WorldWideScience

Sample records for yac contig encompassing

  1. YAC contig information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 8908/lsdba.nbdc00318-06-001 Description of data contents YAC contigs on the rice chromosomes Data file File name: rgp_physical...map_yac_contigs.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_contigs#en Data acquisition method The range including YAC con...m Description Chrom. No. Chromosome number Region Region number Physical map image The file name of rice physical...n Download License Update History of This Database Site Policy | Contact Us YAC contig information - RGP physicalmap | LSDB Archive ...

  2. Construction of a YAC contig and STS map spanning 2.5 Mbp in Xq25, the critical region for the X-linked lymphoproliferative (XLP) gene

    Energy Technology Data Exchange (ETDEWEB)

    Lanyi, A.; Li, B.F.; Li, S. [Univ. of Nebraska Medical Center, Omaha, NE (United States)] [and others

    1994-09-01

    X-linked lymphoproliferative disease (XLP) is characterized by a marked vulnerability in Epstein-Barr virus (EBV) infection. Infection of XLP patients with EBV invariably results in fatal mononucleosis, agammaglobulinemia or B-cell lymphoma. The XLP gene lies within a 10 cM region in Xq25 between DXS42 and DXS10. Initial chromosome studies revealed an interstitial, cytogenetically visible deletion in Xq25 in one XLP family (43-004). We estimated the size of the Xq25 deletion by dual laser flow karyotyping to involve 2% of the X chromosome, or approximately 3 Mbp of DNA sequences. To further delineate the deletion we performed a series of pulsed field gel electrophoresis (PFGE) analyses which showed that DXS6 and DXS100, two Xq25-specific markers, are missing from 45-004 DNA. Five yeast artificial chromosomes (YACs) from a chromosome X specific YAC library containing sequences deleted in patient`s 43-004 DNA were isolated. These five YACs did not overlap, and their end fragments were used to screen the CEPH MegaYAC library. Seven YACs were isolated from the CEPH MegaYAC library. They could be arranged into a contig which spans between DXS6 and DXS100. The contig contains a minimum of 2.5 Mbp of human DNA. A total of 12 YAC end clone, lambda subclones and STS probes have been used to order clones within the contig. These reagents were also used in Southern blot and patients showed interstitial deletions in Xq25. The size of these deletions range between 0.5 and 2.5 Mbp. The shortest deletion probably represents the critical region for the XLP gene.

  3. A 1.7-Mb YAC contig around the human BDNF gene (11p13): integration of the physical, genetic, and cytogenetic maps in relation to WAGR syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Rosier, M.F.; Martin, A.; Houlgatte, R. [Genetique Moleculaire et Biologie du Development, Villejuif (France)] [and others

    1994-11-01

    WAGR (Wilms tumor, aniridia, genito-urinary abnormalities, mental retardation) syndrome in humans is associated with deletions of the 11p13 region. The brain-derived neurotrophic factor (BDNF) gene maps to this region, and its deletion seems to contribute to the severity of the patient`s mental retardation. Yeast artificial chromosomes (YACs) carrying the BDNF gene have been isolated and characterized. Localization of two known exons of this gene leads to a minimal estimation of its size of about 40 kb. Chimerism of the BDNF YACs has been investigated by fluorescence in situ hybridization and chromosome assignment on somatic cell hybrids. Using the BDNF gene, YAC end sequence tagged sites (STS), and Genethon microsatellite markers, the authors constructed a 1.7-Mb contig and refined the cytogenetic map at 11p13. The resulting integrated physical, genetic, and cytogenetic map constitutes a resource for the characterization of genes that may be involved in the WAGR syndrome. 42 refs., 2 figs., 3 tabs.

  4. Development of a YAC contig covering the minimal region of a CSNB1 locus in Xp11

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Gratton, K.J.; Moore, B.J. [Univ. of Calgary (Canada)] [and others

    1994-09-01

    X-linked congenital stationary night blindness (CSNB1) is an eye disorder that includes impairment of night vision, reduced visual acuity and, in some cases, myopia and congenital nystagmus. Electroretinography reveals a marked reduction of the b-wave in affected individuals suggesting that X-linked CSNB is due to a molecular defect in the bipolar layer of the retina. Based on our studies of a large four generation family with X-linked CSNB, a CSNB1 locus was mapped to a 4-5 cM region at Xp11.23-Xp11.22 bounded telomerically by DXS426 and centromerically by DXS988. Using a panel of radiation and conventional somatic cell hybrids, a detailed map of new and published STSs has been generated for the minimal region of CSNB1. PCR primer pairs for STSs has been generated for the minimal region of CSNB1. PCR primer pairs for twenty-five STSs, including eleven end-clones, were used to isolate YAC clones from CEPH, mega-CEPH, and X chromosome-specific YAC libraries. In total, fifty-two YACs were characterized for STS overlaps and assembled to provide a minimum of 3 Mb of physical coverage in the region between DXS426 and DXS988. Five gaps proximal to SYP are still to be closed. Our physical map suggests the following gene order: Xpter-OTAL1-GF1-DXS1011E-MG81-HUMCRAS2P-SYP-Xcen. STS analysis of the YACs revealed three subregions of the physical map which appear to be particularly susceptible to internal deletions and end-clone analysis demonstrated chimerism in six of seventeen YACs. A physical map of Xp11.23-Xp11.22 will provide a resource for the isolation of candidate genes for the X-linked CSNB gene which maps to this region.

  5. Mapping of the locus for autosomal dominant amelogenesis imperfecta (AIH2) to a 4-Mb YAC contig on chromosome 4q11-q21

    Energy Technology Data Exchange (ETDEWEB)

    Kaerrman, C.; Holmgren, G.; Forsman, K. [Univ. Hospital, Umea (Sweden)]|[Univ. of Umea (Sweden)] [and others

    1997-01-15

    Amelogenesis imperfecta (Al) is a clinically and genetically heterogeneous group of inherited enamel defects. We recently mapped a locus for autosomal dominant local hypoplastic amelogenesis imperfecta (AIH2) to the long arm of chromosome 4. The disease gene was localized to a 17.6-cM region between the markers D4S392 and D4S395. The albumin gene (ALB), located in the same interval, was a candidate gene for autosomal dominant AI (ADAI) since albumin has a potential role in enamel maturation. Here we describe refined mapping of the AIH2 locus and the construction of marker maps by radiation hybrid mapping and yeast artificial chromosome (YAC)-based sequence tagged site-content mapping. A radiation hybrid map consisting of 11 microsatellite markers in the 5-cM interval between D4S409 and D4S1558 was constructed. Recombinant haplotypes in six Swedish ADAI families suggest that the disease gene is located in the interval between D4S2421 and ALB. ALB is therefore not likely to be the disease-causing gene. Affected members in all six families share the same allele haplotypes, indicating a common ancestral mutation in all families. The AIH2 critical region is less than 4 cM and spans a physical distance of approximately 4 Mb as judged from radiation hybrid maps. A YAC contig over the AIH2 critical region including several potential candidate genes was constructed. 35 refs., 4 figs., 1 tab.

  6. A YAC contig and an EST map in the pericentromeric region of chromosome 13 surrounding the loci for neurosensory nonsyndromic deafness (DFNB1 and DFNA3) and Limb-Girdle muscular dystrophy type 2C (LGMD2C)

    Energy Technology Data Exchange (ETDEWEB)

    Guilford, P.; Crozet, F.; Blanchard, S. [Institut Pasteur, Paris (France)] [and others

    1995-09-01

    Two forms of inherited childhood nonsyndromic deafness (DFNB1 and DFNA3) and a Duchenne-like form of progressive muscular dystrophy (LGMD2C) have been mapped to the pericentromeric region of chromosome 13. To clone the genes responsible for these diseases we constructed a yeast artificial chromosome (YAC) contig spanning an 8-cM region between the polymorphic markers D13S221. The contig comprises 24 sequence-tagged sites, among which 15 were newly obtained. This contig allowed us to order the polymorphic markers centromere- D13S175-D13S141-D13S143-D13S115-AFM128yc1-D13S292-D13S283-AFM323vh5-D13S221-telomere. Eight expressed sequence tags, previously assigned to 13q11-q12 (D13S182E, D13S183E, D13S502E, D13S504E, D13S505E, D13S837E, TUBA2, ATP1AL1), were localized on the YAC contig. YAC screening of a cDNA library derived from mouse cochlea allowed us to identify an {alpha}-tubulin gene (TUBA2) that was subsequently precisely mapped within the candidate region. 36 refs., 2 figs., 2 tabs.

  7. Refined mapping and YAC contig construction of the X-linked cleft palate and ankyloglossia locus (CPX) including the proximal X-Y homology breakpoint within Xq21.3

    Energy Technology Data Exchange (ETDEWEB)

    Forbes, S.A.; Brennan, L.; Richardson, M. [Queen Charlotte`s Hospital, London (United Kingdom)] [and others

    1996-01-01

    The gene for X-linked cleft palate (CPX) has previously been mapped in an Icelandic kindred between the unordered proximal markers DXS1002/DXS349/DXS95 and the distal marker DXYS1X, which maps to the proximal end of the X-Y homology region in Xq21.3. Using six sequence-tagged sites (STSs) within the region, a total of 91 yeast artificial chromosome (YAC) clones were isolated and overlapped in a single contig that spans approximately 3.1 Mb between DXS1002 and DXYS1X. The order of microsatellite and STS markers in this was established as DXS1002-DXS1168-DXS349-DXS95-DXS364-DXS1196-DXS472-DXS1217-DXYS1X. A long-range restriction map of this region was created using eight nonchimeric, overlapping YAC clones. Analysis of newly positioned polymorphic markers in recombinant individuals from the Icelandic family has enabled us to identify DXS1196 and DXS1217 as the flanking markers for CPX. The maximum physical distance containing the CPX gene has been estimated to be 2.0 Mb, which is spanned by a minimum set of five nonchimeric YAC clones. In addition, YAC end clone and STS analyses have pinpointed the location of the proximal boundary of the X-Y homology region within the map. 40 refs., 2 figs., 2 tabs.

  8. Construction of a yeast artifical chromosome contig spanning the spinal muscular atrophy disease gene region

    Energy Technology Data Exchange (ETDEWEB)

    Kleyn, P.W.; Wang, C.H.; Vitale, E.; Pan, J.; Ross, B.M.; Grunn, A.; Palmer, D.A.; Warburton, D.; Brzustowicz, L.M.; Gilliam, T.G. (New York State Psychiatric Institute, NY (United States)); Lien, L.L.; Kunkel, L.M. (Howard Hughes Medical Institute, Boston, MA (United States))

    1993-07-15

    The childhood spinal muscular atrophies (SMAs) are the most common, serious neuromuscular disorders of childhood second to Duchenne muscular dystrophy. A single locus for these disorders has been mapped by recombination events to a region of 0.7 centimorgan (range, 0.1-2.1 centimorgans) between loci D5S435 and MAP1B on chromosome 5q11.2-13.3. By using PCR amplification to screen yeast artificial chromosome (YAC) DNA pools and the PCR-vectorette method to amplify YAC ends, a YAC contig was constructed across the disease gene region. Nine walk steps identified 32 YACs, including a minimum of seven overlapping YAC clones (average size, 460 kb) that span the SMA region. The contig is characterized by a collection of 30 YAC-end sequence tag sites together with seven genetic markers. The entire YAC contig spans a minimum of 3.2 Mb; the SMA locus is confined to roughly half of this region. Microsatellite markers generated along the YAC contig segregate with the SMA locus in all families where the flanking markers (D5S435 and MAP1B) recombine. Construction of a YAC contig across the disease gene region is an essential step in isolation of the SMA-encoding gene. 26 refs., 3 figs., 1 tab.

  9. High-resolution YAC-cosmid-STS map of human chromosome 13.

    Science.gov (United States)

    Cayanis, E; Russo, J J; Kalachikov, S; Ye, X; Park, S H; Sunjevaric, I; Bonaldo, M F; Lawton, L; Venkatraj, V S; Schon, E; Soares, M B; Rothstein, R; Warburton, D; Edelman, I S; Zhang, P; Efstratiadis, A; Fischer, S G

    1998-01-01

    We have assembled a high-resolution physical map of human chromosome 13 DNA (approximately 114 Mb) from hybridization, PCR, and FISH mapping data using a specifically designed set of computer programs. Although the mapping of 13p is limited, 13q (approximately 98 Mb) is covered by an almost continuous contig of 736 YACs aligned to 597 contigs of cosmids. Of a total of 10,789 cosmids initially selected from a chromosome 13-specific cosmid library (16,896 colonies) using inter-Alu PCR probes from the YACs and probes for markers mapped to chromosome 13, 511 were assembled in contigs that were established from cross-hybridization relationships between the cosmids. The 13q YAC-cosmid map was annotated with 655 sequence tagged sites (STSs) with an average spacing of 1 STS per 150 kb. This set of STSs, each identified by a D number and cytogenetic location, includes database markers (198), expressed sequence tags (93), and STSs generated by sequencing of the ends of cosmid inserts (364). Additional annotation has been provided by positioning 197 cosmids mapped by FISH on 13q. The final (comprehensive) map, a list of STS primers, and raw data used in map assembly are available at our Web site (genome1.ccc.columbia.edu/ approximately genome/) and can serve as a resource to facilitate accurate localization of additional markers, provide substrates for sequencing, and assist in the discovery of chromosome 13 genes associated with hereditary diseases.

  10. Transfer of an expression YAC into goat fetal fibroblasts by cell fusion for mammary gland bioreactor

    International Nuclear Information System (INIS)

    Zhang Xufeng; Wu Guoxiang; Chen, Jian-Quan; Zhang Aimin; Liu Siguo; Jiao Binghua; Cheng Guoxiang

    2005-01-01

    Yeast artificial chromosomes (YACs) as transgenes in transgenic animals are likely to ensure optimal expression levels. Microinjection of YACs is the exclusive technique used to produce YACs transgenic livestock so far. However, low efficiency and high cost are its critical restrictive factors. In this study, we presented a novel procedure to produce YACs transgenic livestock as mammary gland bioreactor. A targeting vector, containing the gene of interest-a human serum albumin minigene (intron 1, 2), yeast selectable marker (G418R), and mammalian cell resistance marker (neo r ), replaced the α-lactalbumin gene in a 210 kb human α-lactalbumin YAC by homogeneous recombination in yeasts. The chimeric YAC was introduced into goat fetal fibroblasts using polyethylene glycol-mediated spheroplast fusion. PCR and Southern analysis showed that intact YAC was integrated in the genome of resistant cells. Perhaps, it may offer a cell-based route by nuclear transfer to produce YACs transgenic livestock

  11. YAC clone information - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available 08/lsdba.nbdc00318-06-002 Description of data contents YAC clones selected with DNA markers Data file File name: rgp_physical...map_yac_clones.zip File URL: ftp://ftp.biosciencedbc.jp/archive/rgp-physicalmap/LATEST/rgp_physical...sciencedbc.jp/togodb/view/rgp_physicalmap_yac_clones#en Data acquisition method YAC clones selected with RGP...rom. No. Chromosome number Region Region number Physical map image The file name of rice physical map Order ...bout This Database Database Description Download License Update History of This Database Site Policy | Contact Us YAC clone information - RGP physicalmap | LSDB Archive ...

  12. Contig Maps and Genomic Sequencing Identify Candidate Genes in the Usher 1C Locus

    Science.gov (United States)

    Higgins, Michael J.; Day, Colleen D.; Smilinich, Nancy J.; Ni, L.; Cooper, Paul R.; Nowak, Norma J.; Davies, Chris; de Jong, Pieter J.; Hejtmancik, Fielding; Evans, Glen A.; Smith, Richard J.H.; Shows, Thomas B.

    1998-01-01

    Usher syndrome 1C (USH1C) is a congenital condition manifesting profound hearing loss, the absence of vestibular function, and eventual retinal degeneration. The USH1C locus has been mapped genetically to a 2- to 3-cM interval in 11p14–15.1 between D11S899 and D11S861. In an effort to identify the USH1C disease gene we have isolated the region between these markers in yeast artificial chromosomes (YACs) using a combination of STS content mapping and Alu–PCR hybridization. The YAC contig is ∼3.5 Mb and has located several other loci within this interval, resulting in the order CEN-LDHA-SAA1-TPH-D11S1310-(D11S1888/KCNC1)-MYOD1-D11S902D11S921-D11S1890-TEL. Subsequent haplotyping and homozygosity analysis refined the location of the disease gene to a 400-kb interval between D11S902 and D11S1890 with all affected individuals being homozygous for the internal marker D11S921. To facilitate gene identification, the critical region has been converted into P1 artificial chromosome (PAC) clones using sequence-tagged sites (STSs) mapped to the YAC contig, Alu–PCR products generated from the YACs, and PAC end probes. A contig of >50 PAC clones has been assembled between D11S1310 and D11S1890, confirming the order of markers used in haplotyping. Three PAC clones representing nearly two-thirds of the USH1C critical region have been sequenced. PowerBLAST analysis identified six clusters of expressed sequence tags (ESTs), two known genes (BIR,SUR1) mapped previously to this region, and a previously characterized but unmapped gene NEFA (DNA binding/EF hand/acidic amino-acid-rich). GRAIL analysis identified 11 CpG islands and 73 exons of excellent quality. These data allowed the construction of a transcription map for the USH1C critical region, consisting of three known genes and six or more novel transcripts. Based on their map location, these loci represent candidate disease loci for USH1C. The NEFA gene was assessed as the USH1C locus by the sequencing of an amplified NEFA

  13. A 2-megabase physical contig incorporating 43 DNA markers on the human X chromosome at p11.23-p11.22 from ZNF21 to DXS255

    Energy Technology Data Exchange (ETDEWEB)

    Boycott, K.M.; Bech-Hansen, N.T. [Univ. of Calgary, Alberta (Canada); Halley, G.R.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States)

    1996-05-01

    A comprehensive physical contig of yeast artificial chromosomes (YACs) and cosmid clones between ZNF21 and DXS255 has been constructed, spanning 2 Mb within the region Xp11.23-p11.22. As a portion of the region was found to be particularly unstable in yeast, the integrity of the contig is dependent on additional information provided by the sequence-tagged site (STS) content of cosmid clones and DNA marker retention in conventional and radiation hybrids. The contig was formatted with 43 DNA markers, including 19 new STSs from YAC insert ends and an internal Alu-PCR product. The density of STSs across the contig ranges from one marker every 20 kb to one every 60 kb, with an average density of one marker every 50 kb. The relative order of previously known gene and expressed sequence tags in this region is predicted to be Xpter-ZNF21-DXS7465E (MG66)-DXS7927E (MG81)-WASP, DXS1011E, DXS7467E (MG21)-DXS-7466E (MG44)-GATA1-DXS7469E (Xp664)-TFE3-SYP (DXS1007E)-Xcen. This contig extends the coverage in Xp11 and provides a framework for the future identification and mapping of new genes, as well as the resources for developing DNA sequencing templates. 47 refs., 1 fig., 4 tabs.

