - Contig-U16603-1 VFB720P (Link... to Original site) VFB720F 521 VFB720Z 353 VFB720P 874 - - Show VFB720 Library VF (Link to library) Clone ID VFB720 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16603-1 Original site URL http://dict...: cytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFB720 is nuc 5' end se

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB644 (Link to dictyBase) - - - Contig-U10683-1 VFB644F (Link... to Original site) VFB644F 519 - - - - - - Show VFB644 Library VF (Link to library) Clone ID VFB644 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10683-1 Original site URL http://dict...7 9 AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-407176... %: nuclear 8.0 %: mitochondrial 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> predict

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB868 (Link to dictyBase) - - - Contig-U15649-1 VFB868F (Link... to Original site) VFB868F 110 - - - - - - Show VFB868 Library VF (Link to library) Clone ID VFB868 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15649-1 Original site URL http://dict...c 4.0 %: cytoskeletal >> prediction for VFB868 is nuc 5' end seq. ID VFB868F 5' end seq. >VFB868F.Seq TATTAA

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB804 (Link to dictyBase) - - - Contig-U13849-1 VFB804P (Link... to Original site) VFB804F 150 VFB804Z 637 VFB804P 787 - - Show VFB804 Library VF (Link to library) Clone ID VFB804 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13849-1 Original site URL http://dict... nuclear 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane 4.0 %: vesicles of secretory system >> predict

  20. Comparison between 125IUdR and 51Cr as cell labels in investigations of tumor cell migration

    DEFF Research Database (Denmark)

    Basse, P; Hokland, P; Hokland, M

    1991-01-01

    YAC-1 tumor cells double-labeled with Na2[51Cr]O4 [51Cr] and [125I]iododeoxyuridine [125IUdR] were injected intravenously into Balb/c mice in order to investigate their migration and fate 0-4 h after the injection. Whereas the clearance of tumor cells from the lung tissue was similar as judged...

  1. Association of coral algal symbionts with a diverse viral community responsive to heat shock

    KAUST Repository

    Brüwer, Jan D.

    2017-08-17

    Stony corals provide the structural foundation of coral reef ecosystems and are termed holobionts given they engage in symbioses, in particular with photosynthetic dinoflagellates of the genus Symbiodinium. Besides Symbiodinium, corals also engage with bacteria affecting metabolism, immunity, and resilience of the coral holobiont, but the role of associated viruses is largely unknown. In this regard, the increase of studies using RNA sequencing (RNA-Seq) to assess gene expression provides an opportunity to elucidate viral signatures encompassed within the data via careful delineation of sequence reads and their source of origin.Here, we re-analyzed an RNA-Seq dataset from a cultured coral symbiont (Symbiodinium microadriaticum, Clade A1) across four experimental treatments (control, cold shock, heat shock, dark shock) to characterize associated viral diversity, abundance, and gene expression. Our approach comprised the filtering and removal of host sequence reads, subsequent phylogenetic assignment of sequence reads of putative viral origin, and the assembly and analysis of differentially expressed viral genes. About 15.46% (123 million) of all sequence reads were non-host-related, of which <1% could be classified as archaea, bacteria, or virus. Of these, 18.78% were annotated as virus and comprised a diverse community consistent across experimental treatments. Further, non-host related sequence reads assembled into 56,064 contigs, including 4856 contigs of putative viral origin that featured 43 differentially expressed genes during heat shock. The differentially expressed genes included viral kinases, ubiquitin, and ankyrin repeat proteins (amongst others), which are suggested to help the virus proliferate and inhibit the algal host\\'s antiviral response.Our results suggest that a diverse viral community is associated with coral algal endosymbionts of the genus Symbiodinium, which prompts further research on their ecological role in coral health and resilience.

  2. Rare RNF213 variants in the C-terminal region encompassing the RING-finger domain are associated with moyamoya angiopathy in Caucasians.

    Science.gov (United States)

    Guey, Stéphanie; Kraemer, Markus; Hervé, Dominique; Ludwig, Thomas; Kossorotoff, Manoëlle; Bergametti, Françoise; Schwitalla, Jan Claudius; Choi, Simone; Broseus, Lucile; Callebaut, Isabelle; Genin, Emmanuelle; Tournier-Lasserve, Elisabeth

    2017-08-01

    Moyamoya angiopathy (MMA) is a cerebral angiopathy affecting the terminal part of internal carotid arteries. Its prevalence is 10 times higher in Japan and Korea than in Europe. In East Asian countries, moyamoya is strongly associated to the R4810K variant in the RNF213 gene that encodes for a protein containing a RING-finger and two AAA+ domains. This variant has never been detected in Caucasian MMA patients, but several rare RNF213 variants have been reported in Caucasian cases. Using a collapsing test based on exome data from 68 European MMA probands and 573 ethnically matched controls, we showed a significant association between rare missense RNF213 variants and MMA in European patients (odds ratio (OR)=2.24, 95% confidence interval (CI)=(1.19-4.11), P=0.01). Variants specific to cases had higher pathogenicity predictive scores (median of 24.2 in cases versus 9.4 in controls, P=0.029) and preferentially clustered in a C-terminal hotspot encompassing the RING-finger domain of RNF213 (P<10 -3 ). This association was even stronger when restricting the analysis to childhood-onset and familial cases (OR=4.54, 95% CI=(1.80-11.34), P=1.1 × 10 -3 ). All clinically affected relatives who were genotyped were carriers. However, the need for additional factors to develop MMA is strongly suggested by the fact that only 25% of mutation carrier relatives were clinically affected.

  3. Cybersemiotics: Suggestion for a Transdisciplinary Framework Encompassing Natural, Life, and Social Sciences as Well as Phenomenology and Humanities

    Directory of Open Access Journals (Sweden)

    Søren Brier

    2014-01-01

    Full Text Available The modern evolutionary paradigm combined with phenomenology forces us to view human consciousness as a product of evolution as well as accepting humans as observers from “within the universe”. The knowledge produced by science has first-person embodied consciousness combined with second-person meaningful communication in language as a prerequisite for third-person fallibilist scientific knowledge. Therefore, the study of consciousness forces us theoretically to encompass the natural and social sciences as well as the humanities in one framework of unrestricted or absolute naturalism. This means to view conscious quale life world with its intentionality as well as the intersubjectivity of culture as a part of nature, and therefore the whole human being as treated in modern bio-medicine. The ‘bio’ is not enough. The crucial question for a transdisciplinary theory of conscious human being is therefore: What is the role of consciousness, signs, and meaning in evolution as well as in cultural development? But this is problematic since the sciences in their present form are without concepts of qualia and meaning, and the European phenomenological-hermeneutic “sciences of meaning” does not have an evolutionary foundation. It is therefore interesting that C.S. Peirce phaneroscopic semiotics - in its modern form of a biosemiotics - was based on a phenomenological basis as well as an evolutionary thinking and ecology of sign webs at the same time drawing on knowledge from the sciences. To develop this 100 year old paradigm it is necessary to supplement it with the knowledge gained from the technologically founded information sciences, as well as systems, and cybernetics in order to produce a transdisciplinary alternative to logical positivism on the one hand and postmodern constructivism on the other. Cybersemiotics constructs such a non-reductionist naturalistic framework in order to integrate third-person knowledge from the exact sciences

  4. Dicty_cDB: SSB721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB721 (Link to dictyBase) ssb721 G20804 DDB0230090 Contig-U04...594-1 SSB721E (Link to Original site) - - - - - - SSB721E 549 Show SSB721 Library SS (Link to library) Clone ID SSB721 (Link to dict...yBase) Atlas ID ssb721 NBRP ID G20804 dictyBase ID DDB0230090 Link to Contig Contig-...U04594-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSB7-A/SSB72...quence update 1997.11.25 Translated Amino Acid sequence NDINSIVCKANSQCPTSHICTSSNKCIIKYSSKVGEKCTDSPLQCRVFNGEI

  5. Dicty_cDB: SLG865 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLG865 (Link to dictyBase) - G22488 DDB0184443 Contig-U04159-1... SLG865E (Link to Original site) - - - - - - SLG865E 373 Show SLG865 Library SL (Link to library) Clone ID SLG865 (Link to dict...yBase) Atlas ID - NBRP ID G22488 dictyBase ID DDB0184443 Link to Contig Contig-U04159-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLG8-C/SLG865Q.Seq.d/ ...quence update 1998. 6.28 Translated Amino Acid sequence KAQLETDLKNICTLVPSNITMECKF

  6. Dicty_cDB: VFB113 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd

  7. Dicty_cDB: CFE213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

  8. Dicty_cDB: SSF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s

  9. Dicty_cDB: VFI196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFI196 (Link to dictyBase) - - - Contig-U16512-1 - (Link to Or...iginal site) - - VFI196Z 168 - - - - Show VFI196 Library VF (Link to library) Clone ID VFI196 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16512-1 Original site URL http://dictycdb.b...ces. 40 8.8 1 CK407044 |CK407044.1 AUF_IfLvr_212_p04 Ictalurus furcatus liver cDNA library Ictalurus furcatu...%: nuclear 36.0 %: mitochondrial 16.0 %: cytoplasmic 4.0 %: cytoskeletal >> prediction for VFI196 is nuc 5'

  10. Dicty_cDB: SSB373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC171 (Link to dictyBase) - - - Contig-U16478-1 VFC171P (Link... to Original site) VFC171F 482 VFC171Z 633 VFC171P 1115 - - Show VFC171 Library VF (Link to library) Clone ID VFC171 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...ptttrlptt trlstttrlptttrlptttrlptttrlptttrlsttrlxtttrlstswctswctswictr ygswissrllcwynhs*l*t*c*sfkksnerywyk*i...ologous to C-terminal repeat sequence of rhodopsin and synaptophysin. 88 1e-15 3 X54062 |X54062.1 Dictyostel

  12. Dicty_cDB: VSE812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSE812 (Link to dictyBase) - - - Contig-U14773-1 VSE812E (Link... to Original site) - - - - - - VSE812E 721 Show VSE812 Library VS (Link to library) Clone ID VSE812 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14773-1 Original site URL http://dict...re E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...9 AF401554_1( AF401554 |pid:none) Ictalurus punctatus ribosomal prot... 132 1e-29 protein update 2009. 7.31

  13. Dicty_cDB: SSD329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD329 (Link to dictyBase) - - - Contig-U16581-1 SSD329F (Link... to Original site) SSD329F 444 - - - - - - Show SSD329 Library SS (Link to library) Clone ID SSD329 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide... DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictal

  14. Dicty_cDB: CFE853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE853 (Link to dictyBase) - - - Contig-U16381-1 CFE853F (Link... to Original site) CFE853F 109 - - - - - - Show CFE853 Library CF (Link to library) Clone ID CFE853 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyost...elium discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60

  15. Dicty_cDB: CFH668 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

  16. Dicty_cDB: SFD117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

  17. Dicty_cDB: AFK740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK740 (Link to dictyBase) - - - Contig-U16381-1 AFK740F (Link... to Original site) AFK740F 107 - - - - - - Show AFK740 Library AF (Link to library) Clone ID AFK740 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...es producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyosteliu...m discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60 gen

  18. Dicty_cDB: SLF689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict

  19. Dicty_cDB: CFH744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH744 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH744F 118 - - - - - - Show CFH744 Library CF (Link to library) Clone ID CFH744 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ng significant alignments: (bits) Value N X51892 |X51892.1 Dictyostelium discoide...um SP60 gene for spore coat protein. 80 1e-23 3 AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 m

  20. Dicty_cDB: SSJ546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSJ546 (Link to dictyBase) - - - Contig-U16581-1 SSJ546F (Link... to Original site) SSJ546F 445 - - - - - - Show SSJ546 Library SS (Link to library) Clone ID SSJ546 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoi...2, DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  1. Dicty_cDB: SSF689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF689 (Link to dictyBase) - - - Contig-U16581-1 SSF689F (Link... to Original site) SSF689F 443 - - - - - - Show SSF689 Library SS (Link to library) Clone ID SSF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum ...A sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictaluru

  2. Dicty_cDB: CFH713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH713 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH713F 133 - - - - - - Show CFH713 Library CF (Link to library) Clone ID CFH713 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  3. Dicty_cDB: CFH518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH518 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH518F 131 - - - - - - Show CFH518 Library CF (Link to library) Clone ID CFH518 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-22 3 AC115685 |AC115685.1 Dictyos

  4. Dicty_cDB: VHI285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

  5. Dicty_cDB: CHQ307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHQ307 (Link to dictyBase) - - - Contig-U16403-1 CHQ307P (Link... to Original site) CHQ307F 441 CHQ307Z 669 CHQ307P 1090 - - Show CHQ307 Library CH (Link to library) Clone ID CHQ307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16403-1 Original site URL http://dict...EDPATQLSSLKFESDKEKEQALLWAFLASYLPEDKGS LQKEFVKHVEYTLAQTKSECTDF--- ---fvmplvmkictslvlvlkrstk*rklfmmenshqtldglv...0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dict

  6. Dicty_cDB: VHH893 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH893 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - VHH893Z 385 - - - - Show VHH893 Library VH (Link to library) Clone ID VHH893 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...anio rerio alanyl-tRNA synthetase... 48 9e-05 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatus isolate C1

  7. Dicty_cDB: CHD534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

  8. Dicty_cDB: CFI225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI225 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFI225F 133 - - - - - - Show CFI225 Library CF (Link to library) Clone ID CFI225 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  9. Dicty_cDB: SSG552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG552 (Link to dictyBase) - - - Contig-U16581-1 - (Link to Or...iginal site) SSG552F 449 - - - - - - Show SSG552 Library SS (Link to library) Clone ID SSG552 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dictycdb.b...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide.... 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalc

  10. Dicty_cDB: SHE682 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE682 (Link to dictyBase) - - - Contig-U11295-1 - (Link to Or...iginal site) SHE682F 142 - - - - - - Show SHE682 Library SH (Link to library) Clone ID SHE682 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11295-1 Original site URL http://dictycdb.b... 2 CB936849 |CB936849.1 IpCGJx13_9_A11_23 IpCGJx13 Ictalurus punctatus cDNA clone...8.0 %: cytoplasmic 28.0 %: nuclear 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0

  11. Dicty_cDB: SHH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC175 (Link to dictyBase) - - - Contig-U16358-1 VFC175F (Link... to Original site) VFC175F 507 - - - - - - Show VFC175 Library VF (Link to library) Clone ID VFC175 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16358-1 Original site URL http://dict...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dict...eletal 4.0 %: mitochondrial 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for VFC175 is

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB606 (Link to dictyBase) - - - Contig-U16382-1 VFB606E (Link...) Clone ID VFB606 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...ucing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostelium discoideum gene for actin A8. 22...28 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 1685067-2...2028 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4, comple

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB714 (Link to dictyBase) - - - Contig-U12859-1 VFB714F (Link... to Original site) VFB714F 545 - - - - - - Show VFB714 Library VF (Link to library) Clone ID VFB714 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12859-1 Original site URL http://dict... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36936 |U36936.1 Dict...Score E Sequences producing significant alignments: (bits) Value U36936_1( U36936 |pid:none) Dictyostelium d

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB830 (Link to dictyBase) - - - Contig-U13825-1 VFB830P (Link... to Original site) VFB830F 566 VFB830Z 634 VFB830P 1200 - - Show VFB830 Library VF (Link to library) Clone ID VFB830 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13825-1 Original site URL http://dict...m3a: 0.00 m3b: 0.00 m_ : 1.00 56.0 %: mitochondrial 28.0 %: cytoplasmic 16.0 %: nuclear >> prediction for VF

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB667 (Link to dictyBase) - - - Contig-U13894-1 VFB667Z (Link... to Original site) - - VFB667Z 633 - - - - Show VFB667 Library VF (Link to library) Clone ID VFB667 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13894-1 Original site URL http://dict... update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117075 |AC117075.2 Dict...chondrial 4.0 %: vacuolar 4.0 %: peroxisomal >> prediction for VFB667 is cyt 5' e

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC129 (Link to dictyBase) - - - Contig-U16543-1 VFC129F (Link... to Original site) VFC129F 276 - - - - - - Show VFC129 Library VF (Link to library) Clone ID VFC129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16543-1 Original site URL http://dict... vs DNA Score E Sequences producing significant alignments: (bits) Value N M91382 |M91382.1 Dictyostelium di...scoideum thioredoxin (TRX2) mRNA, 5' end. 281 2e-96 3 M91384 |M91384.1 Dictyostelium discoideum thioredoxin

  1. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  2. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC222 (Link to dictyBase) - - - Contig-U16046-1 VFC222Z (Link... to Original site) - - VFC222Z 339 - - - - Show VFC222 Library VF (Link to library) Clone ID VFC222 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16046-1 Original site URL http://dict...pdate 2002.12.15 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116989 |AC116989.2 Dict...etical LO... 88 8e-17 AC115592_28( AC115592 |pid:none) Dictyostelium discoideum c

  3. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB776 (Link to dictyBase) - - - Contig-U13978-1 VFB776P (Link... to Original site) VFB776F 513 VFB776Z 602 VFB776P 1115 - - Show VFB776 Library VF (Link to library) Clone ID VFB776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13978-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N L41839 |L41839.1 Dictyoste....00 48.0 %: cytoplasmic 32.0 %: nuclear 16.0 %: cytoskeletal 4.0 %: peroxisomal >> predict

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC231 (Link to dictyBase) - - - Contig-U16593-1 VFC231P (Link... to Original site) VFC231F 428 VFC231Z 202 VFC231P 630 - - Show VFC231 Library VF (Link to library) Clone ID VFC231 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16593-1 Original site URL http://dict...amoeba histolytica genomic, DNA sequence. 48 0.13 1 AC116984 |AC116984.2 Dictyostelium discoideum chromosome...mbrane 4.0 %: vesicles of secretory system 4.0 %: extracellular, including cell wall >> predict

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB552 (Link to dictyBase) - - - Contig-U16480-1 VFB552P (Link... to Original site) VFB552F 529 VFB552Z 562 VFB552P 1091 - - Show VFB552 Library VF (Link to library) Clone ID VFB552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...nce (All Frames) Frame A: kvtv*liiylkiknetficisifdfsyfhcksrlpicfl*iq*iinwwc*rycssfky*w nnikyyi*fyniictkyticc...cuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: Golgi >> prediction for V

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB751 (Link to dictyBase) - - - Contig-U16480-1 VFB751P (Link... to Original site) VFB751F 134 VFB751Z 560 VFB751P 694 - - Show VFB751 Library VF (Link to library) Clone ID VFB751 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16480-1 Original site URL http://dict...4.0 %: endoplasmic reticulum >> prediction for VFB751 is cyt 5' end seq. ID VFB751F 5' end seq. >VFB751F.Seq

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB594 (Link to dictyBase) - G00395 DDB0218201 Contig-U09553-1...brary) Clone ID VFB594 (Link to dictyBase) Atlas ID - NBRP ID G00395 dictyBase ID DDB0218201 Link to Contig ...Contig-U09553-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB5-...s thaliana BAC F21J9 from chromosome I, complete sequence. 44 0.14 3 AC115612 |AC115612.2 Dictyostelium disc...: cytoskeletal 4.0 %: mitochondrial 4.0 %: vesicles of secretory system >> prediction for VFB594 is nuc 5' e

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB703 (Link to dictyBase) - - - Contig-U14188-1 VFB703Z (Link... to Original site) - - VFB703Z 680 - - - - Show VFB703 Library VF (Link to library) Clone ID VFB703 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14188-1 Original site URL http://dict...ENCE, 18 unordered pieces. 36 0.038 5 AC115680 |AC115680.2 Dictyostelium discoideum chromosome 2 map 4415041...4-226K1, *** SEQUENCING IN PROGRESS ***, 52 unordered pieces. 46 0.31 5 AC116977 |AC116977.2 Dict

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB662 (Link to dictyBase) - - - Contig-U15118-1 VFB662E (Link...) Clone ID VFB662 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15118-1 Ori... significant alignments: (bits) Value N AF039211 |AF039211.1 Dictyostelium discoideum ADP/ATP translocase mR...NA, complete cds. 1011 0.0 2 AF100676 |AF100676.1 Dictyostelium discoideum ADP/ATP translocase gene, complet...drial 4.0 %: extracellular, including cell wall 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> predict