  14. Genetic and physical analysis of a YAC contig spanning the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.; Hille, J.; Nijkamp, H.J.J.

    1998-01-01

    The Alternaria stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped on

  15. Genetic and physical analysis of a YAC contig spannig the fungal disease resistance locus Asc of tomato (Lycopersicon esculentum)

    NARCIS (Netherlands)

    Mesbah, L.A.; Kneppers, T.J.A.; Takken, F.L.W.; Laurent, P.J.F.; Hille, J.; Nijkamp, H.J.J.

    1999-01-01

    The Alternaria in stem canker disease of tomato is caused by the necrotrophic fungal pathogen Alternaria alternata f. sp. lycopersici (AAL). The fungus produces AAL toxins that kill the plant tissue. Resistance to the fungus segregates as a single locus, called Asc, and has been genetically mapped

  16. The human MCP-2 gene (SCYA8): Cloning, sequence analysis, tissue expression, and assignment to the CC chemokine gene contig on chromosome 17q11.2

    Energy Technology Data Exchange (ETDEWEB)

    Van Coillie, E.; Fiten, P.; Van Damme, J.; Opdenakker, G. [Univ. of Leuven (Belgium)] [and others

    1997-03-01

    Monocyte chemotactic proteins (MCPs) form a subfamily of chemokines that recruit leukocytes to sites of inflammation and that may contribute to tumor-associated leukocyte infiltration and to the antiviral state against HIV infection. With the use of degenerate primers that were based on CC chemokine consensus sequences, the known MIP-1{alpha}/LD78{alpha}, MCP-1, and MCP-3 genes and the previously unidentified eotaxin and MCP-2 genes were isolated from a YAC contig from human chromosome 17q11.2. The amplified genomic MCP-2 fragment was used to isolate an MCP-2 cosmid from which the gene sequence was determined. The MCP-2 gene shares with the MCP-1 and MCP-3 genes a conserved intron-exon structure and a coding nucleotide sequence homology of 77%. By Northern blot analysis the 1.0-kb MCP-2 mRNA was predominantly detectable in the small intestine, peripheral blood, heart, placenta, lung, skeletal muscle, ovary, colon, spinal cord, pancreas, and thymus. Transcripts of 1.5 and 2.4 kb were found in the testis, the small intestine, and the colon. The isolation of the MCP-2 gene from the chemokine contig localized it on YAC clones of chromosome 17q11.2, which also contain the eotaxin, MCP-1, MCP-3, and NCC-1/MCP-4 genes. The combination of using degenerate primer PCR and YACs illustrates that novel genes can efficiently be isolated from gene cluster contigs with less redundancy and effort than the isolation of novel ESTs. 42 refs., 5 figs., 2 tabs.

  17. A method for high efficiency YAC lipofection into murine embryonic stem cells.

    Science.gov (United States)

    Lee, J T; Jaenisch, R

    1996-01-01

    We describe a modified protocol for introducing yeast artificial chromosomes (YACs) into murine embryonic stem (ES) cells by lipofection. With a decreased DNA:cell ratio, increased concentration of condensing agents and altered culture conditions, this protocol reduces the requirement for YAC DNA to a few micrograms, improves the recovery of neomycin-resistant ES colonies and increases the yield of clones containing both flanking vector markers and insert. These modifications enable generation of sufficient 'intact' transgenic clones for biological analysis with a single experiment. PMID:9016681

  18. AcEST: CL1889Contig1 [AcEST

    Lifescience Database Archive (English)

    Full Text Available CL1889Contig1 491 2 Adiantum capillus-veneris contig: CL1889contig1 sequence. Link ...apillus-veneris contig: CL1889contig1 sequence. Link to clone list Link to clone list Clone ID BP919609 BP91

  19. Efecto de gelificantes en la formulación de dulce de yacón

    OpenAIRE

    Maldonado,Silvina; Singh,Judith del Carmen

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  20. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  1. Dicty_cDB: Contig-U09694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

  2. Cellular, molecular and functional characterisation of YAC transgenic mouse models of Friedreich ataxia.

    Directory of Open Access Journals (Sweden)

    Sara Anjomani Virmouni

    Full Text Available Friedreich ataxia (FRDA is an autosomal recessive neurodegenerative disorder, caused by a GAA repeat expansion mutation within intron 1 of the FXN gene. We have previously established and performed preliminary characterisation of several human FXN yeast artificial chromosome (YAC transgenic FRDA mouse models containing GAA repeat expansions, Y47R (9 GAA repeats, YG8R (90 and 190 GAA repeats and YG22R (190 GAA repeats.We now report extended cellular, molecular and functional characterisation of these FXN YAC transgenic mouse models. FXN transgene copy number analysis of the FRDA mice demonstrated that the YG22R and Y47R lines each have a single copy of the FXN transgene while the YG8R line has two copies. Single integration sites of all transgenes were confirmed by fluorescence in situ hybridisation (FISH analysis of metaphase and interphase chromosomes. We identified significant functional deficits, together with a degree of glucose intolerance and insulin hypersensitivity, in YG8R and YG22R FRDA mice compared to Y47R and wild-type control mice. We also confirmed increased somatic GAA repeat instability in the cerebellum and brain of YG22R and YG8R mice, together with significantly reduced levels of FXN mRNA and protein in the brain and liver of YG8R and YG22R compared to Y47R.Together these studies provide a detailed characterisation of our GAA repeat expansion-based YAC transgenic FRDA mouse models that will help investigations of FRDA disease mechanisms and therapy.

  3. Yeast artificial chromosome cloning in the glycerol kinase and adrenal hypoplasia congenita region of Xp21

    Energy Technology Data Exchange (ETDEWEB)

    Worley, K.C.; Ellison, K.A.; Zhang, Y.H.; Wang, D.F.; Mason, J.; Roth, E.J.; Adams, V.; Fogt, D.D.; Zhu, X.M.; Towbin, J.A. [Baylor College of Medicine, Houston, TX (United States)] [and others

    1993-05-01

    The adrenal hypoplasia congenita (AHC) and glycerol kinase (GK) loci are telomeric to the Duchenne muscular dystrophy locus in Xp21. The authors developed a pair of yeast artificial chromosome (YAC) contigs spanning at least 1.2 Mb and encompassing the region from the telomeric end of the Duchenne muscular dystrophy (DMD) locus to beyond YHX39 (DXS727), including the genes for AHC and GK. The centromeric contig consists of 13 YACs reaching more than 600 kb from DMD through GK. The telomeric contig group consists of 8 YACs containing more than 600 kb including the markers YHX39 (DXS727) and QST-59 (DXS319). Patient deletion breakpoints in the region of the two YAC contigs define at least eight intervals, and seven deletion breakpoints are contained within these contigs. In addition to the probes developed from YAC ends, they have mapped eight Alu-PCR probes amplified from a radiation-reduced somatic cell hybrid, two anonymous DNA probes, and one Alu-PCR product amplified from a cosmid end, for a total of 26 new markers within this region of 2 Mb or less. One YAC in the centromeric contig contains an insert encompassing the minimum interval for GK deficiency defined by patient deletion breakpoints, and this clone includes all or part of the GK gene. 33 refs., 3 figs., 5 tabs.

  4. Evaluation of Texture Profile, Color and Determination of FOS in Yacón Products (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Valeria Cristina Del Castillo

    2016-07-01

    Full Text Available Textural characteristics, color and fructooligosaccharides (FOS content, in yacón root products (syrup and dried snack subjected to different pretreatments with NaCl, blanching and ascorbic acid were evaluated. Yacón from Salta Capital, with 8 months of growth were used. Texture profiles and Color were evaluated instrumentally and FOS content by HPLC. There were significant differences between the samples treated with NaCl and the ones treated by blanching and ascorbic acid for fracture strength, fracture number and hardness according to pretreatment used, and for hardness and tackiness by the drying time. Regarding to color: longer drying time reduces sample brightness. In processed products the FOS content is lower than in fresh yacón, but higher in sucrose, glucose and fructose.

  5. Dicty_cDB: Contig-U15828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

  6. Dicty_cDB: Contig-U01750-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

  7. Dicty_cDB: Contig-U07021-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  8. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

  9. Dicty_cDB: Contig-U09720-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

  10. Dicty_cDB: Contig-U15005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

  11. Dicty_cDB: Contig-U07545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

  12. Dicty_cDB: Contig-U15359-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

  13. Dicty_cDB: Contig-U09379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

  14. Dicty_cDB: Contig-U09581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

  15. Dicty_cDB: Contig-U16108-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16108-1 gap included 1456 4 1889609 1888449 MINUS 4 6 U16108 0 0 2 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U16108-1 Contig ID Contig-U16108-1 Contig update 2004. 6.11 Contig sequence >Contig-U16108-1 (Contig-U16108-1Q) /CSM_Contig/Contig-U1610...AAAATCA TAAAATCAAAAATTGTATAATTAAAATAAAAATAAAAAAAAAAACAAAAA TAAAAAAAAAAAACAA Gap gap included Contig length 1...DFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIGDNFYTKTGYNEIAETNNIIILYPQALET...---NYVNNDNIKTMFDIQSEHAFITNSFGNNCTYLGPDYINNCNFNAPWDFLSQFYGELN QPSLNNLTENIITIDQSSFIPIGYTTITAGLNNFAYAYIPTSCKNDKSLCSIHVAFHGCL QTVATIG

  16. Dicty_cDB: Contig-U04729-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

  17. Dicty_cDB: Contig-U06929-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

  18. Dicty_cDB: Contig-U15566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

  19. Dicty_cDB: Contig-U10406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

  20. Dicty_cDB: Contig-U15525-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

  1. Dicty_cDB: Contig-U04334-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

  2. Dicty_cDB: Contig-U10335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

  3. Dicty_cDB: Contig-U13974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

  4. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  5. Dicty_cDB: Contig-U16457-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

  6. Dicty_cDB: Contig-U04768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

  7. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  8. Dicty_cDB: Contig-U11883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

  9. Dicty_cDB: Contig-U13326-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

  10. Dicty_cDB: Contig-U15036-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

  11. Dicty_cDB: Contig-U16008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

  12. Dicty_cDB: Contig-U11404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

  13. Dicty_cDB: Contig-U13680-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

  14. Dicty_cDB: Contig-U15718-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

  15. Dicty_cDB: Contig-U15573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

  16. Dicty_cDB: Contig-U11342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

  17. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  18. Dicty_cDB: Contig-U13455-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

  19. Dicty_cDB: Contig-U14400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

  20. Dicty_cDB: Contig-U09569-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

  1. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  2. Dicty_cDB: Contig-U15306-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

  3. Dicty_cDB: Contig-U01791-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01791-1 no gap 527 2 7629792 7630319 PLUS 1 1 U01791 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01791-1 Contig ID Contig-U01791-1 Contig update 2001. 8.29 Contig sequence >Contig-U01791-1 (Contig...-U01791-1Q) /CSM_Contig/Contig-U01791-1Q.Seq.d GTTTGATTATAATTTATATGAATGTGAAATTAGACAAGCATTATCAAATA ...TCGTTCCCTTATGATTTAAGAACAACTTT GAATAGTTACAGAAATGGTGAATTTAGTATTTATCAATAAATTTTTTTTT AAAGATTTATAATTAAAATAAAAAAAA Gap no gap Contig...SILWSIESIGSLIVSAQINDDRETMELLHRYQIPQKFLIPLF QILALIDQLEKDLSHQIELDKFTINRDYYFLKSFSNLIEPPLNCLGILKTSRPHFRIFKL VGKNMISQVLETIG

  4. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

  5. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  6. Dicty_cDB: Contig-U12357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

  7. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  8. Dicty_cDB: Contig-U12049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

  9. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

  10. Dicty_cDB: Contig-U14772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

  11. Dicty_cDB: Contig-U11141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

  12. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  13. Dicty_cDB: Contig-U09480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

  14. Dicty_cDB: Contig-U12043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

  15. Dicty_cDB: Contig-U13202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

  16. Dicty_cDB: Contig-U15062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

  17. Dicty_cDB: Contig-U16467-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

  18. Dicty_cDB: Contig-U09345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

  19. Dicty_cDB: Contig-U09432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

  20. Dicty_cDB: Contig-U15323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

  1. Dicty_cDB: Contig-U14236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

  2. Dicty_cDB: Contig-U06822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

  3. Dicty_cDB: Contig-U08861-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

  4. Dicty_cDB: Contig-U15058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

  5. Dicty_cDB: Contig-U06829-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

  6. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  7. Dicty_cDB: Contig-U14745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

  8. Dicty_cDB: Contig-U13254-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

  9. Dicty_cDB: Contig-U03367-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

  10. Dicty_cDB: Contig-U13891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

  11. Dicty_cDB: Contig-U16093-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

  12. Dicty_cDB: Contig-U12073-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

  13. Dicty_cDB: Contig-U16086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

  14. Dicty_cDB: Contig-U06384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

  15. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

  16. Dicty_cDB: Contig-U06307-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

  17. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  18. Dicty_cDB: Contig-U09615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

  19. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

  20. Dicty_cDB: Contig-U15541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

  1. Dicty_cDB: Contig-U10291-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY

  2. Dicty_cDB: Contig-U13065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

  3. Mice lacking caspase-2 are protected from behavioral changes, but not pathology, in the YAC128 model of Huntington disease

    Directory of Open Access Journals (Sweden)

    Bissada Nagat

    2011-08-01

    Full Text Available Abstract Background Huntington Disease (HD is a neurodegenerative disorder in which caspase activation and cleavage of substrates, including the huntingtin protein, has been invoked as a pathological mechanism. Specific changes in caspase-2 (casp2 activity have been suggested to contribute to the pathogenesis of HD, however unique casp2 cleavage substrates have remained elusive. We thus utilized mice completely lacking casp2 (casp2-/- to examine the role played by casp2 in the progression of HD. This 'substrate agnostic' approach allows us to query the effect of casp2 on HD progression without pre-defining proteolytic substrates of interest. Results YAC128 HD model mice lacking casp2 show protection from well-validated motor and cognitive features of HD, including performance on rotarod, swimming T-maze, pre-pulse inhibition, spontaneous alternation and locomotor tasks. However, the specific pathological features of the YAC128 mice including striatal volume loss and testicular degeneration are unaltered in mice lacking casp2. The application of high-resolution magnetic resonance imaging (MRI techniques validates specific neuropathology in the YAC128 mice that is not altered by ablation of casp2. Conclusions The rescue of behavioral phenotypes in the absence of pathological improvement suggests that different pathways may be operative in the dysfunction of neural circuitry in HD leading to behavioral changes compared to the processes leading to cell death and volume loss. Inhibition of caspase-2 activity may be associated with symptomatic improvement in HD.

  4. Dicty_cDB: Contig-U04432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600 Chro...ni**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

  5. Dicty_cDB: Contig-U13894-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

  6. Dicty_cDB: Contig-U15462-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

  7. A theoretical framework for an access programme encompassing ...

    African Journals Online (AJOL)

    A theoretical framework for an access programme encompassing further education training: remedy for educational wastage? ... learners who have dropped out of school without completing their secondary-school education, there are the special needs of adult learners in the workplace that must be taken into consideration.

  8. Encompassing Sexual Medicine within Psychiatry: Pros and Cons

    Science.gov (United States)

    Segraves, Robert Taylor

    2010-01-01

    Objective: This article examines the positive and negative aspects of psychiatry encompassing sexual medicine within its purview. Methods: MEDLINE searches for the period between 1980 to the present were performed with the terms "psychiatry," "sexual medicine," and "sexual dysfunction." In addition, sexual medicine texts were reviewed for chapters…

  9. Educational NASA Computational and Scientific Studies (enCOMPASS)

    Science.gov (United States)

    Memarsadeghi, Nargess

    2013-01-01

    Educational NASA Computational and Scientific Studies (enCOMPASS) is an educational project of NASA Goddard Space Flight Center aimed at bridging the gap between computational objectives and needs of NASA's scientific research, missions, and projects, and academia's latest advances in applied mathematics and computer science. enCOMPASS achieves this goal via bidirectional collaboration and communication between NASA and academia. Using developed NASA Computational Case Studies in university computer science/engineering and applied mathematics classes is a way of addressing NASA's goals of contributing to the Science, Technology, Education, and Math (STEM) National Objective. The enCOMPASS Web site at http://encompass.gsfc.nasa.gov provides additional information. There are currently nine enCOMPASS case studies developed in areas of earth sciences, planetary sciences, and astrophysics. Some of these case studies have been published in AIP and IEEE's Computing in Science and Engineering magazines. A few university professors have used enCOMPASS case studies in their computational classes and contributed their findings to NASA scientists. In these case studies, after introducing the science area, the specific problem, and related NASA missions, students are first asked to solve a known problem using NASA data and past approaches used and often published in a scientific/research paper. Then, after learning about the NASA application and related computational tools and approaches for solving the proposed problem, students are given a harder problem as a challenge for them to research and develop solutions for. This project provides a model for NASA scientists and engineers on one side, and university students, faculty, and researchers in computer science and applied mathematics on the other side, to learn from each other's areas of work, computational needs and solutions, and the latest advances in research and development. This innovation takes NASA science and

  10. Dicty_cDB: Contig-U12682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  11. Production and reception of meaningful sound in Foville's 'encompassing convolution'.

    Science.gov (United States)

    Schiller, F

    1999-04-01

    In the history of neurology. Achille Louis Foville (1799-1879) is a name deserving to be remembered. In the course of time, his circonvolution d'enceinte of 1844 (surrounding the Sylvian fissure) became the 'convolution encompassing' every aspect of aphasiology, including amusia, ie., the localization in a coherent semicircle of semicircle of cerebral cortext serving the production and perception of language, song and instrumental music in health and disease.

  12. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

  13. Dicty_cDB: Contig-U15069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

  14. Dicty_cDB: Contig-U12316-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

  15. Projector : automatic contig mapping for gap closure purposes

    NARCIS (Netherlands)

    van Hijum, SAFT; Zomer, AL; Kuipers, OP; Kok, J

    2003-01-01

    Projector was designed for automatic positioning of contigs from an unfinished prokaryotic genome onto a template genome of a closely related strain or species. Projector mapped 84 contigs of Lactococcus lactis MG1363 (corresponding to 81% of the assembly nucleotides) against the genome of L.lactis

  16. From Balancing the Numbers to an Encompassing Business Case

    DEFF Research Database (Denmark)

    Labucay, Inéz

    2013-01-01

    and Horwitz 2007). The focus of the paper is on further developing and building on theoretical concepts of diversity. It also establishes links to non-mainstream theories like social network theory. After a short introduction to the model, the three stages of the model (Diversity concept, Diversity goals......, Diversity measurement) are presented in more detail, followed by a summary and conclusion on its applicability and relevance for diversity practitioners. An outlook on further research ensues. The paper aims at delineating an approach to building a more encompassing Business Case.......The Business Case of Diversity Management has evolved as the predominant concept underlying many diversity studies and practices in the field. In this line of reasoning, corporate bottom line results like an increased return on investment (ROI) are partially explained by the existence of Diversity...