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB843 (Link to dictyBase) - - - Contig-U15729-1 VFB843F (Link... to Original site) VFB843F 566 - - - - - - Show VFB843 Library VF (Link to library) Clone ID VFB843 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15729-1 Original site URL http://dict...roducing significant alignments: (bits) Value N U64830 |U64830.1 Dictyostelium discoideum AX2 protein tyrosi...ne kinase gene, complete cds. 1114 0.0 1 U01064 |U01064.1 Dictyostelium discoideum AX2 protein tyrosine kina

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB632 (Link to dictyBase) - - - Contig-U16585-1 VFB632Z (Link... to Original site) - - VFB632Z 181 - - - - Show VFB632 Library VF (Link to library) Clone ID VFB632 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16585-1 Original site URL http://dict...g significant alignments: (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657...%: cytoplasmic 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for VFB632 is nuc

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

  14. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  15. Comparative Transcriptome Analysis Identifies Candidate Genes Related to Skin Color Differentiation in Red Tilapia.

    Science.gov (United States)

    Zhu, Wenbin; Wang, Lanmei; Dong, Zaijie; Chen, Xingting; Song, Feibiao; Liu, Nian; Yang, Hui; Fu, Jianjun

    2016-08-11

    Red tilapia is becoming more popular for aquaculture production in China in recent years. However, the pigmentation differentiation in genetic breeding is the main problem limiting its development of commercial red tilapia culture and the genetic basis of skin color variation is still unknown. In this study, we conducted Illumina sequencing of transcriptome on three color variety red tilapia. A total of 224,895,758 reads were generated, resulting in 160,762 assembled contigs that were used as reference contigs. The contigs of red tilapia transcriptome had hits in the range of 53.4% to 86.7% of the unique proteins of zebrafish, fugu, medaka, three-spined stickleback and tilapia. And 44,723 contigs containing 77,423 simple sequence repeats (SSRs) were identified, with 16,646 contigs containing more than one SSR. Three skin transcriptomes were compared pairwise and the results revealed that there were 148 common significantly differentially expressed unigenes and several key genes related to pigment synthesis, i.e. tyr, tyrp1, silv, sox10, slc24a5, cbs and slc7a11, were included. The results will facilitate understanding the molecular mechanisms of skin pigmentation differentiation in red tilapia and accelerate the molecular selection of the specific strain with consistent skin colors.

  16. De novo characterisation of the greenlip abalone transcriptome (Haliotis laevigata) with a focus on the heat shock protein 70 (HSP70) family.

    Science.gov (United States)

    Shiel, Brett P; Hall, Nathan E; Cooke, Ira R; Robinson, Nicholas A; Strugnell, Jan M

    2015-02-01

    Abalone (Haliotis) are economically important molluscs for fisheries and aquaculture industries worldwide. Despite this, genomic resources for abalone and molluscs are still limited. Here we present a description and functional annotation of the greenlip abalone (Haliotis laevigata) transcriptome. We present a focused analysis on the heat shock protein 70 (HSP70) family of genes with putative functions affecting temperature stress and immunity. A total of ~38 million paired end Illumina reads were obtained, resulting in a Trinity assembly of 222,172 contigs with minimum length of 200 base pairs and maximum length of 33 kilobases. The 20,702 contigs were annotated with gene descriptions by BLAST. We created a program to maximise the number of functionally annotated genes, and over 10,000 contigs were assigned Gene ontologies (GO terms). By using CateGOrizer, immunity related GO terms for stressors such as heat, hypoxia, oxidative stress and wounding received the highest counts. Twenty-six contigs with homology to the HSP70 family of genes were identified. Ninety-one putative single-nucleotide polymorphisms were observed in the abalone HSP70 contigs. Eleven of these were considered non-synonymous. The annotated transcriptome described in this study will be a useful basis for future work investigating the genetic response of abalone to stress.

  17. A first generation integrated physical and genetic map of the rainbow trout genome

    Science.gov (United States)

    The rainbow trout physical map was previously constructed from DNA fingerprinting of 192,096 BAC clones using the 4-color high-information content fingerprinting (HICF) method. The clones were assembled into physical map contigs using the finger-printing contig (FPC) program. The map is composed of ...

  18. Integration of transcriptomic and proteomic data from a single wheat cultivar provides new tools for understanding the roles of individual alpha gliadin proteins in flour quality and celiac disease

    Science.gov (United States)

    One-hundred-thirty-six expressed sequence tags (ESTs) encoding alpha gliadins from Triticum aestivum cv Butte 86 were identified in public databases and assembled into 19 contigs. Consensus sequences for 12 of the contigs encoded complete alpha gliadin proteins, but only two were identical to protei...

  19. GenBank blastx search result: AK058655 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058655 001-018-F07 L47838.1 Bacillus subtilis (clone YAC15-6B) ponA gene, yppBCDEFG genes, ypqAE genes..., yprAB genes, cotD gene, ypsABC genes, rnaP gene, yptA gene, ypuA gene, kduDI genes, kdgRKAT genes, ypwA gene, complete cds's.|BCT BCT 7e-20 +1 ...

  20. GenBank blastx search result: AK062166 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062166 001-046-B08 L47838.1 Bacillus subtilis (clone YAC15-6B) ponA gene, yppBCDEFG genes, ypqAE genes..., yprAB genes, cotD gene, ypsABC genes, rnaP gene, yptA gene, ypuA gene, kduDI genes, kdgRKAT genes, ypwA gene, complete cds's.|BCT BCT 2e-12 +1 ...

  1. GenBank blastx search result: AK060500 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060500 001-017-F08 L47838.1 Bacillus subtilis (clone YAC15-6B) ponA gene, yppBCDEFG genes, ypqAE genes..., yprAB genes, cotD gene, ypsABC genes, rnaP gene, yptA gene, ypuA gene, kduDI genes, kdgRKAT genes, ypwA gene, complete cds's.|BCT BCT 1e-18 +1 ...

  2. Identifying wrong assemblies in de novo short read primary

    Indian Academy of Sciences (India)

    Finally, some mis-assembly detecting tools have been evaluated for their ability to detect the wrongly assembledprimary contigs, suggesting a lot of scope for improvement in this area. The present work also proposes a simpleunsupervised learning-based novel approach to identify mis-assemblies in the contigs which was ...

  3. A brain-specific gene cluster isolated from the region of the mouse obesity locus is expressed in the adult hypothalamus and during mouse development

    Energy Technology Data Exchange (ETDEWEB)

    Laig-Webster, M.; Lim, M.E.; Chehab, F.F. [Univ. of California, San Francisco, CA (United States)

    1994-09-01

    The molecular defect underlying an autosomal recessive form of genetic obesity in a classical mouse model C57 BL/6J-ob/ob has not yet been elucidated. Whereas metabolic and physiological disturbances such as diabetes and hypertension are associated with obesity, the site of expression and the nature of the primary lesion responsible for this cascade of events remains elusive. Our efforts aimed at the positional cloning of the ob gene by YAC contig mapping and gene identification have resulted in the cloning of a brain-specific gene cluster from the ob critical region. The expression of this gene cluster is remarkably complex owing to the multitude of brain-specific mRNA transcripts detected on Northern blots. cDNA cloning of these transcripts suggests that they are expressed from different genes as well as by alternate splicing mechanisms. Furthermore, the genomic organization of the cluster appears to consist of at least two identical promoters displaying CpG islands characteristic of housekeeping genes, yet clearly involving tissue-specific expression. Sense and anti-sense synthetic RNA probes were derived from a common DNA sequence on 3 cDNA clones and hybridized to 8-16 days mouse embryonic stages and mouse adult brain sections. Expression in development was noticeable as of the 11th day of gestation and confined to the central nervous system mainly in the telencephalon and spinal cord. Coronal and sagittal sections of the adult mouse brain showed expression only in 3 different regions of the brain stem. In situ hybridization to mouse hypothalamus sections revealed the presence of a localized and specialized group of cells expressing high levels of mRNA, suggesting that this gene cluster may also be involved in the regulation of hypothalamic activities. The hypothalamus has long been hypothesized as a primary candidate tissue for the expression of the obesity gene mainly because of its well-established role in the regulation of energy metabolism and food intake.

  4. Data set for diet specific differential gene expression analysis in three Spodoptera moths

    Directory of Open Access Journals (Sweden)

    A. Roy

    2016-09-01

    Full Text Available Examination of closely related species pairs is suggested for evolutionary comparisons of different degrees of polyphagy, which we did here with three taxa of lepidopteran herbivores, Spodoptera spp (S. littoralis, S. frugiperda maize (C and rice (R strains for a RNAseq analysis of the midguts from the 3rd instar insect larvae for differential metabolic responses after feeding on pinto bean based artificial diet vs maize leaves. Paired-end (2×100 bp Illumina HiSeq2500 sequencing resulted in a total of 24, 23, 24, and 21 million reads for the SF-C-Maize, SF-C-Pinto, SF-R-Maize, SF-R Pinto, and a total of 35 and 36 million reads for the SL-Maize and SL-Pinto samples, respectively. After quality control measures, a total of 62.2 million reads from SL and 71.7 million reads from SF were used for transcriptome assembly (TA. The resulting final de novo reference TA (backbone for the SF taxa contained 37,985 contigs with a N50 contig size of 1030 bp and a maximum contig length of 17,093 bp, while for SL, 28,329 contigs were generated with a N50 contig size of 1980 bp and a maximum contig length of 18,267 bp. The data presented herein contains supporting information related to our research article Roy et al. (2016 http://dx.doi.org/10.1016/j.ibmb.2016.02.006 [1]. Keywords: Differential expression analysis (DGE, Transcriptomics, Spodoptera, Adaptation, Generalist, Specialist, RPKM (reads per kilo base of transcript per million mapped reads, RNA seq

  5. Dicty_cDB: SSL472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSL472 (Link to dictyBase) - - - Contig-U14592-1 SSL472F (Link... to Original site) SSL472F 185 - - - - - - Show SSL472 Library SS (Link to library) Clone ID SSL472 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14592-1 Original site URL http://dict...group) genomic DNA, chromosome 6, PAC clone:P0036F10, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.59 1 AC114263 |AC114263.2 Dict...library Plasmodium falciparum 3D7 cDNA 5' similar to TR:O96129 O96129 PREDICTED MEMBRANE ASSOCIATED PROTEIN.

  6. Dicty_cDB: SSH414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH414 (Link to dictyBase) - - - Contig-U16581-1 SSH414Z (Link... to Original site) - - SSH414Z 448 - - - - Show SSH414 Library SS (Link to library) Clone ID SSH414 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium... SAMPLING. 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  7. Dicty_cDB: VHE867 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict

  8. Dicty_cDB: SSD571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD571 (Link to dictyBase) - - - Contig-U16581-1 SSD571Z (Link... to Original site) - - SSD571Z 415 - - - - Show SSD571 Library SS (Link to library) Clone ID SSD571 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...Brassica oleracea genomic clone BONRK12, DNA sequence. 50 0.025 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  9. Dicty_cDB: VHO349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHO349 (Link to dictyBase) - - - Contig-U11939-1 - (Link to Or...iginal site) - - VHO349Z 412 - - - - Show VHO349 Library VH (Link to library) Clone ID VHO349 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11939-1 Original site URL http://dictycdb.b...4 |CK424794.1 AUF_IpSto_12_h11 Stomach cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 42 6.1 1 dna...ial 8.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VHO349 is

  10. Dicty_cDB: CFH521 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH521 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH521F 134 - - - - - - Show CFH521 Library CF (Link to library) Clone ID CFH521 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict.... 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

  11. Dicty_cDB: FC-IC0102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC-IC (Link to library) FC-IC0102 (Link to dictyBase) - - - Contig-U16527-1 FC-IC01...02F (Link to Original site) FC-IC0102F 434 - - - - - - Show FC-IC0102 Library FC-IC (Link to library) Clone ...ID FC-IC0102 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16527-1 Original site URL http://dict... (bits) Value N AB088483 |AB088483.1 Dictyostelium discoideum gene for gamete and mating-type specific prote...oducing significant alignments: (bits) Value AB088483_1( AB088483 |pid:none) Dictyostelium discoideum gmsA g

  12. Dicty_cDB: SSK552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK552 (Link to dictyBase) - - - Contig-U04708-1 SSK552Z (Link... to Original site) - - SSK552Z 713 - - - - Show SSK552 Library SS (Link to library) Clone ID SSK552 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04708-1 Original site URL http://dict...equence. 40 0.26 5 BM029272 |BM029272.1 IpSkn00291 Skin cDNA library Ictalurus pu...0 m3a: 0.00 m3b: 0.00 m_ : 1.00 76.0 %: nuclear 20.0 %: cytoplasmic 4.0 %: plasma membrane >> prediction for

  13. Dicty_cDB: SSG335 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG335 (Link to dictyBase) - - - Contig-U16509-1 SSG335F (Link... to Original site) SSG335F 200 - - - - - - Show SSG335 Library SS (Link to library) Clone ID SSG335 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...y vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium d...iscoideum mRNA. 64 1e-17 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Icta

  14. Dicty_cDB: CFE801 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE801 (Link to dictyBase) - - - Contig-U12894-1 CFE801Z (Link... to Original site) - - CFE801Z 690 - - - - Show CFE801 Library CF (Link to library) Clone ID CFE801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12894-1 Original site URL http://dict...6e1 5', mRNA sequence. 36 5.4 2 CK426247 |CK426247.1 AUF_IpTes_24_l09 Testis cDNA library Ict...A26838 )prestalk protein precursor - slime mold (Dictyoste... 66 9e-10 AC117072_6

  15. Dicty_cDB: AFJ817 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFJ817 (Link to dictyBase) - - - Contig-U15574-1 AFJ817F (Link... to Original site) AFJ817F 172 - - - - - - Show AFJ817 Library AF (Link to library) Clone ID AFJ817 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15574-1 Original site URL http://dict...alue N AC116920 |AC116920.2 Dictyostelium discoideum chromosome 2 map 3879572-4071762 strain AX4, complete s...es. 42 1.1 2 BE213059 |BE213059.1 IpBrn01690 Brain cDNA library Ictalurus punctatus cDNA 5', mRNA sequence.