  17. An all-encompassing study of an authentic court setting

    DEFF Research Database (Denmark)

    Christensen, Tina Paulsen

    necessarily be judged from a particular (subjective) perspective on the communicative event. In this paper I shall address the issue of interpreting quality in an all-encompassing perspective on an authentic Danish courtroom setting. The aim of the empirical case-based survey is unlike that of most existing...... but homogeneous. Several empirical studies, which have been carried out on this subject, have shown that different user groups have different expectations about the interpreted communicative event, which ceteris paribus means that user expectations are heterogeneous. The question is, whether the heterogeneity......, which are to be considered as expectancy norms projected and recommended by the specific legal system. In order to be able to answer this question, a questionnaire-based survey on specific quality criteria has been conducted within an authentic interpreter-mediated court setting, because, according...

  18. Genome scan identifies a locus affecting gamma-globin expression in human beta-cluster YAC transgenic mice

    Energy Technology Data Exchange (ETDEWEB)

    Lin, S.D.; Cooper, P.; Fung, J.; Weier, H.U.G.; Rubin, E.M.

    2000-03-01

    Genetic factors affecting post-natal g-globin expression - a major modifier of the severity of both b-thalassemia and sickle cell anemia, have been difficult to study. This is especially so in mice, an organism lacking a globin gene with an expression pattern equivalent to that of human g-globin. To model the human b-cluster in mice, with the goal of screening for loci affecting human g-globin expression in vivo, we introduced a human b-globin cluster YAC transgene into the genome of FVB mice . The b-cluster contained a Greek hereditary persistence of fetal hemoglobin (HPFH) g allele resulting in postnatal expression of human g-globin in transgenic mice. The level of human g-globin for various F1 hybrids derived from crosses between the FVB transgenics and other inbred mouse strains was assessed. The g-globin level of the C3HeB/FVB transgenic mice was noted to be significantly elevated. To map genes affecting postnatal g-globin expression, a 20 centiMorgan (cM) genome scan of a C3HeB/F VB transgenics [prime] FVB backcross was performed, followed by high-resolution marker analysis of promising loci. From this analysis we mapped a locus within a 2.2 cM interval of mouse chromosome 1 at a LOD score of 4.2 that contributes 10.4% of variation in g-globin expression level. Combining transgenic modeling of the human b-globin gene cluster with quantitative trait analysis, we have identified and mapped a murine locus that impacts on human g-globin expression in vivo.

  19. Efecto del smallanthus sonchifolius "yacón" en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007

    OpenAIRE

    Reyes Beltrán, María Esther Daisy

    2009-01-01

    Autor: María Esther Daisy Reyes Beltrán Título Tesis Doctoral: Efecto del Smallanthus sonchifolius “yacón” en el tratamiento de hiperlipemias comparado con dieta sola y gemfibrozilo. Trujillo, 2007. Asesor: Dr. Juan Jorge Huamán Saavedra. Páginas Totales: 40 Institución: Facultad de Medicina, Universidad Nacional de Trujillo. El aumento de LDL colesterol y de triglicéridos y la disminución de HDL colesterol son factores de riesgo coronario. Es de interés saber si existe alguna variació...

  20. Evaluación químico bromatológica de las variedades Yurac Llajum, Gello Llajum y Yurac Checche de Smallanthus Sonchifolius (Poepp & Endl).H. Robinson (Yacón) procedente de Puno

    OpenAIRE

    Ramos Zapana, Rubén; Arias Arroyo, Gladys

    2014-01-01

    Las variedades Yurac llajum, Qello llajum y Yurac checche de la especie Smallanthus sonchifolius (Poepp & Endl) (Yacón), procedente de la provincia de Sandia del Departamento de Puno, se desarrollan entre 1500 a 3000 msnm. Conocidas como “yacón”, “yakuma”, “llaqón”, “llacun” o “llacuma” en quechua; en aymara “aricoma” o “aricuma“; en español “Yacón”, “Jacón”, “llacón”, “arboloco”, “Puhe”, “jicama”, “jíquima”, “jikima” o “jiquimilla”. Estas raíces tuberosas de sabor dulce y refrescante, de asp...

  1. Two sequence-ready contigs spanning the two copies of a 200-kb duplication on human 21q: partial sequence and polymorphisms.

    Science.gov (United States)

    Potier, M; Dutriaux, A; Orti, R; Groet, J; Gibelin, N; Karadima, G; Lutfalla, G; Lynn, A; Van Broeckhoven, C; Chakravarti, A; Petersen, M; Nizetic, D; Delabar, J; Rossier, J

    1998-08-01

    Physical mapping across a duplication can be a tour de force if the region is larger than the size of a bacterial clone. This was the case of the 170- to 275-kb duplication present on the long arm of chromosome 21 in normal human at 21q11.1 (proximal region) and at 21q22.1 (distal region), which we described previously. We have constructed sequence-ready contigs of the two copies of the duplication of which all the clones are genuine representatives of one copy or the other. This required the identification of four duplicon polymorphisms that are copy-specific and nonallelic variations in the sequence of the STSs. Thirteen STSs were mapped inside the duplicated region and 5 outside but close to the boundaries. Among these STSs 10 were end clones from YACs, PACs, or cosmids, and the average interval between two markers in the duplicated region was 16 kb. Eight PACs and cosmids showing minimal overlaps were selected in both copies of the duplication. Comparative sequence analysis along the duplication showed three single-basepair changes between the two copies over 659 bp sequenced (4 STSs), suggesting that the duplication is recent (less than 4 mya). Two CpG islands were located in the duplication, but no genes were identified after a 36-kb cosmid from the proximal copy of the duplication was sequenced. The homology of this chromosome 21 duplicated region with the pericentromeric regions of chromosomes 13, 2, and 18 suggests that the mechanism involved is probably similar to pericentromeric-directed mechanisms described in interchromosomal duplications. Copyright 1998 Academic Press.

  2. Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

    Energy Technology Data Exchange (ETDEWEB)

    Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

    1996-11-01

    Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

  3. difusividad, masa, humedad, volumen y sólidos en yacón (Smallantus sonchifolius deshidratado osmóticamente

    Directory of Open Access Journals (Sweden)

    Julio Rojas Naccha

    2012-01-01

    Full Text Available Se evaluó la capacidad predictiva de la Red Neuronal Artificial (RNA en el efecto de la concentración (30,40, 50 y 60 % p/p y temperatura (30, 40 y 50°C de la solución de fructooligosacaridos (FOS en la masa,humedad, volumen y sólidos en cubos de yacón osmodeshidratados, y en el coeficiente de difusividad efectivamedia del agua, con y sin encogimiento. Se aplicó la RNA del tipoFeedforwardcon los algoritmos deentrenamientoBackpropagationy de ajuste de pesosLevenberg-Marquardt, usando la topología: error metade 10-5, tasa de aprendizaje de 0.01, coeficiente de momento de 0.5, 2 neuronas de entrada, 6 neuronas desalida, una capa oculta con 18 neuronas, 15 etapas de entrenamiento y funciones de transferencialogsig-purelin. El error promedio global por la RNA fue 3.44% y los coeficientes de correlación fueron mayores a0.9. No se encontraron diferencias significativas entre los valores experimentales con losvalores predichos porla RNA y con los valores predichos por un modelo estadístico de regresión polinomial de segundo orden (p >0.95.Palabras clave:Red Neuronal Artificial (RNA, difusividad efectiva, yacón, deshidratación osmótica

  4. Efecto hepatoprotector del extracto acuoso de Smallanthus sonchifolius (yacón en un modelo de intoxicación con acetaminofén

    Directory of Open Access Journals (Sweden)

    Acela Inés Arnao-Salas

    2012-07-01

    Full Text Available En la medicina tradicional se ha publicado que las hojas de Smallanthus sonchifolius (yacón poseen efectos antidiabético y hepatoprotector. Objetivos: Evaluar en suero y hematíes el efecto hepatoprotector del extracto acuoso de hojas de yacón (EAY en un modelo de intoxicación con acetaminofén en ratas. Diseño: Experimental, transversal. Institución: Centro de Investigación de Bioquímica y Nutrición, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Material biológico: Hojas de yacón. Intervenciones: Se formó cinco grupos de ratas hembra (n=6 que recibieron por cinco días, por vía oral, suero fisiológico (SF, EAY o silimarina (Sil (50 mg/kg y luego de 1 hora, SF o acetaminofén (A 250 mg/kg, según lo siguiente: G1 (control; SF-SF, G2 (SF-A, G3 (EAY (200 mg/kg-A, G4 (EAY (400 mg/kg-A y G5 (Sil-A. Principales medidas de los resultados: Actividad de aspartato amino transferasas (AST, alanina amino transferasa (ALT, fosfatasa alcalina (FAL γ γ-amino transferasa (γ-GTP; niveles de bilirrubina total (BT, proteνnas y lipoperoxidaciσn (MDA. En hematíes, actividades de superóxido dismutasa (SOD, catalasa (CAT y hemoglobina. Resultados: Se observó aumento significativo (p<0,05 en la actividad de γ-GTP entre el grupo G2 y los grupos G3 y G4. Hubo disminuciσn significativa (p<0,05 de proteνnas en el grupo G2 con respecto G1. El nivel de MDA fue menor en el grupo que recibió 200 mg/kg de EAY con respecto al control. Las actividades de AST, ALT y FAL no mostraron diferencias significativas. La relación SOD/CAT fue similar entre los grupos G1, G4 y G5, evidencia de una recuperación del daño causado por el acetaminofén. Conclusiones: La administración del EAY tuvo un efecto hepatoprotector comparable a la silimarina.

  5. Physical mapping of the Bloom syndrome region by the identification of YAC and P1 clones from human chromosome 15 band q26.1

    Energy Technology Data Exchange (ETDEWEB)

    Straughen, J.; Groden, J. [Univ. of Cincinnati College of Medicine, OH (United States); Ciocci, S. [New York Blood Center, NY (United States)] [and others

    1996-07-01

    The gene for Bloom syndrome (BLM) has been mapped to human chromosome 15 band q26.1 by homozygosity mapping. Further refinement of the location of BLM has relied upon linkage-disequilibrium mapping and somatic intragenic recombination. In combination with these mapping approaches and to identify novel DNA markers and probes for the BLM candidate region, a contiguous representation of the 2-Mb region that contains the BLM gene was generated and is presented here. YAC and P1 clones from the region have been identified and ordered by using previously available genetic markers in the region along with newly developed sequence-tagged sites from radiation-restriction map of the 2-Mb region that allowed estimation of the distance between polymorphic microsatellite loci is also reported. This map and the DNA markers derived from it were instrumental in the recent identification of the BLM gene. 25 refs., 3 figs., 3 tabs.

  6. A Blumeria graminis f.sp. hordei BAC library - contig building and microsynteny studies

    DEFF Research Database (Denmark)

    Pedersen, C.; Wu, B.; Giese, H.

    2002-01-01

    A bacterial artificial chromosome (BAC) library of Blumeria graminis f.sp. hordei, containing 12,000 clones with an average insert size of 41 kb, was constructed. The library represents about three genome equivalents and BAC-end sequencing showed a high content of repetitive sequences, making...... contigs, at or close to avirulence loci, were constructed. Single nucleotide polymorphism (SNP) markers were developed from BAC-end sequences to link the contigs to the genetic maps. Two other BAC contigs were used to study microsynteny between B. graminis and two other ascomycetes, Neurospora crassa...

  7. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    OpenAIRE

    Silvina Maldonado; Judith del Carmen Singh

    2008-01-01

    El yacón (Smallanthus sonchifolius) es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se ag...

  8. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  9. Dicty_cDB: Contig-U16279-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

  10. Cinética de la transferencia de masa durante la deshidratación osmótica de yacón (Smallanthus sonchifolius Cinética de transferência de massa durante a desidratação osmótica de yacón (Smallanthus sonchifolius

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-03-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino de vida útil muy corta bajo condiciones ambientales. Los objetivos de este trabajo fueron determinar: 1 la cinética de deshidratación osmótica de yacón, utilizando sacarosa como soluto; 2 el ajuste de la ecuación de Peleg a los datos experimentales; y 3 el coeficiente de difusión usando la ecuación de Hawkes y Flink. La fruta se peló y cortó en placas de 3 x 3 x 0,3 cm. Se la deshidrató osmóticamente con solución de sacarosa al 40% (p/p, hasta aw = 0,97. El proceso se realizó a temperatura de 25 °C y con agitación continua (105 rpm. Se determinó la pérdida de peso de las muestras, la ganancia de sólidos y la retención de agua. Los parámetros obtenidos para el ajuste de pérdida de agua y ganancia de sólidos son respectivamente: k1: 8,2 0,1 y k2: 0,53 ± 0,06; k1: 234 ± 8 y k2: 2,6 ± 0,5. La mayor transferencia de masa, tanto de agua como de soluto, ocurre durante los primeros 60 a 90 minutos de proceso, lográndose una ganancia media de sólidos de 9,5 [g.100 g-1 MF] y una pérdida de agua de 68,8 [g.100 g-1MF]. Se puede asegurar que es posible aplicar satisfactoriamente el proceso de deshidratación osmótica en yacón como pre tratamiento de conservación.O yacón (Smallanthus sonchifolius é um tubérculo andino de vida útil muito curta sob condições ambientais. Os objetivos deste trabalho foram determinar: 1 a cinética de desidratação osmótica do yacón, utilizando sacarose como soluto; 2 o ajuste da equação de Peleg aos dados experimentais; e 3 o coeficiente de difusão usando a equação de Hawkes e Flink. A fruta foi descascada e cortada em placas de 3 x 3 x 0,3 cm. Foi desidratada osmoticamente usando uma solução de sacarose aos 40% (p/p, até aw = 0,97. O processo foi conduzido mantendo a temperatura constante em 25 °C e com agitação orbital contínua (105 rpm. Determinou-se a perda de peso das mostras, o ganho de sólidos e a retenção de

  11. Four-dimensional Hooke's law can encompass linear elasticity and inertia

    International Nuclear Information System (INIS)

    Antoci, S.; Mihich, L.

    1999-01-01

    The question is examined whether the formally straightforward extension of Hooke's time-honoured stress-strain relation to the four dimensions of special and of general relativity can make physical sense. The four-dimensional Hooke law is found able to account for the inertia of matter; in the flat-space, slow-motion approximation the field equations for the displacement four-vector field ξ i can encompass both linear elasticity and inertia. In this limit one just recovers the equations of motion of the classical theory of elasticity

  12. Scaffold filling, contig fusion and comparative gene order inference

    Directory of Open Access Journals (Sweden)

    Rounsley Steve

    2010-06-01

    Full Text Available Abstract Background There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Results Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. Conclusions The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  13. Scaffold filling, contig fusion and comparative gene order inference.

    Science.gov (United States)

    Muñoz, Adriana; Zheng, Chunfang; Zhu, Qian; Albert, Victor A; Rounsley, Steve; Sankoff, David

    2010-06-04

    There has been a trend in increasing the phylogenetic scope of genome sequencing without finishing the sequence of the genome. Increasing numbers of genomes are being published in scaffold or contig form. Rearrangement algorithms, however, including gene order-based phylogenetic tools, require whole genome data on gene order or syntenic block order. How then can we use rearrangement algorithms to compare genomes available in scaffold form only? Can the comparative evidence predict the location of unsequenced genes? Our method involves optimally filling in genes missing from the scaffolds, while incorporating the augmented scaffolds directly into the rearrangement algorithms as if they were chromosomes. This is accomplished by an exact, polynomial-time algorithm. We then correct for the number of extra fusion/fission operations required to make scaffolds comparable to full assemblies. We model the relationship between the ratio of missing genes actually absent from the genome versus merely unsequenced ones, on one hand, and the increase of genomic distance after scaffold filling, on the other. We estimate the parameters of this model through simulations and by comparing the angiosperm genomes Ricinus communis and Vitis vinifera. The algorithm solves the comparison of genomes with 18,300 genes, including 4500 missing from one genome, in less than a minute on a MacBook, putting virtually all genomes within range of the method.

  14. Contig-Layout-Authenticator (CLA): A Combinatorial Approach to Ordering and Scaffolding of Bacterial Contigs for Comparative Genomics and Molecular Epidemiology.

    Science.gov (United States)

    Shaik, Sabiha; Kumar, Narender; Lankapalli, Aditya K; Tiwari, Sumeet K; Baddam, Ramani; Ahmed, Niyaz

    2016-01-01

    A wide variety of genome sequencing platforms have emerged in the recent past. High-throughput platforms like Illumina and 454 are essentially adaptations of the shotgun approach generating millions of fragmented single or paired sequencing reads. To reconstruct whole genomes, the reads have to be assembled into contigs, which often require further downstream processing. The contigs can be directly ordered according to a reference, scaffolded based on paired read information, or assembled using a combination of the two approaches. While the reference-based approach appears to mask strain-specific information, scaffolding based on paired-end information suffers when repetitive elements longer than the size of the sequencing reads are present in the genome. Sequencing technologies that produce long reads can solve the problems associated with repetitive elements but are not necessarily easily available to researchers. The most common high-throughput technology currently used is the Illumina short read platform. To improve upon the shortcomings associated with the construction of draft genomes with Illumina paired-end sequencing, we developed Contig-Layout-Authenticator (CLA). The CLA pipeline can scaffold reference-sorted contigs based on paired reads, resulting in better assembled genomes. Moreover, CLA also hints at probable misassemblies and contaminations, for the users to cross-check before constructing the consensus draft. The CLA pipeline was designed and trained extensively on various bacterial genome datasets for the ordering and scaffolding of large repetitive contigs. The tool has been validated and compared favorably with other widely-used scaffolding and ordering tools using both simulated and real sequence datasets. CLA is a user friendly tool that requires a single command line input to generate ordered scaffolds.

  15. End-to-end network models encompassing terrestrial, wireless, and satellite components

    Science.gov (United States)

    Boyarko, Chandler L.; Britton, John S.; Flores, Phil E.; Lambert, Charles B.; Pendzick, John M.; Ryan, Christopher M.; Shankman, Gordon L.; Williams, Ramon P.

    2004-08-01

    Development of network models that reflect true end-to-end architectures such as the Transformational Communications Architecture need to encompass terrestrial, wireless and satellite component to truly represent all of the complexities in a world wide communications network. Use of best-in-class tools including OPNET, Satellite Tool Kit (STK), Popkin System Architect and their well known XML-friendly definitions, such as OPNET Modeler's Data Type Description (DTD), or socket-based data transfer modules, such as STK/Connect, enable the sharing of data between applications for more rapid development of end-to-end system architectures and a more complete system design. By sharing the results of and integrating best-in-class tools we are able to (1) promote sharing of data, (2) enhance the fidelity of our results and (3) allow network and application performance to be viewed in the context of the entire enterprise and its processes.

  16. Área foliar del yacón (Smallanthus sonchifolius (Poep. & Endl. H. Rob. estimada mediante método indirecto.