  16. Dicty_cDB: SSG316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG316 (Link to dictyBase) - - - Contig-U16509-1 SSG316F (Link... to Original site) SSG316F 231 - - - - - - Show SSG316 Library SS (Link to library) Clone ID SSG316 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideu...m mRNA. 64 3e-12 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  17. Dicty_cDB: FC-AY04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AY04 (Link to dictyBase) - - - Contig-U16521-1 FC-AY04Z (Li...nk to Original site) - - FC-AY04Z 583 - - - - Show FC-AY04 Library FC (Link to library) Clone ID FC-AY04 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16521-1 Original site URL http://dict...10 4 CA753827 |AF402814_1 ( AF402814 ) 40S ribosomal protein S6 [Ictalurus puncta...0.00 m_ : 1.00 92.0 %: cytoplasmic 4.0 %: mitochondrial 4.0 %: nuclear >> prediction for FC-AY04 is cyt 5' e

  18. Dicty_cDB: CHP827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Or...iginal site) CHP827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15898-1 Original site URL http://dictycdb.b...ments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain ...18q21 clone:RP11-866E20, WORKING DRAFT SEQUENCE, 18 unordered pieces. 42 0.073 4 CK406764 |CK406764.1 AUF_IfLvr_212_c09 Ict

  19. Dicty_cDB: AFI444 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFI444 (Link to dictyBase) - - - Contig-U16560-1 AFI444Z (Link... to Original site) - - AFI444Z 326 - - - - Show AFI444 Library AF (Link to library) Clone ID AFI444 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16560-1 Original site URL http://dict...e ... 109 2e-36 B27806( B27806 ) ubiquitin (clone lambda229) - slime mold (Dictyo...s... 109 2e-36 A27806( A27806 ) polyubiquitin 5 (clone pLK229) - slime mold (Dict... 109 6e-36 M19666_1( M19

  20. Dicty_cDB: SSE436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE436 (Link to dictyBase) - - - Contig-U16509-1 SSE436P (Link... to Original site) SSE436F 222 SSE436Z 178 SSE436P 400 - - Show SSE436 Library SS (Link to library) Clone ID SSE436 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...EQUENCING IN PROGRESS ***, 5 unordered pieces. 42 0.13 3 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  1. Dicty_cDB: SFF105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF105 (Link to dictyBase) - - - Contig-U14516-1 SFF105Z (Link... to Original site) - - SFF105Z 217 - - - - Show SFF105 Library SF (Link to library) Clone ID SFF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14516-1 Original site URL http://dict...pieces. 44 0.77 1 CF971786 |CF971786.1 AUB_IfLvr00258 Ictalurus furcatus liver cDNA library Ictalurus furcat...endoplasmic reticulum >> prediction for SFF105 is cyt 5' end seq. ID - 5' end seq. - Length of 5' end seq. -

  2. Dicty_cDB: SSF105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF105 (Link to dictyBase) - - - Contig-U16581-1 SSF105F (Link... to Original site) SSF105F 432 - - - - - - Show SSF105 Library SS (Link to library) Clone ID SSF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-126 3 BZ46365...028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  3. Dicty_cDB: SSG307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG307 (Link to dictyBase) - - - Contig-U16382-1 SSG307Z (Link... to Original site) - - SSG307Z 391 - - - - Show SSG307 Library SS (Link to library) Clone ID SSG307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...om clone CH211-202E12. 36 0.97 7 CF263546 |CF263546.1 AUA_IpTrk00012 Trunk kidney cDNA library Ictalurus pun...ytoskeletal 4.0 %: vacuolar 4.0 %: vesicles of secretory system >> prediction for SSG307 is nuc 5' end seq.

  4. Dicty_cDB: SSI468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  5. Dicty_cDB: SSK129 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK129 (Link to dictyBase) - - - Contig-U16021-1 SSK129Z (Link... to Original site) - - SSK129Z 372 - - - - Show SSK129 Library SS (Link to library) Clone ID SSK129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16021-1 Original site URL http://dict...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dict...419632 |CK419632.1 AUF_IpOva_21_i24 Ovary cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 36 0.54 2

  6. Dicty_cDB: SSC474 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC474 (Link to dictyBase) - - - Contig-U07719-1 SSC474P (Link... to Original site) SSC474F 368 SSC474Z 238 SSC474P 606 - - Show SSC474 Library SS (Link to library) Clone ID SSC474 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07719-1 Original site URL http://dict...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU071762 ) Dictyostelium di...scoideum slug cDNA, clone SSC474. 448 e-121 1 ( AU060185 ) Dictyostelium discoideum slug cDNA, clone SLA535.

  7. Dicty_cDB: CFC652 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFC652 (Link to dictyBase) - - - Contig-U02523-1 CFC652Z (Link... to Original site) - - CFC652Z 713 - - - - Show CFC652 Library CF (Link to library) Clone ID CFC652 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U02523-1 Original site URL http://dict... clone DKEY-104M9 in linkage group 19. 46 0.73 1 AC148615 |AC148615.2 Ictalurus punctatus clone CH212-99A22,...luding cell wall 4.0 %: peroxisomal >> prediction for CFC652 is mit 5' end seq. ID - 5' end seq. - Length of

  8. Dicty_cDB: SSD250 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD250 (Link to dictyBase) - - - Contig-U14716-1 SSD250E (Link... to Original site) - - - - - - SSD250E 491 Show SSD250 Library SS (Link to library) Clone ID SSD250 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14716-1 Original site URL http://dict...t alignments: (bits) Value N U20432 |U20432.1 Dictyostelium discoideum TagB (tagB) gene, complete cds. 151 1...cName: Full=Cytochrome b-c1 complex subunit 7; AltNam... 45 0.001 DQ399515_1( DQ399515 |pid:none) Ictalurus