    Directory of Open Access Journals (Sweden)

    Juan Francisco Seminario-Cunya

    2016-12-01

    Full Text Available El objetivo de este trabajo fue estimar el área foliar de ocho morfotipos de yacón mediante análisis de regresión lineal simple. La investigación se realizó entre los años 2014 y 2015, en el Programa de Raíces y Tubérculos Andinos de la Universidad Nacional de Cajamarca, Perú (7° 10’ 00’’ S, 78° 30’00’’ W, 2650 msnm. Se tomaron cien hojas de cada morfotipo, incluyendo hojas de los estratos basal, medio y terminal de plantas en plena oración. Las siluetas de las hojas frescas se dibujaron en papel y se midió el largo (L y ancho mayor de la lámina (W. El área medida (o real de la lámina se determinó con planímetro digital. Con el área medida (variable dependiente y los valores de largo, ancho, largo al cuadrado, ancho al cuadrado, largo x ancho y largo/ancho (como variables independientes, se realizó el análisis de regresión para cada morfotipo. En todos los morfotipos, excepto en dos, las mejores ecuaciones para estimar el área foliar, fueron aquellas en donde intervino el producto de L x W. La ecuación A= 20,41 + 0,4167 (L x W (r2 = 0,89 permitió estimar el área foliar de los ocho morfotipos en conjunto. El área del peciolo de los morfotipos en estudio signi có 15%, respecto del área total de la hoja.

  17. AAV-dominant negative tumor necrosis factor (DN-TNF gene transfer to the striatum does not rescue medium spiny neurons in the YAC128 mouse model of Huntington's disease.

    Directory of Open Access Journals (Sweden)

    Laura Taylor Alto

    Full Text Available CNS inflammation is a hallmark of neurodegenerative disease, and recent studies suggest that the inflammatory response may contribute to neuronal demise. In particular, increased tumor necrosis factor (TNF signaling is implicated in the pathology of both Parkinson's disease (PD and Alzheimer's disease (AD. We have previously shown that localized gene delivery of dominant negative TNF to the degenerating brain region can limit pathology in animal models of PD and AD. TNF is upregulated in Huntington's disease (HD, like in PD and AD, but it is unknown whether TNF signaling contributes to neuronal degeneration in HD. We used in vivo gene delivery to test whether selective reduction of soluble TNF signaling could attenuate medium spiny neuron (MSN degeneration in the YAC128 transgenic (TG mouse model of Huntington's disease (HD. AAV vectors encoding cDNA for dominant-negative tumor necrosis factor (DN-TNF or GFP (control were injected into the striatum of young adult wild type WT and YAC128 TG mice and achieved 30-50% target coverage. Expression of dominant negative TNF protein was confirmed immunohistologically and biochemically and was maintained as mice aged to one year, but declined significantly over time. However, the extent of striatal DN-TNF gene transfer achieved in our studies was not sufficient to achieve robust effects on neuroinflammation, rescue degenerating MSNs or improve motor function in treated mice. Our findings suggest that alternative drug delivery strategies should be explored to determine whether greater target coverage by DN-TNF protein might afford some level of neuroprotection against HD-like pathology and/or that soluble TNF signaling may not be the primary driver of striatal neuroinflammation and MSN loss in YAC128 TG mice.

  18. ESTminer: a Web interface for mining EST contig and cluster databases.

    Science.gov (United States)

    Huang, Yecheng; Pumphrey, Janie; Gingle, Alan R

    2005-03-01

    ESTminer is a Web application and database schema for interactive mining of expressed sequence tag (EST) contig and cluster datasets. The Web interface contains a query frame that allows the selection of contigs/clusters with specific cDNA library makeup or a threshold number of members. The results are displayed as color-coded tree nodes, where the color indicates the fractional size of each cDNA library component. The nodes are expandable, revealing library statistics as well as EST or contig members, with links to sequence data, GenBank records or user configurable links. Also, the interface allows 'queries within queries' where the result set of a query is further filtered by the subsequent query. ESTminer is implemented in Java/JSP and the package, including MySQL and Oracle schema creation scripts, is available from http://cggc.agtec.uga.edu/Data/download.asp agingle@uga.edu.

  19. Dicty_cDB: Contig-U03802-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

  20. Deletion 1q43 encompassing only CHRM3 in a patient with autistic disorder.

    Science.gov (United States)

    Petersen, Andrea Klunder; Ahmad, Ausaf; Shafiq, Mustafa; Brown-Kipphut, Brigette; Fong, Chin-To; Anwar Iqbal, M

    2013-02-01

    Deletions on the distal portion of the long arm of chromosome 1 result in complex and highly variable clinical phenotypes which include intellectual disability, autism, seizures, microcephaly/craniofacial dysmorphology, corpus callosal agenesis/hypogenesis, cardiac and genital anomalies, hand and foot abnormalities and short stature. Genotype-phenotype correlation reported a minimum region of 2 Mb at 1q43-q44. We report on a 3 ½ year old male patient diagnosed with autistic disorder who has social withdrawal, eating problems, repetitive stereotypic behaviors including self-injurious head banging and hair pulling, and no seizures, anxiety, or mood swings. Array comparative genomic hybridization (aCGH) showed an interstitial deletion of 473 kb at 1q43 region (239,412,391-239,885,394; NCBI build37/hg19) harboring only CHRM3 (Acetylcholine Receptor, Muscarinic, 3; OMIM: 118494). Recently, another case with a de novo interstitial deletion of 911 kb at 1q43 encompassing three genes including CHRM3 was reported. The M3 muscarinic receptor influences a multitude of central and peripheral nervous system processes via its interaction with acetylcholine and may be an important modulator of behavior, learning and memory. We propose CHRM3 as a candidate gene responsible for our patient's specific phenotype as well as the overlapping phenotypic features of other patients with 1q43 or 1q43-q44 deletions. Copyright © 2013. Published by Elsevier Masson SAS.

  1. A new bidirectional heteroassociative memory encompassing correlational, competitive and topological properties.

    Science.gov (United States)

    Chartier, Sylvain; Giguère, Gyslain; Langlois, Dominic

    2009-01-01

    In this paper, we present a new recurrent bidirectional model that encompasses correlational, competitive and topological model properties. The simultaneous use of many classes of network behaviors allows for the unsupervised learning/categorization of perceptual patterns (through input compression) and the concurrent encoding of proximities in a multidimensional space. All of these operations are achieved within a common learning operation, and using a single set of defining properties. It is shown that the model can learn categories by developing prototype representations strictly from exposition to specific exemplars. Moreover, because the model is recurrent, it can reconstruct perfect outputs from incomplete and noisy patterns. Empirical exploration of the model's properties and performance shows that its ability for adequate clustering stems from: (1) properly distributing connection weights, and (2) producing a weight space with a low dispersion level (or higher density). In addition, since the model uses a sparse representation (k-winners), the size of topological neighborhood can be fixed, and no longer requires a decrease through time as was the case with classic self-organizing feature maps. Since the model's learning and transmission parameters are independent from learning trials, the model can develop stable fixed points in a constrained topological architecture, while being flexible enough to learn novel patterns.

  2. Familial X/Y Translocation Encompassing ARSE in Two Moroccan Siblings with Sensorineural Deafness.

    Science.gov (United States)

    Amasdl, Saadia; Smaili, Wiam; Natiq, Abdelhafid; Hassani, Amale; Sbiti, Aziza; Agadr, Aomar; Sanlaville, Damien; Sefiani, Abdelaziz

    2017-01-01

    Unbalanced translocations involving X and Y chromosomes are rare and associated with a contiguous gene syndrome. The clinical phenotype is heterogeneous including mainly short stature, chondrodysplasia punctata, ichthyosis, hypogonadism, and intellectual disability. Here, we report 2 brothers with peculiar gestalt, short stature, and hearing loss, who harbor an X/Y translocation. Physical examination, brainstem acoustic potential evaluation, bone age, hormonal assessment, and X-ray investigations were performed. Because of their dysmorphic features, karyotyping, FISH, and aCGH were carried out. The probands had short stature, hypertelorism, midface hypoplasia, sensorineural hearing loss, normal intelligence as well as slight radial and ulnar bowing with brachytelephalangy. R-banding identified a derivative X chromosome with an abnormally expanded short arm. The mother was detected as a carrier of the same aberrant X chromosome. aCGH disclosed a 3.1-Mb distal deletion of chromosome region Xp22.33pter. This interval encompasses several genes, especially the short stature homeobox (SHOX) and arylsulfatase (ARSE) genes. The final karyotype of the probands was: 46,Y,der(X),t(X;Y)(p22;q12).ish der(X)(DXYS129-,DXYS153-)mat.arr[hg19] Xp22.33(61091_2689408)×1mat,Xp22.33(2701273_3258404)×0mat,Yq11.222q12 (21412851_59310245)×2. Herein, we describe a Moroccan family with a maternally inherited X/Y translocation and discuss the genotype-phenotype correlations according to the deleted genes. © 2017 S. Karger AG, Basel.

  3. Cultural respect encompassing simulation training: being heard about health through broadband

    Directory of Open Access Journals (Sweden)

    Phyllis Min-yu Lau

    2016-04-01

    Full Text Available Background. Cultural Respect Encompassing Simulation Training (CREST is a learning program that uses simulation to provide health professional students and practitioners with strategies to communicate sensitively with culturally and linguistically diverse (CALD patients. It consists of training modules with a cultural competency evaluation framework and CALD simulated patients to interact with trainees in immersive simulation scenarios. The aim of this study was to test the feasibility of expanding the delivery of CREST to rural Australia using live video streaming; and to investigate the fidelity of cultural sensitivity – defined within the process of cultural competency which includes awareness, knowledge, skills, encounters and desire – of the streamed simulations. Design and Methods. In this mixed-methods evaluative study, health professional trainees were recruited at three rural academic campuses and one rural hospital to pilot CREST sessions via live video streaming and simulation from the city campus in 2014. Cultural competency, teaching and learning evaluations were conducted. Results. Forty-five participants rated 26 reliable items before and after each session and reported statistically significant improvement in 4 of 5 cultural competency domains, particularly in cultural skills (P<0.05. Qualitative data indicated an overall acknowledgement amongst participants of the importance of communication training and the quality of the simulation training provided remotely by CREST. Conclusions. Cultural sensitivity education using live video-streaming and simulation can contribute to health professionals’ learning and is effective in improving cultural competency. CREST has the potential to be embedded within health professional curricula across Australian universities to address issues of health inequalities arising from a lack of cultural sensitivity training.

  4. Groundwater-Surface water interaction in agricultural watershed that encompasses dense network of High Capacity wells

    Science.gov (United States)

    Talib, A.; Desai, A. R.

    2017-12-01

    The Central Sands region of Wisconsin is characterized by productive trout streams, lakes, farmland and forest. However, stream channelization, past wetland drainage, and ground water withdrawals have disrupted the hydrology of this Central Sands region. Climatically driven conditions in last decade (2000-2008) alone are unable to account for the severely depressed water levels. Increased interception and evapotranspiration from afforested areas in central sand Wisconsin may also be culprit for reduced water recharge. Hence, there is need to study the cumulative effects of changing precipitation patterns, groundwater withdrawals, and forest evapotranspiration to improve projections of the future of lake levels and water availability in this region. Here, the SWAT-MODFLOW coupled model approach was applied at large spatio-temporal scale. The coupled model fully integrates a watershed model (SWAT) with a groundwater flow model (MODFLOW). Surface water and ground water flows were simulated integratively at daily time step to estimate the groundwater discharge to the stream network in Central Sands that encompasses high capacity wells. The model was calibrated (2010-2013) and validated (2014-2017) based on streamflow, groundwater extraction, and water table elevation. As the long-term trends in some of the primary drivers is presently ambiguous in Central Sands under future climate, as is the case for total precipitation or timing of precipitation, we relied on a sensitivity student to quantitatively access how primary and secondary drivers may influence future net groundwater recharge. We demonstrate how such an approach could then be coupled with decision-making models to evaluate the effectiveness of groundwater withdrawal policies under a changing climate.

  5. Dicty_cDB: Contig-U11311-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A from... 58 6e-07 2 ( AM481444 ) Vitis vinifera contig VV78X144362.4, whole genome... 68 1e-06 1 ( AY604469 ) Prodonto...117 4e-27 AY604469_1( AY604469 |pid:none) Prodontorhabditis wirthi strain DF... 125 5e-27 ( P25202 ) RecName

  6. Dicty_cDB: Contig-U16102-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 6 ( BJ408668 ) Dictyostelium discoideum cDNA clone:dds46g14, 3' ... 44 3.0 2 ( CV162186 ) CS_hyp_01d11_M13Reverse Blue crab hypoder...08_M13Reverse Blue crab hypodermis, nor... 42 3.6 2 ( AM474408 ) Vitis vinifera contig VV78X173370.5, whole

  7. Dicty_cDB: Contig-U05126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000939 ) Clostridium botulinum B1 str. Okra, complete genome. 34 2.5 18 ( GE803619 ) EST_scau_evk_893885 ...scauevk mixed_tissue Sebastes... 32 2.6 3 ( AM462416 ) Vitis vinifera contig VV78X219254.19, whole genom...

  8. Enhancement of antibody-dependent cellular cytotoxicity of cetuximab by a chimeric protein encompassing interleukin-15.

    Science.gov (United States)

    Ochoa, Maria Carmen; Minute, Luna; López, Ascensión; Pérez-Ruiz, Elisabeth; Gomar, Celia; Vasquez, Marcos; Inoges, Susana; Etxeberria, Iñaki; Rodriguez, Inmaculada; Garasa, Saray; Mayer, Jan-Peter Andreas; Wirtz, Peter; Melero, Ignacio; Berraondo, Pedro

    2018-01-01

    Enhancement of antibody-dependent cellular cytotoxicity (ADCC) may potentiate the antitumor efficacy of tumor-targeted monoclonal antibodies. Increasing the numbers and antitumor activity of NK cells is a promising strategy to maximize the ADCC of standard-of-care tumor-targeted antibodies. For this purpose, we have preclinically tested a recombinant chimeric protein encompassing the sushi domain of the IL15Rα, IL-15, and apolipoprotein A-I (Sushi-IL15-Apo) as produced in CHO cells. The size-exclusion purified monomeric fraction of this chimeric protein was stable and retained the IL-15 and the sushi domain bioactivity as measured by CTLL-2 and Mo-7e cell proliferation and STAT5 phosphorylation in freshly isolated human NK and CD8 + T cells. On cell cultures, Sushi-IL15-Apo increases NK cell proliferation and survival as well as spontaneous and antibody-mediated cytotoxicity. Scavenger receptor class B type I (SR-B1) is the receptor for ApoA-I and is expressed on the surface of tumor cells. SR-B1 can adsorb the chimeric protein on tumor cells and can transpresent IL-15 to NK and CD8 + T cells. A transient NK-humanized murine model was developed to test the increase of ADCC attained by the chimeric protein in vivo . The EGFR + human colon cancer cell line HT-29 was intraperitoneally inoculated in immune-deficient Rag2 -/- γc -/- mice that were reconstituted with freshly isolated PBMCs and treated with the anti-EGFR mAb cetuximab. The combination of the Sushi-IL15-Apo protein and cetuximab reduced the number of remaining tumor cells in the peritoneal cavity and delayed tumor engraftment in the peritoneum. Furthermore, Sushi-IL15-Apo increased the anti-tumor effect of a murine anti-EGFR mAb in Rag1 -/- mice bearing subcutaneous MC38 colon cancer transfected to express EGFR. Thus, Sushi-IL15-Apo is a potent tool to increase the number and the activation of NK cells to promote the ADCC activity of antibodies targeting tumor antigens.

  9. Efecto de gelificantes en la formulación de dulce de yacón Efeito de gelificante na formulação do doce do yacon

    Directory of Open Access Journals (Sweden)

    Silvina Maldonado

    2008-06-01

    Full Text Available El yacón (Smallanthus sonchifolius es un tubérculo andino cultivado en las laderas de los Andes. Es una planta perenne que llega a su madurez entre 6-7 meses hasta 1 año, según la altura sobre el nivel del mar. Este trabajo propone la formulación de un producto alimenticio a partir de yacón por agregado de solutos: glucosa y sacarosa y combinación de barreras de estrés. Se estudió el efecto de gelificantes: agar-agar, pectina y goma arábiga, en tres concentraciones: 0,30, 0,41 y 0,48%. Se agregó benzoato de sodio, metabisulfito de sodio y ácido cítrico. Se desarrolló un dulce tipo pan. Se registró la evolución de temperatura durante la cocción. Se empacó y envasó el dulce en bandejas. Se analizaron parámetros de textura principales y secundarios. La formulación que alcanzó valores de textura similares a la referencia fue: 0,48% de agar-agar; 12% de sacarosa; 17% de glucosa; 23% de agua; 996,75 ppm de metabisulfito; 498,50 ppm de ácido cítrico y 1435,7 ppm de benzoato de sodio. Se realizó una prueba sensorial a través de la evaluación de los parámetros más representativos de la textura, utilizando para ello una escala hedónica, determinando la aceptación de la formulación seleccionada.O yacón (Smallanthus sonchifolius é um tubérculo andino cultivado nas encostas Dos Andes. É uma planta perene que chega a sua maduração entre 6 meses e 1 ano. Este trabalho propõe a formulação de um produto alimentício a partir do yacón agregando solutos: glicose, sacarose e combinação de barreiras de estresse. Estudou-se o efeito de gelificantes: ágar-ágar e arábica, em três concentrações 0.30, 0.41 e 0.48%. Agregou-se benzoato de sódio, metabisulfito de sódio, e ácido cítrico. Desenvolveu-se um doce tipo pão. Registrou-se a evolução da temperatura durate cozimento. Empacotou-se e envasou-se o doce em bandejas. Analisaram-se parâmetros de textura principais e secundários. A formulação que atingiu os

  10. The binning of metagenomic contigs for microbial physiology of mixed cultures.

    Science.gov (United States)

    Strous, Marc; Kraft, Beate; Bisdorf, Regina; Tegetmeyer, Halina E

    2012-01-01

    So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population. In the present study eight metagenomic samples from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to existing algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a 100 times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt).

  11. The binning of metagenomic contigs for microbial physiology of mixed cultures

    Directory of Open Access Journals (Sweden)

    Marc eStrous

    2012-12-01

    Full Text Available So far, microbial physiology has dedicated itself mainly to pure cultures. In nature, cross feeding and competition are important aspects of microbial physiology and these can only be addressed by studying complete communities such as enrichment cultures. Metagenomic sequencing is a powerful tool to characterize such mixed cultures. In the analysis of metagenomic data, well established algorithms exist for the assembly of short reads into contigs and for the annotation of predicted genes. However, the binning of the assembled contigs or unassembled reads is still a major bottleneck and required to understand how the overall metabolism is partitioned over different community members. Binning consists of the clustering of contigs or reads that apparently originate from the same source population.In the present study eight metagenomic samples originating from the same habitat, a laboratory enrichment culture, were sequenced. Each sample contained 13-23 Mb of assembled contigs and up to eight abundant populations. Binning was attempted with existing methods but they were found to produce poor results, were slow, dependent on non-standard platforms or produced errors. A new binning procedure was developed based on multivariate statistics of tetranucleotide frequencies combined with the use of interpolated Markov models. Its performance was evaluated by comparison of the results between samples with BLAST and in comparison to exisiting algorithms for four publicly available metagenomes and one previously published artificial metagenome. The accuracy of the new approach was comparable or higher than existing methods. Further, it was up to a hunderd times faster. It was implemented in Java Swing as a complete open source graphical binning application available for download and further development (http://sourceforge.net/projects/metawatt.

  12. CBrowse: a SAM/BAM-based contig browser for transcriptome assembly visualization and analysis.

    Science.gov (United States)

    Li, Pei; Ji, Guoli; Dong, Min; Schmidt, Emily; Lenox, Douglas; Chen, Liangliang; Liu, Qi; Liu, Lin; Zhang, Jie; Liang, Chun

    2012-09-15

    To address the impending need for exploring rapidly increased transcriptomics data generated for non-model organisms, we developed CBrowse, an AJAX-based web browser for visualizing and analyzing transcriptome assemblies and contigs. Designed in a standard three-tier architecture with a data pre-processing pipeline, CBrowse is essentially a Rich Internet Application that offers many seamlessly integrated web interfaces and allows users to navigate, sort, filter, search and visualize data smoothly. The pre-processing pipeline takes the contig sequence file in FASTA format and its relevant SAM/BAM file as the input; detects putative polymorphisms, simple sequence repeats and sequencing errors in contigs and generates image, JSON and database-compatible CSV text files that are directly utilized by different web interfaces. CBowse is a generic visualization and analysis tool that facilitates close examination of assembly quality, genetic polymorphisms, sequence repeats and/or sequencing errors in transcriptome sequencing projects. CBrowse is distributed under the GNU General Public License, available at http://bioinfolab.muohio.edu/CBrowse/ liangc@muohio.edu or liangc.mu@gmail.com; glji@xmu.edu.cn Supplementary data are available at Bioinformatics online.

  13. CSAR-web: a web server of contig scaffolding using algebraic rearrangements.

    Science.gov (United States)

    Chen, Kun-Tze; Lu, Chin Lung

    2018-05-04

    CSAR-web is a web-based tool that allows the users to efficiently and accurately scaffold (i.e. order and orient) the contigs of a target draft genome based on a complete or incomplete reference genome from a related organism. It takes as input a target genome in multi-FASTA format and a reference genome in FASTA or multi-FASTA format, depending on whether the reference genome is complete or incomplete, respectively. In addition, it requires the users to choose either 'NUCmer on nucleotides' or 'PROmer on translated amino acids' for CSAR-web to identify conserved genomic markers (i.e. matched sequence regions) between the target and reference genomes, which are used by the rearrangement-based scaffolding algorithm in CSAR-web to order and orient the contigs of the target genome based on the reference genome. In the output page, CSAR-web displays its scaffolding result in a graphical mode (i.e. scalable dotplot) allowing the users to visually validate the correctness of scaffolded contigs and in a tabular mode allowing the users to view the details of scaffolds. CSAR-web is available online at http://genome.cs.nthu.edu.tw/CSAR-web.

  14. Deletion of Xpter encompassing the SHOX gene and PAR1 region in familial patients with Leri-Weill Dyschondrosteosis syndrome.

    Science.gov (United States)

    Mutesa, L; Vanbellinghen, J F; Hellin, A C; Segers, K; Jamar, M; Pierquin, G; Bours, V

    2009-01-01

    Heterozygote deletions or mutations of pseudoautosomal 1 region (PAR1) encompassing the short stature homeobox-containing (SHOX) gene cause Leri-Weill Dyschondrosteosis (LWD), which is a dominantly inherited osteochondroplasia characterized by short stature with mesomelic shortening of the upper and lower limbs and Madelung deformity of the wrists. SHOX is expressed by both sex chromosomes in males and females and plays an important role in bone growth and development. Clinically, the LWD expression is variable and more severe in females than males due to sex differences in oestrogen levels. Here, we report two familial cases of LWD with a large Xp terminal deletion (approximately 943 kb) of distal PAR1 encompassing the SHOX gene. In addition, the proband had mental retardation which appeared to be from recessive inheritance in the family.

  15. LTC: a novel algorithm to improve the efficiency of contig assembly for physical mapping in complex genomes

    Directory of Open Access Journals (Sweden)

    Feuillet Catherine

    2010-11-01

    Full Text Available Abstract Background Physical maps are the substrate of genome sequencing and map-based cloning and their construction relies on the accurate assembly of BAC clones into large contigs that are then anchored to genetic maps with molecular markers. High Information Content Fingerprinting has become the method of choice for large and repetitive genomes such as those of maize, barley, and wheat. However, the high level of repeated DNA present in these genomes requires the application of very stringent criteria to ensure a reliable assembly with the FingerPrinted Contig (FPC software, which often results in short contig lengths (of 3-5 clones before merging as well as an unreliable assembly in some difficult regions. Difficulties can originate from a non-linear topological structure of clone overlaps, low power of clone ordering algorithms, and the absence of tools to identify sources of gaps in Minimal Tiling Paths (MTPs. Results To address these problems, we propose a novel approach that: (i reduces the rate of false connections and Q-clones by using a new cutoff calculation method; (ii obtains reliable clusters robust to the exclusion of single clone or clone overlap; (iii explores the topological contig structure by considering contigs as networks of clones connected by significant overlaps; (iv performs iterative clone clustering combined with ordering and order verification using re-sampling methods; and (v uses global optimization methods for clone ordering and Band Map construction. The elements of this new analytical framework called Linear Topological Contig (LTC were applied on datasets used previously for the construction of the physical map of wheat chromosome 3B with FPC. The performance of LTC vs. FPC was compared also on the simulated BAC libraries based on the known genome sequences for chromosome 1 of rice and chromosome 1 of maize. Conclusions The results show that compared to other methods, LTC enables the construction of highly

  16. Physical mapping in highly heterozygous genomes: a physical contig map of the Pinot Noir grapevine cultivar

    Directory of Open Access Journals (Sweden)

    Jurman Irena

    2010-03-01

    Full Text Available Abstract Background Most of the grapevine (Vitis vinifera L. cultivars grown today are those selected centuries ago, even though grapevine is one of the most important fruit crops in the world. Grapevine has therefore not benefited from the advances in modern plant breeding nor more recently from those in molecular genetics and genomics: genes controlling important agronomic traits are practically unknown. A physical map is essential to positionally clone such genes and instrumental in a genome sequencing project. Results We report on the first whole genome physical map of grapevine built using high information content fingerprinting of 49,104 BAC clones from the cultivar Pinot Noir. Pinot Noir, as most grape varieties, is highly heterozygous at the sequence level. This resulted in the two allelic haplotypes sometimes assembling into separate contigs that had to be accommodated in the map framework or in local expansions of contig maps. We performed computer simulations to assess the effects of increasing levels of sequence heterozygosity on BAC fingerprint assembly and showed that the experimental assembly results are in full agreement with the theoretical expectations, given the heterozygosity levels reported for grape. The map is anchored to a dense linkage map consisting of 994 markers. 436 contigs are anchored to the genetic map, covering 342 of the 475 Mb that make up the grape haploid genome. Conclusions We have developed a resource that makes it possible to access the grapevine genome, opening the way to a new era both in grape genetics and breeding and in wine making. The effects of heterozygosity on the assembly have been analyzed and characterized by using several complementary approaches which could be easily transferred to the study of other genomes which present the same features.

  17. Identification of the first PAR1 deletion encompassing upstream SHOX enhancers in a family with idiopathic short stature.

    Science.gov (United States)

    Benito-Sanz, Sara; Aza-Carmona, Miriam; Rodríguez-Estevez, Amaya; Rica-Etxebarria, Ixaso; Gracia, Ricardo; Campos-Barros, Angel; Heath, Karen E

    2012-01-01

    Short stature homeobox-containing gene, MIM 312865 (SHOX) is located within the pseudoautosomal region 1 (PAR1) of the sex chromosomes. Mutations in SHOX or its downstream transcriptional regulatory elements represent the underlying molecular defect in ~60% of Léri-Weill dyschondrosteosis (LWD) and ~5-15% of idiopathic short stature (ISS) patients. Recently, three novel enhancer elements have been identified upstream of SHOX but to date, no PAR1 deletions upstream of SHOX have been observed that only encompass these enhancers in LWD or ISS patients. We set out to search for genetic alterations of the upstream SHOX regulatory elements in 63 LWD and 100 ISS patients with no known alteration in SHOX or the downstream enhancer regions using a specifically designed MLPA assay, which covers the PAR1 upstream of SHOX. An upstream SHOX deletion was identified in an ISS proband and her affected father. The deletion was confirmed and delimited by array-CGH, to extend ~286 kb. The deletion included two of the upstream SHOX enhancers without affecting SHOX. The 13.3-year-old proband had proportionate short stature with normal GH and IGF-I levels. In conclusion, we have identified the first PAR1 deletion encompassing only the upstream SHOX transcription regulatory elements in a family with ISS. The loss of these elements may result in SHOX haploinsufficiency because of decreased SHOX transcription. Therefore, this upstream region should be included in the routine analysis of PAR1 in patients with LWD, LMD and ISS.

  18. Clinical and molecular characterization of duplications encompassing the human SHOX gene reveal a variable effect on stature.

    Science.gov (United States)

    Thomas, N Simon; Harvey, John F; Bunyan, David J; Rankin, Julia; Grigelioniene, Giedre; Bruno, Damien L; Tan, Tiong Y; Tomkins, Susan; Hastings, Robert

    2009-07-01

    Deletions of the SHOX gene are well documented and cause disproportionate short stature and variable skeletal abnormalities. In contrast interstitial SHOX duplications limited to PAR1 appear to be very rare and the clinical significance of the only case report in the literature is unclear. Mapping of this duplication has now shown that it includes the entire SHOX gene but little flanking sequence and so will not encompass any of the long-range enhancers required for SHOX transcription. We now describe the clinical and molecular characterization of three additional cases. The duplications all included the SHOX coding sequence but varied in the amount of flanking sequence involved. The probands were ascertained for a variety of reasons: hypotonia and features of Asperger syndrome, Leri-Weill dyschondrosteosis (LWD), and a family history of cleft palate. However, the presence of a duplication did not correlate with any of these features or with evidence of skeletal abnormality. Remarkably, the proband with LWD had inherited both a SHOX deletion and a duplication. The effect of the duplications on stature was variable: height appeared to be elevated in some carriers, particularly in those with the largest duplications, but was still within the normal range. SHOX duplications are likely to be under ascertained and more cases need to be identified and characterized in detail in order to accurately determine their phenotypic consequences.

  19. Physical and transcription map of a 25 Mb region on human chromosome 7 (region q21-q22)

    Energy Technology Data Exchange (ETDEWEB)

    Scherer, S. [Univ. of Toronto (Canada)]|[Hosptial for Sick Children, Toronto (Canada); Little, S.; Vandenberg, A. [Hospital for Sick Children, Toronto (Canada)] [and others

    1994-09-01

    We are interested in the q21-q22 region of chromosome 7 because of its implication in a number of diseases. This region of about 25 Mb appears to be involved in ectrodactyly/ectodermal dysplasia/cleft plate (EEC) and split hand/split foot deformity (SHFD1), as well as myelodysplastic syndrome and acute non-lymphocyte leukemia. In order to identify the genes responsible for these and other diseases, we have constructed a physical map of this region. The proximal and distal boundaries of the region were operationally defined by the microsatellite markers D7S660 and D7S692, which are about 35 cM apart. This region between these two markers could be divided into 13 intervals on the basis of chromosome breakpoints contained in somatic cell hybrids. The map positions for 43 additional microsatellite markers and 25 cloned genes were determined with respect to these intervals. A physical map based on contigs of over 250 YACs has also been assembled. While the contigs encompass all of the known genetic markers mapped to the region and almost cover the entire 25-Mb region, there are 3 gaps on the map. One of these gaps spans a set of DNA markers for which no corresponding YAC clones could be identified. To connect the two adjacent contigs we have initiated cosmid walking with a chromosome 7-specific library (Lawrence Livermore Laboratory). A tiling path of 60 contiguous YAC clones has been assembled and used for direct cDNA selection. Over 300 cDNA clones have been isolated and characterized. They are being grouped into transcription units by Northern blot analysis and screening of full-length cDNA libraries. Further, exon amplification and direct cDNA library screening with evolutionarily conserved sequences are being performed for a 1-Mb region spanning the SHFD1 locus to ensure detection of all transcribed sequences.

  20. A post-assembly genome-improvement toolkit (PAGIT) to obtain annotated genomes from contigs.

    Science.gov (United States)

    Swain, Martin T; Tsai, Isheng J; Assefa, Samual A; Newbold, Chris; Berriman, Matthew; Otto, Thomas D

    2012-06-07

    Genome projects now produce draft assemblies within weeks owing to advanced high-throughput sequencing technologies. For milestone projects such as Escherichia coli or Homo sapiens, teams of scientists were employed to manually curate and finish these genomes to a high standard. Nowadays, this is not feasible for most projects, and the quality of genomes is generally of a much lower standard. This protocol describes software (PAGIT) that is used to improve the quality of draft genomes. It offers flexible functionality to close gaps in scaffolds, correct base errors in the consensus sequence and exploit reference genomes (if available) in order to improve scaffolding and generating annotations. The protocol is most accessible for bacterial and small eukaryotic genomes (up to 300 Mb), such as pathogenic bacteria, malaria and parasitic worms. Applying PAGIT to an E. coli assembly takes ∼24 h: it doubles the average contig size and annotates over 4,300 gene models.

  1. Dicty_cDB: Contig-U01541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ula chromosome 7 BAC clone mth2-7... 36 3.7 5 ( FG283242 ) 1108457714276 New World Screwworm Egg 9261 ESTs C...1-1... 40 3.8 2 ( AM448784 ) Vitis vinifera contig VV78X077229.13, whole genom... 40 3.8 5 ( FG299281 ) 1108793334783 New World...malized cDNA li... 34 3.8 3 ( FG298782 ) 1108793320683 New World Screwworm Larvae 9387 EST... 40 3.8 2 ( AC2...) Populus trichocarpa clone POP011-A24, complete se... 38 3.9 5 ( FG298363 ) 1108793311332 New World Screwwo...rm Larvae 9387 EST... 40 3.9 2 ( AE017263 ) Mesoplasma florum L1 complete genome. 34 3.9 11 ( FG290177 ) 1108793315292 New World

  2. L’Anaphore associative: contigüité métonymique

    Directory of Open Access Journals (Sweden)

    Gemma Peña Martínez

    2008-04-01

    Full Text Available Cet article porte sur les rapports de contigüité exigés lors de la résolution des anaphores associatives. Il s’agit en général de relations métonymiques, car les différents rapports, à caractère notamment socioculturel, entre référent et marque anaphorique convergent dans un même cadre conceptuel, se faisant écho d’éléments ou caractéristiques du même domaine cognitif. L’anaphore associative reprenant ainsi un attribut concret du référent, nous envisageons donc une classification de ces marques anaphoriques d’après des rapports métonymiques, tels que partie à tout, objet à matière et caractéristique ou propriété à objet.

  3. First report of a deletion encompassing an entire exon in the homogentisate 1,2-dioxygenase gene causing alkaptonuria.

    Science.gov (United States)

    Zouheir Habbal, Mohammad; Bou-Assi, Tarek; Zhu, Jun; Owen, Renius; Chehab, Farid F

    2014-01-01

    Alkaptonuria is often diagnosed clinically with episodes of dark urine, biochemically by the accumulation of peripheral homogentisic acid and molecularly by the presence of mutations in the homogentisate 1,2-dioxygenase gene (HGD). Alkaptonuria is invariably associated with HGD mutations, which consist of single nucleotide variants and small insertions/deletions. Surprisingly, the presence of deletions beyond a few nucleotides among over 150 reported deleterious mutations has not been described, raising the suspicion that this gene might be protected against the detrimental mechanisms of gene rearrangements. The quest for an HGD mutation in a proband with AKU revealed with a SNP array five large regions of homozygosity (5-16 Mb), one of which includes the HGD gene. A homozygous deletion of 649 bp deletion that encompasses the 72 nucleotides of exon 2 and surrounding DNA sequences in flanking introns of the HGD gene was unveiled in a proband with AKU. The nature of this deletion suggests that this in-frame deletion could generate a protein without exon 2. Thus, we modeled the tertiary structure of the mutant protein structure to determine the effect of exon 2 deletion. While the two β-pleated sheets encoded by exon 2 were missing in the mutant structure, other β-pleated sheets are largely unaffected by the deletion. However, nine novel α-helical coils substituted the eight coils present in the native HGD crystal structure. Thus, this deletion results in a deleterious enzyme, which is consistent with the proband's phenotype. Screening for mutations in the HGD gene, particularly in the Middle East, ought to include this exon 2 deletion in order to determine its frequency and uncover its origin.

  4. Can Static Habitat Protection Encompass Critical Areas for Highly Mobile Marine Top Predators? Insights from Coastal East Africa.

    Directory of Open Access Journals (Sweden)

    Sergi Pérez-Jorge

    Full Text Available Along the East African coast, marine top predators are facing an increasing number of anthropogenic threats which requires the implementation of effective and urgent conservation measures to protect essential habitats. Understanding the role that habitat features play on the marine top predator' distribution and abundance is a crucial step to evaluate the suitability of an existing Marine Protected Area (MPA, originally designated for the protection of coral reefs. We developed species distribution models (SDM on the IUCN data deficient Indo-Pacific bottlenose dolphin (Tursiops aduncus in southern Kenya. We followed a comprehensive ecological modelling approach to study the environmental factors influencing the occurrence and abundance of dolphins while developing SDMs. Through the combination of ensemble prediction maps, we defined recurrent, occasional and unfavourable habitats for the species. Our results showed the influence of dynamic and static predictors on the dolphins' spatial ecology: dolphins may select shallow areas (5-30 m, close to the reefs (< 500 m and oceanic fronts (< 10 km and adjacent to the 100 m isobath (< 5 km. We also predicted a significantly higher occurrence and abundance of dolphins within the MPA. Recurrent and occasional habitats were identified on large percentages on the existing MPA (47% and 57% using presence-absence and abundance models respectively. However, the MPA does not adequately encompass all occasional and recurrent areas and within this context, we propose to extend the MPA to incorporate all of them which are likely key habitats for the highly mobile species. The results from this study provide two key conservation and management tools: (i an integrative habitat modelling approach to predict key marine habitats, and (ii the first study evaluating the effectiveness of an existing MPA for marine mammals in the Western Indian Ocean.

  5. First report of a deletion encompassing an entire exon in the homogentisate 1,2-dioxygenase gene causing alkaptonuria.