  9. Dicty_cDB: FC-AK01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AK01 (Link to dictyBase) - - - Contig-U15038-1 FC-AK01E (Li...nk to Original site) - - - - - - FC-AK01E 996 Show FC-AK01 Library FC (Link to library) Clone ID FC-AK01 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15038-1 Original site URL http://dict...s clone omyk-evn... 172 6e-79 AF401557_1( AF401557 |pid:none) Ictalurus punctatus...reticulum 4.0 %: vacuolar >> prediction for FC-AK01 is mit 5' end seq. ID - 5' end seq. - Length of 5' end s

  10. Dicty_cDB: VSG286 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSG286 (Link to dictyBase) - - - Contig-U16209-1 VSG286E (Link... Clone ID VSG286 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...846 |BQ096846.1 IfHdk00487 Ictalurus furcatus head kidney cDNA library Ictalurus furcatus cDNA 5' similar to... Ribosomal protein Sa (laminin receptor 1), mRNA sequence. 46 2e-11 4 CK406973 |CK406973.1 AUF_IfLvr_212_m02 Ict...alurus furcatus liver cDNA library Ictalurus furcatus cDNA 5' similar to lami

  11. Dicty_cDB: SSF865 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF865 (Link to dictyBase) - - - Contig-U16581-1 SSF865Z (Link... to Original site) - - SSF865Z 436 - - - - Show SSF865 Library SS (Link to library) Clone ID SSF865 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...s producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-115...0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  12. Dicty_cDB: VSH207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

  13. Dicty_cDB: VFI685 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFI685 (Link to dictyBase) - - - Contig-U16455-1 - (Link to Or...iginal site) - - VFI685Z 189 - - - - Show VFI685 Library VF (Link to library) Clone ID VFI685 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dictycdb.b...ignments: (bits) Value N ( BJ432495 ) Dictyostelium discoideum cDNA clone:ddv18i22, 3' ... 313 1e-81 1 ( X55...973 ) D. discoideum EF1-I gene for elongation factor 1 al... 305 3e-79 1 ( AU285051 ) Dict

  14. Dicty_cDB: VSK324 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK324 (Link to dictyBase) - G24005 DDB0233069 Contig-U15575-1... VSK324F (Link to Original site) VSK324F 364 - - - - - - Show VSK324 Library VS (Link to library) Clone ID VSK324 (Link to dict...yBase) Atlas ID - NBRP ID G24005 dictyBase ID DDB0233069 Link to Contig Contig-U15575-1 O...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSK3-A/VSK324Q.Seq.d/ ...12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117070 |AC117070.2 Dict

  15. Dicty_cDB: VFK273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFK273 (Link to dictyBase) - - - Contig-U16028-1 | Contig-U16311-1 VFK2...73P (Link to Original site) VFK273F 633 VFK273Z 575 VFK273P 1188 - - Show VFK273 Library VF (Link to library) Clone ID VFK2...028-1 | Contig-U16311-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFK2-D/VFK2...73Q.Seq.d/ Representative seq. ID VFK273P (Link to Original site) Representative DNA sequence >VFK273 (VFK2...73Q) /CSM/VF/VFK2-D/VFK273Q.Seq.d/ AAATCTTTATTAATATTTTTCAAAATAAATAAATAAATAAATTAAAAATGAAAGTTTTAT

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC162 (Link to dictyBase) - - - Contig-U16455-1 VFC162P (Link... to Original site) VFC162F 367 VFC162Z 501 VFC162P 868 - - Show VFC162 Library VF (Link to library) Clone ID VFC162 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...elongation factor 1 alpha. 896 0.0 3 AF016242 |AF016242.1 Dictyostelium discoideu... vacuolar 4.0 %: mitochondrial 4.0 %: peroxisomal >> prediction for VFC162 is nuc 5' end seq. ID VFC162F 5'

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB612 (Link to dictyBase) - - - Contig-U16272-1 VFB612P (Link... to Original site) VFB612F 631 VFB612Z 640 VFB612P 1271 - - Show VFB612 Library VF (Link to library) Clone ID VFB612 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...es producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal prot...gi 4.0 %: plasma membrane >> prediction for VFB612 is nuc 5' end seq. ID VFB612F

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB611 (Link to dictyBase) - - - Contig-U16239-1 VFB611P (Link... to Original site) VFB611F 650 VFB611Z 704 VFB611P 1354 - - Show VFB611 Library VF (Link to library) Clone ID VFB611 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16239-1 Original site URL http://dict...ant alignments: (bits) Value N AC116989 |AC116989.2 Dictyostelium discoideum chro...mosome 2 map complement(3527391-3470188) strain AX4, complete sequence. 42 5e-10 9 AC116987 |AC116987.2 Dict

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB569 (Link to dictyBase) - - - Contig-U15456-1 VFB569E (Link...) Clone ID VFB569 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Ori...7 0.0 own update 2004. 8. 9 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dict...yostelium discoideum mRNA for cathepsin D. 2264 0.0 2 AJ243946 |AJ243946.1 Dictyoste...uclear 8.0 %: cytoplasmic 8.0 %: Golgi 8.0 %: endoplasmic reticulum >> prediction for VFB569 is exc 5' end s

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB489 (Link to dictyBase) - - - Contig-U16382-1 VFB489P (Link... to Original site) VFB489F 178 VFB489Z 501 VFB489P 679 - - Show VFB489 Library VF (Link to library) Clone ID VFB489 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...: (bits) Value N AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2...e cds. 783 0.0 3 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX4,

  1. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB847 (Link to dictyBase) - - - Contig-U16272-1 VFB847P (Link... to Original site) VFB847F 528 VFB847Z 749 VFB847P 1277 - - Show VFB847 Library VF (Link to library) Clone ID VFB847 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ...ear 24.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: plasma membrane 4.0 %: endoplasmic reticulum >> predictio

  2. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB788 (Link to dictyBase) - - - Contig-U14924-1 VFB788P (Link... to Original site) VFB788F 158 VFB788Z 768 VFB788P 926 - - Show VFB788 Library VF (Link to library) Clone ID VFB788 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14924-1 Original site URL http://dict... (bits) Value N AC115592 |AC115592.2 Dictyostelium discoideum chromosome 2 map 1-...2_6( AC115592 |pid:none) Dictyostelium discoideum chromosom... 520 e-146 CU459003_2449( CU459003 |pid:none)

  3. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB895 (Link to dictyBase) - - - Contig-U10164-1 VFB895P (Link... to Original site) VFB895F 578 VFB895Z 699 VFB895P 1277 - - Show VFB895 Library VF (Link to library) Clone ID VFB895 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10164-1 Original site URL http://dict...ore E Sequences producing significant alignments: (bits) Value N AC115604 |AC115604.2 Dictyostelium discoide...um chromosome 2 map 4354771-4414991 strain AX4, complete sequence. 42 5e-06 9 M18106 |M18106.1 Dictyostelium

  4. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB770 (Link to dictyBase) - - - Contig-U16382-1 VFB770E (Link...) Clone ID VFB770 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Ori...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyosteliu...m discoideum gene for actin A8. 2230 0.0 1 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map 16...deum actin 15 gene, complete cds. 2030 0.0 1 AC115579 |AC115579.2 Dictyostelium discoideum chromosome 2 map