    Directory of Open Access Journals (Sweden)

    Mohammad Zouheir Habbal

    Full Text Available Alkaptonuria is often diagnosed clinically with episodes of dark urine, biochemically by the accumulation of peripheral homogentisic acid and molecularly by the presence of mutations in the homogentisate 1,2-dioxygenase gene (HGD. Alkaptonuria is invariably associated with HGD mutations, which consist of single nucleotide variants and small insertions/deletions. Surprisingly, the presence of deletions beyond a few nucleotides among over 150 reported deleterious mutations has not been described, raising the suspicion that this gene might be protected against the detrimental mechanisms of gene rearrangements. The quest for an HGD mutation in a proband with AKU revealed with a SNP array five large regions of homozygosity (5-16 Mb, one of which includes the HGD gene. A homozygous deletion of 649 bp deletion that encompasses the 72 nucleotides of exon 2 and surrounding DNA sequences in flanking introns of the HGD gene was unveiled in a proband with AKU. The nature of this deletion suggests that this in-frame deletion could generate a protein without exon 2. Thus, we modeled the tertiary structure of the mutant protein structure to determine the effect of exon 2 deletion. While the two β-pleated sheets encoded by exon 2 were missing in the mutant structure, other β-pleated sheets are largely unaffected by the deletion. However, nine novel α-helical coils substituted the eight coils present in the native HGD crystal structure. Thus, this deletion results in a deleterious enzyme, which is consistent with the proband's phenotype. Screening for mutations in the HGD gene, particularly in the Middle East, ought to include this exon 2 deletion in order to determine its frequency and uncover its origin.

  6. Direct selection of expressed sequences on a YAC clone revealed proline-rich-like genes and BARE-1 sequences physically linked to the complex ¤Mla¤ powdery mildew resistance locus of barley (¤Hordeum vulgare¤ L.)

    DEFF Research Database (Denmark)

    Schwarz, G.; Michalek, W.; Jahoor, A.

    2002-01-01

    homology to the copia-like retroelement BA REI of barley, putatively involved in evolution of disease resistance loci. The high degree of clones representing barley rRNA sequences or false positives is a major disadvantage of direct selection of cDNAs in barley. (C) 2002 Elsevier Science Ireland Ltd. All...... gene. Of 22 selected cDNA clones, six were re-located on the YAC by southern analysis. Two of these clones are predicted to encode members of the hydroxyproline-rich glycoprotein and proline-rich protein gene families which have been implicated in plant defense response. Four sequences showed high...

  7. Cybersemiotics: Suggestion for a Transdisciplinary Framework Encompassing Natural, Life, and Social Sciences as Well as Phenomenology and Humanities

    Directory of Open Access Journals (Sweden)

    Søren Brier

    2014-01-01

    Full Text Available The modern evolutionary paradigm combined with phenomenology forces us to view human consciousness as a product of evolution as well as accepting humans as observers from “within the universe”. The knowledge produced by science has first-person embodied consciousness combined with second-person meaningful communication in language as a prerequisite for third-person fallibilist scientific knowledge. Therefore, the study of consciousness forces us theoretically to encompass the natural and social sciences as well as the humanities in one framework of unrestricted or absolute naturalism. This means to view conscious quale life world with its intentionality as well as the intersubjectivity of culture as a part of nature, and therefore the whole human being as treated in modern bio-medicine. The ‘bio’ is not enough. The crucial question for a transdisciplinary theory of conscious human being is therefore: What is the role of consciousness, signs, and meaning in evolution as well as in cultural development? But this is problematic since the sciences in their present form are without concepts of qualia and meaning, and the European phenomenological-hermeneutic “sciences of meaning” does not have an evolutionary foundation. It is therefore interesting that C.S. Peirce phaneroscopic semiotics - in its modern form of a biosemiotics - was based on a phenomenological basis as well as an evolutionary thinking and ecology of sign webs at the same time drawing on knowledge from the sciences. To develop this 100 year old paradigm it is necessary to supplement it with the knowledge gained from the technologically founded information sciences, as well as systems, and cybernetics in order to produce a transdisciplinary alternative to logical positivism on the one hand and postmodern constructivism on the other. Cybersemiotics constructs such a non-reductionist naturalistic framework in order to integrate third-person knowledge from the exact sciences

  8. ScaffoldScaffolder: solving contig orientation via bidirected to directed graph reduction.

    Science.gov (United States)

    Bodily, Paul M; Fujimoto, M Stanley; Snell, Quinn; Ventura, Dan; Clement, Mark J

    2016-01-01

    The contig orientation problem, which we formally define as the MAX-DIR problem, has at times been addressed cursorily and at times using various heuristics. In setting forth a linear-time reduction from the MAX-CUT problem to the MAX-DIR problem, we prove the latter is NP-complete. We compare the relative performance of a novel greedy approach with several other heuristic solutions. Our results suggest that our greedy heuristic algorithm not only works well but also outperforms the other algorithms due to the nature of scaffold graphs. Our results also demonstrate a novel method for identifying inverted repeats and inversion variants, both of which contradict the basic single-orientation assumption. Such inversions have previously been noted as being difficult to detect and are directly involved in the genetic mechanisms of several diseases. http://bioresearch.byu.edu/scaffoldscaffolder. paulmbodily@gmail.com Supplementary data are available at Bioinformatics online. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  9. Gene content and organization of a 281-kbp contig from the genome of the extremely thermophilic archaeon, Sulfolobus solfataricus P2

    NARCIS (Netherlands)

    Charlebois, R.; Confalonieri, F.; Curtis, B.; Doolittle, W.F.; Duguet, M.; Erauso, G.; Faguy, D.; Gaasterland, T.; Garrett, R.A.; Gordon, P.; Kozera, C.; Medina, N.; Oost, van der J.; Peng, X.; Ragan, M.; She, Q.; Singh, R.K.

    2000-01-01

    The sequence of a 281-kbp contig from the crenarchaeote Sulfolobus solfataricus P2 was determined and analysed. Notable features in this region include 29 ribosomal protein genes, 12 tRNA genes (four of which contain archaeal-type introns), operons encoding enzymes of histidine biosynthesis,

  10. The soybean-Phytophthora resistance locus Rps1-k encompasses coiled coil-nucleotide binding-leucine rich repeat-like genes and repetitive sequences

    Directory of Open Access Journals (Sweden)

    Bhattacharyya Madan K

    2008-03-01

    Full Text Available Abstract Background A series of Rps (resistance to Pytophthora sojae genes have been protecting soybean from the root and stem rot disease caused by the Oomycete pathogen, Phytophthora sojae. Five Rps genes were mapped to the Rps1 locus located near the 28 cM map position on molecular linkage group N of the composite genetic soybean map. Among these five genes, Rps1-k was introgressed from the cultivar, Kingwa. Rps1-k has been providing stable and broad-spectrum Phytophthora resistance in the major soybean-producing regions of the United States. Rps1-k has been mapped and isolated. More than one functional Rps1-k gene was identified from the Rps1-k locus. The clustering feature at the Rps1-k locus might have facilitated the expansion of Rps1-k gene numbers and the generation of new recognition specificities. The Rps1-k region was sequenced to understand the possible evolutionary steps that shaped the generation of Phytophthora resistance genes in soybean. Results Here the analyses of sequences of three overlapping BAC clones containing the 184,111 bp Rps1-k region are reported. A shotgun sequencing strategy was applied in sequencing the BAC contig. Sequence analysis predicted a few full-length genes including two Rps1-k genes, Rps1-k-1 and Rps1-k-2. Previously reported Rps1-k-3 from this genomic region 1 was evolved through intramolecular recombination between Rps1-k-1 and Rps1-k-2 in Escherichia coli. The majority of the predicted genes are truncated and therefore most likely they are nonfunctional. A member of a highly abundant retroelement, SIRE1, was identified from the Rps1-k region. The Rps1-k region is primarily composed of repetitive sequences. Sixteen simple repeat and 63 tandem repeat sequences were identified from the locus. Conclusion These data indicate that the Rps1 locus is located in a gene-poor region. The abundance of repetitive sequences in the Rps1-k region suggested that the location of this locus is in or near a

  11. Complete re-sequencing of a 2Mb topological domain encompassing the FTO/IRXB genes identifies a novel obesity-associated region upstream of IRX5

    DEFF Research Database (Denmark)

    Hunt, Lilian E; Noyvert, Boris; Bhaw-Rosun, Leena

    2015-01-01

    BACKGROUND: Association studies have identified a number of loci that contribute to an increased body mass index (BMI), the strongest of which is in the first intron of the FTO gene on human chromosome 16q12.2. However, this region is both non-coding and under strong linkage disequilibrium, making...... it recalcitrant to functional interpretation. Furthermore, the FTO gene is located within a complex cis-regulatory landscape defined by a topologically associated domain that includes the IRXB gene cluster, a trio of developmental regulators. Consequently, at least three genes in this interval have been...... implicated in the aetiology of obesity. METHODS: Here, we sequence a 2 Mb region encompassing the FTO, RPGRIP1L and IRXB cluster genes in 284 individuals from a well-characterised study group of Danish men containing extremely overweight young adults and controls. We further replicate our findings both...

  12. Patterns of Nucleotide Diversity at the Regions Encompassing the Drosophila Insulin-Like Peptide (dilp) Genes: Demography vs. Positive Selection in Drosophila melanogaster

    Science.gov (United States)

    Guirao-Rico, Sara; Aguadé, Montserrat

    2013-01-01

    In Drosophila, the insulin-signaling pathway controls some life history traits, such as fertility and lifespan, and it is considered to be the main metabolic pathway involved in establishing adult body size. Several observations concerning variation in body size in the Drosophila genus are suggestive of its adaptive character. Genes encoding proteins in this pathway are, therefore, good candidates to have experienced adaptive changes and to reveal the footprint of positive selection. The Drosophila insulin-like peptides (DILPs) are the ligands that trigger the insulin-signaling cascade. In Drosophila melanogaster, there are several peptides that are structurally similar to the single mammalian insulin peptide. The footprint of recent adaptive changes on nucleotide variation can be unveiled through the analysis of polymorphism and divergence. With this aim, we have surveyed nucleotide sequence variation at the dilp1-7 genes in a natural population of D. melanogaster. The comparison of polymorphism in D. melanogaster and divergence from D. simulans at different functional classes of the dilp genes provided no evidence of adaptive protein evolution after the split of the D. melanogaster and D. simulans lineages. However, our survey of polymorphism at the dilp gene regions of D. melanogaster has provided some evidence for the action of positive selection at or near these genes. The regions encompassing the dilp1-4 genes and the dilp6 gene stand out as likely affected by recent adaptive events. PMID:23308258

  13. Conundrums with penumbras: the right to privacy encompasses non-gamete providers who create preembryos with the intent to become parents.

    Science.gov (United States)

    Dillon, Lainie M C

    2003-05-01

    To date, five state high courts have resolved disputes over frozen preembryos. These disputes arose during divorce proceedings between couples who had previously used assisted reproduction and cryopreserved excess preembryos. In each case, one spouse wished to have the preembryos destroyed, while the other wanted to be able to use or donate them in the future. The parties in these cases invoked the constitutional right to privacy to argue for dispositional control over the preembryos; two of the five cases were resolved by relying on this right. The constitutional right to privacy protects intimate decisions involving procreation, marriage, and family life. However, when couples use donated sperm or ova to create preembryos, a unique circumstance arises: one spouse--the gamete provider--is genetically related to the preembryos and the other is not. If courts resolve frozen preembryo disputes that involve non-gamete providers based on the constitutional right to privacy, they should find that the constitutional right to privacy encompasses the interests of both gamete and non-gamete providers. Individuals who create preembryos with the intent to become a parent have made an intimate decision involving procreation, marriage, and family life that falls squarely within the the right to privacy. In such cases, the couple together made the decision to create a family through the use of assisted reproduction, and the preembryos would not exist but for that joint decision. Therefore, gamete and non-gamete providers should be afforded equal constitutional protection in disputes over frozen preembryos.

  14. Small mosaic deletion encompassing the snoRNAs and SNURF-SNRPN results in an atypical Prader-Willi syndrome phenotype.

    Science.gov (United States)

    Anderlid, Britt-Marie; Lundin, Johanna; Malmgren, Helena; Lehtihet, Mikael; Nordgren, Ann

    2014-02-01

    Genetic analyses were performed in a male patient with suspected Prader-Willi syndrome who presented with hypogonadism, excessive eating, central obesity, small hands and feet and cognition within the low normal range. However, he had no neonatal hypotonia or feeding problems during infancy. Chromosome analysis showed a normal male karyotype. Further analysis with array-CGH identified a mosaic 847 kb deletion in 15q11-q13, including SNURF-SNRPN, the snoRNA gene clusters SNORD116 (HBII-85), SNORD115, (HBII-52), SNORD109 A and B (HBII-438A and B), SNORD64 (HBII-13), and NPAP1 (C15ORF2). MLPA confirmed the deletion and the results were compatible with a paternal origin. Metaphase-FISH verified the mosaicism with the deletion present in 58% of leukocytes analyzed. Three smaller deletions in this region have previously been reported in patients with Prader-Willi syndrome phenotype. All three deletions included SNORD116, but only two encompassed parts of SNURF-SNRPN, implicating SNORD116 as the major contributor to the Prader-Willi phenotype. Our case adds further information about genotype-phenotype correlation and supports the hypothesis that SNORD116 plays a major role in the pathogenesis of Prader-Willi syndrome. Furthermore, it examplifies diagnostic difficulties in atypical cases and illustrates the need for additional testing methods when Prader-Willi syndrome is suspected. © 2013 Wiley Periodicals, Inc.

  15. Rare RNF213 variants in the C-terminal region encompassing the RING-finger domain are associated with moyamoya angiopathy in Caucasians.

    Science.gov (United States)

    Guey, Stéphanie; Kraemer, Markus; Hervé, Dominique; Ludwig, Thomas; Kossorotoff, Manoëlle; Bergametti, Françoise; Schwitalla, Jan Claudius; Choi, Simone; Broseus, Lucile; Callebaut, Isabelle; Genin, Emmanuelle; Tournier-Lasserve, Elisabeth

    2017-08-01

    Moyamoya angiopathy (MMA) is a cerebral angiopathy affecting the terminal part of internal carotid arteries. Its prevalence is 10 times higher in Japan and Korea than in Europe. In East Asian countries, moyamoya is strongly associated to the R4810K variant in the RNF213 gene that encodes for a protein containing a RING-finger and two AAA+ domains. This variant has never been detected in Caucasian MMA patients, but several rare RNF213 variants have been reported in Caucasian cases. Using a collapsing test based on exome data from 68 European MMA probands and 573 ethnically matched controls, we showed a significant association between rare missense RNF213 variants and MMA in European patients (odds ratio (OR)=2.24, 95% confidence interval (CI)=(1.19-4.11), P=0.01). Variants specific to cases had higher pathogenicity predictive scores (median of 24.2 in cases versus 9.4 in controls, P=0.029) and preferentially clustered in a C-terminal hotspot encompassing the RING-finger domain of RNF213 (P<10 -3 ). This association was even stronger when restricting the analysis to childhood-onset and familial cases (OR=4.54, 95% CI=(1.80-11.34), P=1.1 × 10 -3 ). All clinically affected relatives who were genotyped were carriers. However, the need for additional factors to develop MMA is strongly suggested by the fact that only 25% of mutation carrier relatives were clinically affected.

  16. Giant panda BAC library construction and assembly of a 650-kb contig spanning major histocompatibility complex class II region

    Directory of Open Access Journals (Sweden)

    Pan Hui-Juan

    2007-09-01

    Full Text Available Abstract Background Giant panda is rare and endangered species endemic to China. The low rates of reproductive success and infectious disease resistance have severely hampered the development of captive and wild populations of the giant panda. The major histocompatibility complex (MHC plays important roles in immune response and reproductive system such as mate choice and mother-fetus bio-compatibility. It is thus essential to understand genetic details of the giant panda MHC. Construction of a bacterial artificial chromosome (BAC library will provide a new tool for panda genome physical mapping and thus facilitate understanding of panda MHC genes. Results A giant panda BAC library consisting of 205,800 clones has been constructed. The average insert size was calculated to be 97 kb based on the examination of 174 randomly selected clones, indicating that the giant panda library contained 6.8-fold genome equivalents. Screening of the library with 16 giant panda PCR primer pairs revealed 6.4 positive clones per locus, in good agreement with an expected 6.8-fold genomic coverage of the library. Based on this BAC library, we constructed a contig map of the giant panda MHC class II region from BTNL2 to DAXX spanning about 650 kb by a three-step method: (1 PCR-based screening of the BAC library with primers from homologous MHC class II gene loci, end sequences and BAC clone shotgun sequences, (2 DNA sequencing validation of positive clones, and (3 restriction digest fingerprinting verification of inter-clone overlapping. Conclusion The identifications of genes and genomic regions of interest are greatly favored by the availability of this giant panda BAC library. The giant panda BAC library thus provides a useful platform for physical mapping, genome sequencing or complex analysis of targeted genomic regions. The 650 kb sequence-ready BAC contig map of the giant panda MHC class II region from BTNL2 to DAXX, verified by the three-step method, offers a

  17. A 3.7 Mb Deletion Encompassing ZEB2 Causes a Novel Polled and Multisystemic Syndrome in the Progeny of a Somatic Mosaic Bull

    Science.gov (United States)

    Capitan, Aurélien; Allais-Bonnet, Aurélie; Pinton, Alain; Marquant-Le Guienne, Brigitte; Le Bourhis, Daniel; Grohs, Cécile; Bouet, Stéphan; Clément, Laëtitia; Salas-Cortes, Laura; Venot, Eric; Chaffaux, Stéphane; Weiss, Bernard; Delpeuch, Arnaud; Noé, Guy; Rossignol, Marie-Noëlle; Barbey, Sarah; Dozias, Dominique; Cobo, Emilie; Barasc, Harmonie; Auguste, Aurélie; Pannetier, Maëlle; Deloche, Marie-Christine; Lhuilier, Emeline; Bouchez, Olivier; Esquerré, Diane; Salin, Gérald; Klopp, Christophe; Donnadieu, Cécile; Chantry-Darmon, Céline; Hayes, Hélène; Gallard, Yves; Ponsart, Claire; Boichard, Didier; Pailhoux, Eric

    2012-01-01

    Polled and Multisystemic Syndrome (PMS) is a novel developmental disorder occurring in the progeny of a single bull. Its clinical spectrum includes polledness (complete agenesis of horns), facial dysmorphism, growth delay, chronic diarrhea, premature ovarian failure, and variable neurological and cardiac anomalies. PMS is also characterized by a deviation of the sex-ratio, suggesting male lethality during pregnancy. Using Mendelian error mapping and whole-genome sequencing, we identified a 3.7 Mb deletion on the paternal bovine chromosome 2 encompassing ARHGAP15, GTDC1 and ZEB2 genes. We then produced control and affected 90-day old fetuses to characterize this syndrome by histological and expression analyses. Compared to wild type individuals, affected animals showed a decreased expression of the three deleted genes. Based on a comparison with human Mowat-Wilson syndrome, we suggest that deletion of ZEB2, is responsible for most of the effects of the mutation. Finally sperm-FISH, embryo genotyping and analysis of reproduction records confirmed somatic mosaicism in the founder bull and male-specific lethality during the first third of gestation. In conclusion, we identified a novel locus involved in bovid horn ontogenesis and suggest that epithelial-to-mesenchymal transition plays a critical role in horn bud differentiation. We also provide new insights into the pathogenicity of ZEB2 loss of heterozygosity in bovine and humans and describe the first case of male-specific lethality associated with an autosomal locus in a non-murine mammalian species. This result sets PMS as a unique model to study sex-specific gene expression/regulation. PMID:23152852

  18. Toxoplasma gondii infection shifts dendritic cells into an amoeboid rapid migration mode encompassing podosome dissolution, secretion of TIMP-1, and reduced proteolysis of extracellular matrix.

    Science.gov (United States)

    Ólafsson, Einar B; Varas-Godoy, Manuel; Barragan, Antonio

    2018-03-01

    Dendritic cells (DCs) infected by Toxoplasma gondii rapidly acquire a hypermigratory phenotype that promotes systemic parasite dissemination by a "Trojan horse" mechanism in mice. Recent paradigms of leukocyte migration have identified the amoeboid migration mode of DCs as particularly suited for rapid locomotion in extracellular matrix and tissues. Here, we have developed a microscopy-based high-throughput approach to assess motility and matrix degradation by Toxoplasma-challenged murine and human DCs. DCs challenged with T. gondii exhibited dependency on metalloproteinase activity for hypermotility and transmigration but, strikingly, also dramatically reduced pericellular proteolysis. Toxoplasma-challenged DCs up-regulated expression and secretion of tissue inhibitor of metalloproteinases-1 (TIMP-1) and their supernatants impaired matrix degradation by naïve DCs and by-stander DCs dose dependently. Gene silencing of TIMP-1 by short hairpin RNA restored matrix degradation activity in Toxoplasma-infected DCs. Additionally, dissolution of podosome structures in parasitised DCs coincided with abrogated matrix degradation. Toxoplasma lysates inhibited pericellular proteolysis in a MyD88-dependent fashion whereas abrogated proteolysis persevered in Toxoplasma-infected MyD88-deficient DCs. This indicated that both TLR/MyD88-dependent and TLR/MyD88-independent signalling pathways mediated podosome dissolution and the abrogated matrix degradation. We report that increased TIMP-1 secretion and cytoskeletal rearrangements encompassing podosome dissolution are features of Toxoplasma-induced hypermigration of DCs with an impact on matrix degradation. Jointly, the data highlight how an obligate intracellular parasite orchestrates key regulatory cellular processes consistent with non-proteolytic amoeboid migration of the vehicle cells that facilitate its dissemination. © 2017 John Wiley & Sons Ltd.

  19. A contig-based strategy for the genome-wide discovery of microRNAs without complete genome resources.

    Directory of Open Access Journals (Sweden)

    Jun-Zhi Wen

    Full Text Available MicroRNAs (miRNAs are important regulators of many cellular processes and exist in a wide range of eukaryotes. High-throughput sequencing is a mainstream method of miRNA identification through which it is possible to obtain the complete small RNA profile of an organism. Currently, most approaches to miRNA identification rely on a reference genome for the prediction of hairpin structures. However, many species of economic and phylogenetic importance are non-model organisms without complete genome sequences, and this limits miRNA discovery. Here, to overcome this limitation, we have developed a contig-based miRNA identification strategy. We applied this method to a triploid species of edible banana (GCTCV-119, Musa spp. AAA group and identified 180 pre-miRNAs and 314 mature miRNAs, which is three times more than those were predicted by the available dataset-based methods (represented by EST+GSS. Based on the recently published miRNA data set of Musa acuminate, the recall rate and precision of our strategy are estimated to be 70.6% and 92.2%, respectively, significantly better than those of EST+GSS-based strategy (10.2% and 50.0%, respectively. Our novel, efficient and cost-effective strategy facilitates the study of the functional and evolutionary role of miRNAs, as well as miRNA-based molecular breeding, in non-model species of economic or evolutionary interest.

  20. COCACOLA: binning metagenomic contigs using sequence COmposition, read CoverAge, CO-alignment and paired-end read LinkAge.

    Science.gov (United States)

    Lu, Yang Young; Chen, Ting; Fuhrman, Jed A; Sun, Fengzhu

    2017-03-15

    The advent of next-generation sequencing technologies enables researchers to sequence complex microbial communities directly from the environment. Because assembly typically produces only genome fragments, also known as contigs, instead of an entire genome, it is crucial to group them into operational taxonomic units (OTUs) for further taxonomic profiling and down-streaming functional analysis. OTU clustering is also referred to as binning. We present COCACOLA, a general framework automatically bin contigs into OTUs based on sequence composition and coverage across multiple samples. The effectiveness of COCACOLA is demonstrated in both simulated and real datasets in comparison with state-of-art binning approaches such as CONCOCT, GroopM, MaxBin and MetaBAT. The superior performance of COCACOLA relies on two aspects. One is using L 1 distance instead of Euclidean distance for better taxonomic identification during initialization. More importantly, COCACOLA takes advantage of both hard clustering and soft clustering by sparsity regularization. In addition, the COCACOLA framework seamlessly embraces customized knowledge to facilitate binning accuracy. In our study, we have investigated two types of additional knowledge, the co-alignment to reference genomes and linkage of contigs provided by paired-end reads, as well as the ensemble of both. We find that both co-alignment and linkage information further improve binning in the majority of cases. COCACOLA is scalable and faster than CONCOCT, GroopM, MaxBin and MetaBAT. The software is available at https://github.com/younglululu/COCACOLA . fsun@usc.edu. Supplementary data are available at Bioinformatics online. © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com

  1. Report of the Fourth International Workshop on human X chromosome mapping 1993

    Energy Technology Data Exchange (ETDEWEB)

    Schlessinger, D.; Mandel, J.L.; Monaco, A.P.; Nelson, D.L.; Willard, H.F. [eds.

    1993-12-31

    Vigorous interactive efforts by the X chromosome community have led to accelerated mapping in the last six months. Seventy-five participants from 12 countries around the globe contributed progress reports to the Fourth International X Chromosome Workshop, at St. Louis, MO, May 9-12, 1993. It became clear that well over half the chromosome is now covered by YAC contigs that are being extended, verified, and aligned by their content of STSs and other markers placed by cytogenetic or linkage mapping techniques. The major aim of the workshop was to assemble the consensus map that appears in this report, summarizing both consensus order and YAC contig information.

  2. Detection of a Usp-like gene in Calotropis procera plant from the de novo assembled genome contigs of the high-throughput sequencing dataset

    KAUST Repository

    Shokry, Ahmed M.

    2014-02-01

    The wild plant species Calotropis procera (C. procera) has many potential applications and beneficial uses in medicine, industry and ornamental field. It also represents an excellent source of genes for drought and salt tolerance. Genes encoding proteins that contain the conserved universal stress protein (USP) domain are known to provide organisms like bacteria, archaea, fungi, protozoa and plants with the ability to respond to a plethora of environmental stresses. However, information on the possible occurrence of Usp in C. procera is not available. In this study, we uncovered and characterized a one-class A Usp-like (UspA-like, NCBI accession No. KC954274) gene in this medicinal plant from the de novo assembled genome contigs of the high-throughput sequencing dataset. A number of GenBank accessions for Usp sequences were blasted with the recovered de novo assembled contigs. Homology modelling of the deduced amino acids (NCBI accession No. AGT02387) was further carried out using Swiss-Model, accessible via the EXPASY. Superimposition of C. procera USPA-like full sequence model on Thermus thermophilus USP UniProt protein (PDB accession No. Q5SJV7) was constructed using RasMol and Deep-View programs. The functional domains of the novel USPA-like amino acids sequence were identified from the NCBI conserved domain database (CDD) that provide insights into sequence structure/function relationships, as well as domain models imported from a number of external source databases (Pfam, SMART, COG, PRK, TIGRFAM). © 2014 Académie des sciences.

  3. The canine sarcoglycan delta gene: BAC clone contig assembly, chromosome assignment and interrogation as a candidate gene for dilated cardiomyopathy in Dobermann dogs.

    Science.gov (United States)

    Stabej, P; Leegwater, P A J; Imholz, S; Versteeg, S A; Zijlstra, C; Stokhof, A A; Domanjko-Petriè, A; van Oost, B A

    2005-01-01

    Dilated cardiomyopathy (DCM) is a common disease of the myocardium recognized in human, dog and experimental animals. Genetic factors are responsible for a large proportion of cases in humans, and 17 genes with DCM causing mutations have been identified. The genetic origin of DCM in the Dobermann dogs has been suggested, but no disease genes have been identified to date. In this paper, we describe the characterization and evaluation of the canine sarcoglycan delta (SGCD), a gene implicated in DCM in human and hamster. Bacterial artificial chromosomes (BACs) containing the canine SGCD gene were isolated with probes for exon 3 and exons 4-8 and were characterized by Southern blot analysis. BAC end sequences were obtained for four BACs. Three of the BACs overlapped and could be ordered relative to each other and the end sequences of all four BACs could be anchored on the preliminary assembly of the dog genome sequence (www. ensembl.org). One of the BACs of the partial contig was localized by fluorescent in situ hybridization to canine chromosome 4q22, in agreement with the dog genome sequence. Two highly informative polymorphic microsatellite markers in intron 7 of the SGCD gene were identified. In 25 DCM-affected and 13 non DCM-affected dogs seven different haplotypes could be distinguished. However, no association between any of the SGCD variants and the disease locus was apparent.

  4. Identification of evolutionary hotspots based on genetic data from multiple terrestrial and aquatic taxa and gap analysis of hotspots in protected lands encompassed by the South Atlantic Landscape Conservation Cooperative.

    Science.gov (United States)

    Robinson, J.; Snider, M.; Duke, J.; Moyer, G.R.

    2014-01-01

     The southeastern United States is a recognized hotspot of biodiversity for a variety of aquatic taxa, including fish, amphibians, and mollusks. Unfortunately, the great diversity of the area is accompanied by a large proportion of species at risk of extinction . Gap analysis was employed to assess the representation of evolutionary hotspots in protected lands w h ere an evolutionary hotspot was defined as an area with high evolutionary potential and measured by atypical patterns of genetic divergence, genetic diversity, and to a lesser extent genetic similarity across multiple terrestrial or aquatic taxa. A survey of the primary literature produced 16 terrestrial and 14 aquatic genetic datasets for estimation of genetic divergence and diversity. Relative genetic diversity and divergence values for each terrestrial and aquatic dataset were used for interpolation of multispecies genetic surfaces and subsequent visualization using ArcGIS. The multispecies surfaces interpolated from relative divergences and diversity data identified numerous evolutionary hotspots for both terrestrial and aquatic taxa , many of which were afforded some current protection. For instance, 14% of the cells identified as hotspots of aquatic diversity were encompassed by currently protected areas. Additionally, 25% of the highest 1% of terrestrial diversity cells were afforded some level of protection. In contrast, areas of high and low divergence among species, and areas of high variance in diversity were poorly represented in the protected lands. Of particular interest were two areas that were consistently identified by several different measures as important from a conservation perspective. These included an area encompassing the panhandle of Florida and southern Georgia near the Apalachicola National Forest (displaying varying levels of genetic divergence and greater than average levels of genetic diversity) and a large portion of the coastal regions of North and South Carolina

  5. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles

    Directory of Open Access Journals (Sweden)

    Boussaha Mekki

    2006-05-01

    Full Text Available Abstract Background The Fragile Histidine Triad gene (FHIT is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. Results The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. Conclusion A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis

  6. Comparative genomic mapping of the bovine Fragile Histidine Triad (FHIT) tumour suppressor gene: characterization of a 2 Mb BAC contig covering the locus, complete annotation of the gene, analysis of cDNA and of physiological expression profiles.

    Science.gov (United States)

    Uboldi, Cristina; Guidi, Elena; Roperto, Sante; Russo, Valeria; Roperto, Franco; Di Meo, Giulia Pia; Iannuzzi, Leopoldo; Floriot, Sandrine; Boussaha, Mekki; Eggen, André; Ferretti, Luca

    2006-05-23

    The Fragile Histidine Triad gene (FHIT) is an oncosuppressor implicated in many human cancers, including vesical tumors. FHIT is frequently hit by deletions caused by fragility at FRA3B, the most active of human common fragile sites, where FHIT lays. Vesical tumors affect also cattle, including animals grazing in the wild on bracken fern; compounds released by the fern are known to induce chromosome fragility and may trigger cancer with the interplay of latent Papilloma virus. The bovine FHIT was characterized by assembling a contig of 78 BACs. Sequence tags were designed on human exons and introns and used directly to select bovine BACs, or compared with sequence data in the bovine genome database or in the trace archive of the bovine genome sequencing project, and adapted before use. FHIT is split in ten exons like in man, with exons 5 to 9 coding for a 149 amino acids protein. VISTA global alignments between bovine genomic contigs retrieved from the bovine genome database and the human FHIT region were performed. Conservation was extremely high over a 2 Mb region spanning the whole FHIT locus, including the size of introns. Thus, the bovine FHIT covers about 1.6 Mb compared to 1.5 Mb in man. Expression was analyzed by RT-PCR and Northern blot, and was found to be ubiquitous. Four cDNA isoforms were isolated and sequenced, that originate from an alternative usage of three variants of exon 4, revealing a size very close to the major human FHIT cDNAs. A comparative genomic approach allowed to assemble a contig of 78 BACs and to completely annotate a 1.6 Mb region spanning the bovine FHIT gene. The findings confirmed the very high level of conservation between human and bovine genomes and the importance of comparative mapping to speed the annotation process of the recently sequenced bovine genome. The detailed knowledge of the genomic FHIT region will allow to study the role of FHIT in bovine cancerogenesis, especially of vesical papillomavirus-associated cancers of

  7. contemporary christian spirituality: an “encompassing field”

    African Journals Online (AJOL)

    The spirit of the disciplines: Understanding how God changes lives. San Fran cisco: Harper. 1993. In search of guidance: Developing a conversational relationship with God. San Francisco: Harper. 1998. The divine conspiracy: Rediscovering our hidden life in God. London: Harper. Collins. Keywords. Trefwoorde. Spirituality.

  8. A theoretical framework for an access programme encompassing ...

    African Journals Online (AJOL)

    The contemporary challenge facing education in South Africa is finding ways to assist the vast majority of school-leavers who do not qualify for direct entry into higher ... These programmes were institution-based and had very few uniform characteristics in terms of duration and curriculum; moreover, they failed to provide any ...

  9. Co-occurrence of Xp21 microduplication encompassing the DMD ...

    African Journals Online (AJOL)

    Defects in the DMD gene (deletion, duplication, or mutation) are associated with Duchenne and Becker muscular dystrophies (DMD and BMD). Combined microduplications of Xp21/DMD with 17p12/PMP22 are extremely rare with only one published report of a male patient with changes in both the DMD and PMP22 genes.

  10. Global functional atlas of Escherichia coli encompassing previously uncharacterized proteins.

    Directory of Open Access Journals (Sweden)

    Pingzhao Hu

    2009-04-01

    Full Text Available One-third of the 4,225 protein-coding genes of Escherichia coli K-12 remain functionally unannotated (orphans. Many map to distant clades such as Archaea, suggesting involvement in basic prokaryotic traits, whereas others appear restricted to E. coli, including pathogenic strains. To elucidate the orphans' biological roles, we performed an extensive proteomic survey using affinity-tagged E. coli strains and generated comprehensive genomic context inferences to derive a high-confidence compendium for virtually the entire proteome consisting of 5,993 putative physical interactions and 74,776 putative functional associations, most of which are novel. Clustering of the respective probabilistic networks revealed putative orphan membership in discrete multiprotein complexes and functional modules together with annotated gene products, whereas a machine-learning strategy based on network integration implicated the orphans in specific biological processes. We provide additional experimental evidence supporting orphan participation in protein synthesis, amino acid metabolism, biofilm formation, motility, and assembly of the bacterial cell envelope. This resource provides a "systems-wide" functional blueprint of a model microbe, with insights into the biological and evolutionary significance of previously uncharacterized proteins.

  11. Global functional atlas of Escherichia coli encompassing previously uncharacterized proteins.

    Science.gov (United States)

    Hu, Pingzhao; Janga, Sarath Chandra; Babu, Mohan; Díaz-Mejía, J Javier; Butland, Gareth; Yang, Wenhong; Pogoutse, Oxana; Guo, Xinghua; Phanse, Sadhna; Wong, Peter; Chandran, Shamanta; Christopoulos, Constantine; Nazarians-Armavil, Anaies; Nasseri, Negin Karimi; Musso, Gabriel; Ali, Mehrab; Nazemof, Nazila; Eroukova, Veronika; Golshani, Ashkan; Paccanaro, Alberto; Greenblatt, Jack F; Moreno-Hagelsieb, Gabriel; Emili, Andrew

    2009-04-28

    One-third of the 4,225 protein-coding genes of Escherichia coli K-12 remain functionally unannotated (orphans). Many map to distant clades such as Archaea, suggesting involvement in basic prokaryotic traits, whereas others appear restricted to E. coli, including pathogenic strains. To elucidate the orphans' biological roles, we performed an extensive proteomic survey using affinity-tagged E. coli strains and generated comprehensive genomic context inferences to derive a high-confidence compendium for virtually the entire proteome consisting of 5,993 putative physical interactions and 74,776 putative functional associations, most of which are novel. Clustering of the respective probabilistic networks revealed putative orphan membership in discrete multiprotein complexes and functional modules together with annotated gene products, whereas a machine-learning strategy based on network integration implicated the orphans in specific biological processes. We provide additional experimental evidence supporting orphan participation in protein synthesis, amino acid metabolism, biofilm formation, motility, and assembly of the bacterial cell envelope. This resource provides a "systems-wide" functional blueprint of a model microbe, with insights into the biological and evolutionary significance of previously uncharacterized proteins.

  12. Co-occurrence of Xp21 microduplication encompassing the DMD ...

    African Journals Online (AJOL)

    Alpa Sidhu

    2014-12-27

    Dec 27, 2014 ... fine motor tasks with her hands, pain in the upper extremities ... Xp21.1–Xp21.2 microduplication was confirmed by FISH ... Additional FISH or CMA testing on at risk family members was recommended to determine whether the microduplications were inherited or de novo, but was not performed due to lack ...