  5. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC101 (Link to dictyBase) - - - Contig-U16544-1 VFC101Z (Link... to Original site) - - VFC101Z 556 - - - - Show VFC101 Library VF (Link to library) Clone ID VFC101 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16544-1 Original site URL http://dict...t alignments: (bits) Value N AY164994 |AY164994.1 Dictyostelium discoideum RTNLC (RTNLC) mRNA, complete cds.... 969 0.0 2 AY164656 |AY164656.1 Dictyostelium discoideum RTNLC (RTNLC) gene, complete cds. 565 0.0 3 AL71386

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC280 (Link to dictyBase) - - - Contig-U16349-1 VFC280Z (Link... to Original site) - - VFC280Z 627 - - - - Show VFC280 Library VF (Link to library) Clone ID VFC280 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AJ315489 |AJ315489.1 Dict...: vacuolar 4.0 %: Golgi 4.0 %: nuclear 4.0 %: vesicles of secretory system >> prediction for VFC280 is end 5

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB645 (Link to dictyBase) - - - Contig-U16382-1 VFB645P (Link... to Original site) VFB645F 619 VFB645Z 413 VFB645P 1032 - - Show VFB645 Library VF (Link to library) Clone ID VFB645 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N X03281 |X03281.1 Dictyostel...ium discoideum gene for actin A8. 1174 0.0 2 AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 map

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC187 (Link to dictyBase) - - - Contig-U12289-1 VFC187P (Link... to Original site) VFC187F 411 VFC187Z 678 VFC187P 1089 - - Show VFC187 Library VF (Link to library) Clone ID VFC187 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12289-1 Original site URL http://dict... N AC117176 |AC117176.2 Dictyostelium discoideum chromosome 2 map 5018074-5200947... strain AX4, complete sequence. 36 0.008 12 AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 map 2

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC212 (Link to dictyBase) - - - Contig-U16455-1 VFC212P (Link... to Original site) VFC212F 260 VFC212Z 343 VFC212P 603 - - Show VFC212 Library VF (Link to library) Clone ID VFC212 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16455-1 Original site URL http://dict...actor 1 alpha. 394 0.0 3 X55972 |X55972.1 D. discoideum EF1-II gene for elongation factor 1 alpha. 347 0.0 3...4.0 %: vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction fo

  11. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB837 (Link to dictyBase) - - - Contig-U14985-1 VFB837P (Link... to Original site) VFB837F 606 VFB837Z 689 VFB837P 1295 - - Show VFB837 Library VF (Link to library) Clone ID VFB837 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14985-1 Original site URL http://dict... 13 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-256737...0 strain AX4, complete sequence. 38 2e-05 15 AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB733 (Link to dictyBase) - - - Contig-U16279-1 VFB733P (Link... to Original site) VFB733F 608 VFB733Z 663 VFB733P 1271 - - Show VFB733 Library VF (Link to library) Clone ID VFB733 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16279-1 Original site URL http://dict...es producing significant alignments: (bits) Value N U23957 |U23957.1 Dictyostelium discoideum P52D mRNA, com...15 e-114 U23957_1( U23957 |pid:none) Dictyostelium discoideum P52D mRNA, co... 41

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB862 (Link to dictyBase) - - - Contig-U16311-1 VFB862P (Link... to Original site) VFB862F 624 VFB862Z 720 VFB862P 1344 - - Show VFB862 Library VF (Link to library) Clone ID VFB862 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16311-1 Original site URL http://dict...s) Value N U72746 |U72746.1 Dictyostelium discoideum cysteine proteinase (cprG) m...RNA, complete cds. 1209 0.0 5 U72745 |U72745.1 Dictyostelium discoideum cysteine proteinase (cprF) mRNA, com

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB736 (Link to dictyBase) - - - Contig-U16272-1 VFB736F (Link... to Original site) VFB736F 628 - - - - - - Show VFB736 Library VF (Link to library) Clone ID VFB736 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict....12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 m_ : 1.00 68.0 %: nuclear 16.0 %: cytoplasmic 8.0 %: cytoskeletal 4.0 %: mitochondrial 4.0 %: plasma membrane >> predict

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC265 (Link to dictyBase) - - - Contig-U16459-1 VFC265Z (Link... to Original site) - - VFC265Z 278 - - - - Show VFC265 Library VF (Link to library) Clone ID VFC265 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16459-1 Original site URL http://dict...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC123513 |AC123513.1 Dictyos...telium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***. 159 9e-77 4 AC117070 |AC117070.2 Dict

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB574 (Link to dictyBase) - - - Contig-U16382-1 VFB574P (Link... to Original site) VFB574F 508 VFB574Z 686 VFB574P 1194 - - Show VFB574 Library VF (Link to library) Clone ID VFB574 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromo...some 2 map 1685067-2090751 strain AX4, complete sequence. 1352 0.0 4 AC116986 |AC116986.2 Dict

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC255 (Link to dictyBase) - - - Contig-U16272-1 VFC255P (Link... to Original site) VFC255F 198 VFC255Z 525 VFC255P 723 - - Show VFC255 Library VF (Link to library) Clone ID VFC255 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...oducing significant alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal protein (...ic 32.0 %: nuclear 4.0 %: Golgi 4.0 %: mitochondrial >> prediction for VFC255 is cyt 5' end seq. ID VFC255F

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB559 (Link to dictyBase) - - - Contig-U16272-1 VFB559P (Link... to Original site) VFB559F 307 VFB559Z 624 VFB559P 931 - - Show VFB559 Library VF (Link to library) Clone ID VFB559 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...alignments: (bits) Value N L08391 |L08391.1 Dictyostelium discoideum ribosomal pr...toplasmic 16.0 %: mitochondrial 4.0 %: nuclear >> prediction for VFB559 is cyt 5' end seq. ID VFB559F 5' end

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB769 (Link to dictyBase) - - - Contig-U15456-1 VFB769P (Link... to Original site) VFB769F 625 VFB769Z 690 VFB769P 1315 - - Show VFB769 Library VF (Link to library) Clone ID VFB769 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...roducing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin... D. 1257 0.0 3 AJ243946 |AJ243946.1 Dictyostelium discoideum ctsD gene for cathep

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB524 (Link to dictyBase) - - - Contig-U14169-1 VFB524Z (Link... to Original site) - - VFB524Z 233 - - - - Show VFB524 Library VF (Link to library) Clone ID VFB524 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14169-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N AC116305 |AC116305.2 Dict... cds. 40 0.81 2 Z70204 |Z70204.1 Caenorhabditis elegans cosmid C11G6. 40 2.7 2 AC117176 |AC117176.2 Dictyost

Some links on this page may take you to non-federal websites. Their policies may differ from this site.