  13. Microdeletion del(22(q12.2 encompassing the facial development-associated gene, MN1 (meningioma 1 in a child with Pierre-Robin sequence (including cleft palate and neurofibromatosis 2 (NF2: a case report and review of the literature

    Directory of Open Access Journals (Sweden)

    Davidson Tom B

    2012-03-01

    Full Text Available Abstract Background Pierre-Robin sequence (PRS is defined by micro- and/or retrognathia, glossoptosis and cleft soft palate, either caused by deformational defect or part of a malformation syndrome. Neurofibromatosis type 2 (NF2 is an autosomal dominant syndrome caused by mutations in the NF2 gene on chromosome 22q12.2. NF2 is characterized by bilateral vestibular schwannomas, spinal cord schwannomas, meningiomas and ependymomas, and juvenile cataracts. To date, NF2 and PRS have not been described together in the same patient. Case presentation We report a female with PRS (micrognathia, cleft palate, microcephaly, ocular hypertelorism, mental retardation and bilateral hearing loss, who at age 15 was also diagnosed with severe NF2 (bilateral cerebellopontine schwannomas and multiple extramedullary/intradural spine tumors. This is the first published report of an individual with both diagnosed PRS and NF2. High resolution karyotype revealed 46, XX, del(22(q12.1q12.3, FISH confirmed a deletion encompassing NF2, and chromosomal microarray identified a 3,693 kb deletion encompassing multiple genes including NF2 and MN1 (meningioma 1. Five additional patients with craniofacial dysmorphism and deletion in chromosome 22-adjacent-to or containing NF2 were identified in PubMed and the DECIPHER clinical chromosomal database. Their shared chromosomal deletion encompassed MN1, PITPNB and TTC28. MN1, initially cloned from a patient with meningioma, is an oncogene in murine hematopoiesis and participates as a fusion gene (TEL/MN1 in human myeloid leukemias. Interestingly, Mn1-haploinsufficient mice have abnormal skull development and secondary cleft palate. Additionally, Mn1 regulates maturation and function of calvarial osteoblasts and is an upstream regulator of Tbx22, a gene associated with murine and human cleft palate. This suggests that deletion of MN1 in the six patients we describe may be causally linked to their cleft palates and/or craniofacial

  14. Insert size of YAC clones - RGP physicalmap | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available search(/contents-en/) != -1 || url.search(/index-e.html/) != -1 ) { document.getElementById(lang).innerHTML=.../) != -1 ) { url = url.replace(-e.html,.html); document.getElementById(lang).innerHTML=[ Japanese |...en/,/jp/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if ( url.search(//contents...//) != -1 ) { url = url.replace(/contents/,/contents-en/); document.getElementById(lang).innerHTML=[ Japanes...e(/contents-en/,/contents/); document.getElementById(lang).innerHTML=[ Japanese | English ]; } else if( url.

  15. Identification and characterization of a new multigene family in the human MHC: A candidate autoimmune disease susceptibility element (3.8-1)

    Energy Technology Data Exchange (ETDEWEB)

    Harris, J.M.; Venditti, C.P.; Chorney, M.J. [Pennsylvania State Univ. College of Medicine, Hershey, PA (United States)

    1994-09-01

    An association between idiopathic hemochromatosis (HFE) and the HLA-A3 locus has been previously well-established. In an attempt to identify potential HFE candidate genes, a genomic DNA fragment distal to the HLA-A9 breakpoint was used to screen a B cell cDNA library; a member (3.8-1) of a new multigene family, composed of five distinct genomic cross-reactive fragments, was identified. Clone 3.8-1 represents the 3{prime} end of 9.6 kb transcript which is expressed in multiple tissues including the spleen, thymus, lung and kidney. Sequencing and genome database analysis indicate that 3.8-1 is unique, with no homology to any known entries. The genomic residence of 3-8.1, defined by polymorphism analysis and physical mapping using YAC clones, appears to be absent from the genomes of higher primates, although four other cross-reactivities are maintained. The absence of this gene as well as other probes which map in the TNF to HLA-B interval, suggest that this portion of the human HMC, located between the Class I and Class III regions, arose in humans as the result of a post-speciation insertional event. The large size of the 3.8-1 gene and the possible categorization of 3.8-1 as a human-specific gene are significant given the genetic data that place an autoimmune susceptibility element for IDDM and myasthenia gravis in the precise region where this gene resides. In an attempt to isolate the 5{prime} end of this large transcript, we have constructed a cosmid contig which encompasses the genomic locus of this gene and are progressively isolating coding sequences by exon trapping.

  16. Genomic Anatomy of a Premier Major Histocompatibility Complex Paralogous Region on Chromosome 1q21–q22

    Science.gov (United States)

    Shiina, Takashi; Ando, Asako; Suto, Yumiko; Kasai, Fumio; Shigenari, Atsuko; Takishima, Nobusada; Kikkawa, Eri; Iwata, Kyoko; Kuwano, Yuko; Kitamura, Yuka; Matsuzawa, Yumiko; Sano, Kazumi; Nogami, Masahiro; Kawata, Hisako; Li, Suyun; Fukuzumi, Yasuhito; Yamazaki, Masaaki; Tashiro, Hiroyuki; Tamiya, Gen; Kohda, Atsushi; Okumura, Katsuzumi; Ikemura, Toshimichi; Soeda, Eiichi; Mizuki, Nobuhisa; Kimura, Minoru; Bahram, Seiamak; Inoko, Hidetoshi

    2001-01-01

    Human chromosomes 1q21–q25, 6p21.3–22.2, 9q33–q34, and 19p13.1–p13.4 carry clusters of paralogous loci, to date best defined by the flagship 6p MHC region. They have presumably been created by two rounds of large-scale genomic duplications around the time of vertebrate emergence. Phylogenetically, the 1q21–25 region seems most closely related to the 6p21.3 MHC region, as it is only the MHC paralogous region that includes bona fide MHC class I genes, the CD1 and MR1 loci. Here, to clarify the genomic structure of this model MHC paralogous region as well as to gain insight into the evolutionary dynamics of the entire quadriplication process, a detailed analysis of a critical 1.7 megabase (Mb) region was performed. To this end, a composite, deep, YAC, BAC, and PAC contig encompassing all five CD1 genes and linking the centromeric +P5 locus to the telomeric KRTC7 locus was constructed. Within this contig a 1.1-Mb BAC and PAC core segment joining CD1D to FCER1A was fully sequenced and thoroughly analyzed. This led to the mapping of a total of 41 genes (12 expressed genes, 12 possibly expressed genes, and 17 pseudogenes), among which 31 were novel. The latter include 20 olfactory receptor (OR) genes, 9 of which are potentially expressed. Importantly, CD1, SPTA1, OR, and FCERIA belong to multigene families, which have paralogues in the other three regions. Furthermore, it is noteworthy that 12 of the 13 expressed genes in the 1q21–q22 region around the CD1 loci are immunologically relevant. In addition to CD1A-E, these include SPTA1, MNDA, IFI-16, AIM2, BL1A, FY and FCERIA. This functional convergence of structurally unrelated genes is reminiscent of the 6p MHC region, and perhaps represents the emergence of yet another antigen presentation gene cluster, in this case dedicated to lipid/glycolipid antigens rather than antigen-derived peptides. [The nucleotide sequence data reported in this paper have been submitted to the DDBJ, EMBL, and GenBank databases under

  17. Binning metagenomic contigs by coverage and composition

    NARCIS (Netherlands)

    Alneberg, J.; Bjarnason, B.S.; Bruijn, de I.; Schirmer, M.; Quick, J.; Ijaz, U.Z.; Lahti, L.M.; Loman, N.J.; Andersson, A.F.; Quince, C.

    2014-01-01

    Shotgun sequencing enables the reconstruction of genomes from complex microbial communities, but because assembly does not reconstruct entire genomes, it is necessary to bin genome fragments. Here we present CONCOCT, a new algorithm that combines sequence composition and coverage across multiple

  18. SPECIFIC ACCOUNTING POLICIES ON PUBLIC INSTITUTIONS RELATED TO PROVISIONS, CONTIGENT LIABILITIES AND CONTIGENT ASSETS

    Directory of Open Access Journals (Sweden)

    Ţenovici Cristina Otilia

    2013-04-01

    Full Text Available Nowadays, the activity performed by professional accountants should be transparent and the communication process should be an efficient one so that the data transmitted is relevant and reliable. Such characteristics can become achievable only within a quality accounting referential, based on international accounting standards likely to integrate the public field particularities. The need to obtain comparable and transparent information in the public sector has determined the emergence of IPSAS standards, high quality standards with benefice consequences upon the world economy. The purpose of the disclose study is to analyse the development of accountancy in Romania and the level of accounting harmonization and convergence with IPSAS 19 “Provisions, contingent liabilities and contingent assets”. We are also focusing on performing a comparison between the main characteristics of the disclose national and international regulations, with the mention of resemblances and differences on provisions, contingent liabilities and contingent assets in order to identify the range of convergent and divergent issues.

  19. Cloning of the anhidrotic ectodermal dysplasia gene: Identification of cDNAs associated with CpG islands mapped near translocation breakpoint in two female patients

    Energy Technology Data Exchange (ETDEWEB)

    Srivastava, A.K.; Schlessinger, D. [Washington Univ. School of Medicine, St. Louis, MO (United States); Kere, J. [Univ. of Helsinki (Finland)] [and others

    1994-09-01

    The gene for the X chromosomal developmental disorder anhidrotic ectodermal dysplasia (EDA) has been mapped to Xq12-q13 by linkage analysis and is expressed in a few females with chromosomal translocations involving band Xq12-q13. A yeast artificial chromosome (YAC) contig (2.0 Mb) spanning two translocation breakpoints has been assembled by sequence-tagged site (STS)-based chromosomal walking. The two translocation breakpoints (X:autosome translocations from the affected female patients) have been mapped less than 60 kb apart within a YAC contig. Unique probes and intragenic STSs (mapped between the two translocations) have been developed and a somatic cell hybrid carrying the translocated X chromosome from the AK patient has been analyzed by isolating unique probes that span the breakpoint. Several STSs made from intragenic sequences have been found to be conserved in mouse, hamster and monkey, but we have detected no mRNAs in a number of tissues tested. However, a probe and STS developed from the DNA spanning the AK breakpoint is conserved in mouse, hamster and monkey, and we have detected expressed sequences in skin cells and cDNA libraries. In addition, unique sequences have been obtained from two CpG islands in the region that maps proximal to the breakpoints. cDNAs containing these sequences are being studied as candidates for the gene affected in the etiology of EDA.

  20. Physical mapping of a commonly deleted region, the site of a candidate tumor suppressor gene, at 12q22 in human male germ cell tumors

    Energy Technology Data Exchange (ETDEWEB)

    Murty, V.V.V.S.; Bosl, G.J.; Chaganti, R.S.K. [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)] [and others

    1996-08-01

    A candidate tumor suppressor gene (TSG) site at 12q22 characterized by a high frequency of loss of heterozygosity (LOH) and a homozygous deletion has previously (LOH) and a homozygous deletion has previously been reported in human male germ cell tumors (GCTs). In a detailed deletion mapping analysis of 67 normal-tumor DNAs utilizing 20 polymorphic markers mapped to 12q22-q24, we identified the limits of the minimal region of deletion at 12q22 between D12S377 (priximal) and D12S296 (distal). We have constructed a YAC contig map of a 3-cM region of this band between the proximal marker D12S101 and the distal marker D12S346, which contained the minimal region of deletion in GCTs. The map is composed of 53 overlapping YACs and 3 cosmids onto which 25 polymorphic and nonpolymorphic sequence-tagged sites (STSs) were placed in a unique order. The size of the minimal region of deletion was approximately 2 Mb from overlapping, nonchimeric YACs that spanned the region. We also developed a radiation hybrid (RH) map of the region between D12S101 and D12S346 containing 17 loci. The consensus order developed by RH mapping is in good agreement with the YAC STS-content map order. The RH map estimated the distance between D12S101 and D12S346 to be 246 cR{sub 8000} and the minimal region of deletion to be 141 cR{sub 8000}. In addition, four genes that were previously mapped to 12q22 have been excluded as candidate genes. The leads gained from the deletion mapping and physical maps should expedite the isolation and characterization of the TSG at 12q22. 35 refs., 4 figs., 2 tabs.

  1. An international cooperation by using an all-encompassing passive radon monitor

    International Nuclear Information System (INIS)

    Tommasino, L.; Chen, J.; Falcomer, R.; Janik, M.; Kanda, R.; DeFelice, F.; Cardellini, F.; Trevisi, R.; Leonardi, F.; Magnoni, M.; Chiaberto, E.; Agnesod, G.; Ragani, M. Faure; Espinosa, G.; Golzarri, J.; Kozak, K.; Mazur, J.

    2017-01-01

    The recently developed radon film-badge makes it possible to measure radon indoors, in soil, in water and/or in aqueous media (e.g. mud). As a result of its wide response linearity, this monitor has been successfully used to measure radon in-water with concentrations from 10 to ∼10 000 Bq/L. By exploiting the unique characteristics of this badge, a mini-survey has been carried out by Health Canada in which radon in water was measured from 12 private wells, as well as in tap water originating from the Ottawa River. Due to the widespread interest of different laboratories in using these passive monitors, laboratories were provided with plastic films to construct their own badges by using in-house CR-39 detectors. Monitors were then irradiated by a known radon concentration at the National Institute of Radiation Metrology (ENEA) s radon chamber and sent back to each laboratory for processing and counting. Even though these laboratories have been using different etching- and counting procedures, the film-badge responses varied only within ∼12%. (authors)

  2. New generation quantitative x-ray microscopy encompassing phase-contrast

    International Nuclear Information System (INIS)

    Wilkins, S.W.; Mayo, S.C.; Gureyev, T.E.; Miller, P.R.; Pogany, A.; Stevenson, A.W.; Gao, D.; Davis, T.J.; Parry, D.J.; Paganin, D.

    2000-01-01

    Full text: We briefly outline a new approach to X-ray ultramicroscopy using projection imaging in a scanning electron microscope (SEM). Compared to earlier approaches, the new approach offers spatial resolution of ≤0.1 micron and includes novel features such as: i) phase contrast to give additional sample information over a wide energy range, rapid phase/amplitude extraction algorithms to enable new real-time modes of microscopic imaging widespread applications are envisaged to fields such as materials science, biomedical research, and microelectronics device inspection. Some illustrative examples are presented. The quantitative methods described here are also very relevant to X-ray projection microscopy using synchrotron sources

  3. Material and surface - Course synergy as a channel towards a more encompassing view of learning

    Directory of Open Access Journals (Sweden)

    Ana Nuutinen

    2016-02-01

    Full Text Available The course Material and Surface is a combination of four minor courses: Experiential Textile Design, Dyeing, Textile Printing and Embroidery. The course combination is offered to first-year textile teacher students. Through combining courses, the aim has been to support integrated learning and transform fragmented education into a thematically coherent whole. The four courses form an intertwined and progressive structure in which each course is based on the knowledge learned from the previous course. The creative basis of the Experiential Textile Design course applies David Kolb’s theory (1984. The creative ideas are then applied to assignments in Dyeing, Textile Printing and Embroidery. Following the courses, students collect assignments in a learning portfolio. They organize their assignments in a progressive order to self-assess personal development, the creative process and changes in learning and thinking. The aims of this research were to find out 1 how the course combination reinforced students’ understanding of their own learning, 2 in which ways students’ own experiences strengthened their personal development and 3 what effect the collaboration had on teachers and their working. Data collected during the years 2008–2013 consisted of students’ portfolios (N=152, teachers' self-reflections as notes and diary remarks and notes from the final critiques. Data were analyzed using qualitative content analysis. The results indicate that the learning portfolio serves as feedback for the teachers. During the courses, the students worked in groups and shared experiences which strengthened collective values and meanings. Mutual sharing built the group’s cohesion, which was observable in students’ vivid and increasing discussions: they shared more of their ideas, they encouraged and inspired each other.  Diversity appeared to be the most important feature that arose from the data – all experiences were evaluated equally true and valuable.  

  4. How encompassing is the effect of negativity bias on political conservatism?

    Science.gov (United States)

    Malka, Ariel; Soto, Christopher J

    2014-06-01

    We argue that the political effects of negativity bias are narrower than Hibbing et al. suggest. Negativity bias reliably predicts social, but not economic, conservatism, and its political effects often vary across levels of political engagement. Thus the role of negativity bias in broad ideological conflict depends on the strategic packaging of economic and social attitudes by political elites.

  5. Contemporary art encompasses all the rest / Maria Lind ; intervjueerinud Eero Epner

    Index Scriptorium Estoniae

    Lind, Maria, 1966-

    2011-01-01

    Rootsi kuraator ja kunstikriitik Maria Lind retrospektiivnäituse formaadist, kaasaegsest kunstimaailmast, riigi kunstiinstitutsioonidest ja eragaleriidest, oma raamatust "Maria Lind. Selected Writings" (2010), kunstikriitikast ja -kirjutistest, kureerimise tähtsuse tõusust, nüüdiskunstist

  6. Microdiversity of an Abundant Terrestrial Bacterium Encompasses Extensive Variation in Ecologically Relevant Traits

    Directory of Open Access Journals (Sweden)

    Alexander B. Chase

    2017-11-01

    Full Text Available Much genetic diversity within a bacterial community is likely obscured by microdiversity within operational taxonomic units (OTUs defined by 16S rRNA gene sequences. However, it is unclear how variation within this microdiversity influences ecologically relevant traits. Here, we employ a multifaceted approach to investigate microdiversity within the dominant leaf litter bacterium, Curtobacterium, which comprises 7.8% of the bacterial community at a grassland site undergoing global change manipulations. We use cultured bacterial isolates to interpret metagenomic data, collected in situ over 2 years, together with lab-based physiological assays to determine the extent of trait variation within this abundant OTU. The response of Curtobacterium to seasonal variability and the global change manipulations, specifically an increase in relative abundance under decreased water availability, appeared to be conserved across six Curtobacterium lineages identified at this site. Genomic and physiological analyses in the lab revealed that degradation of abundant polymeric carbohydrates within leaf litter, cellulose and xylan, is nearly universal across the genus, which may contribute to its high abundance in grassland leaf litter. However, the degree of carbohydrate utilization and temperature preference for this degradation varied greatly among clades. Overall, we find that traits within Curtobacterium are conserved at different phylogenetic depths. We speculate that similar to bacteria in marine systems, diverse microbes within this taxon may be structured in distinct ecotypes that are key to understanding Curtobacterium abundance and distribution in the environment.

  7. Geochronologic evidence of a large magmatic province in northern Patagonia encompassing the Permian-Triassic boundary

    Science.gov (United States)

    Luppo, Tomás; López de Luchi, Mónica G.; Rapalini, Augusto E.; Martínez Dopico, Carmen I.; Fanning, Christopher M.

    2018-03-01

    The Los Menucos Complex (northern Patagonia) consists of ∼6 km thick succession of acidic and intermediate volcanic and pyroclastic products, which has been traditionally assigned to the Middle/Late Triassic. New U/Pb (SHRIMP) zircon crystallization ages of 257 ± 2 Ma at the base, 252 ± 2 Ma at an intermediate level and 248 ± 2 Ma near the top of the sequence, indicate that this volcanic event took place in about 10 Ma around the Permian-Triassic boundary. This volcanism can now be considered as the effusive terms of the neighboring and coeval La Esperanza Plutono-Volcanic Complex. This indicates that the climax of activity of a large magmatic province in northern Patagonia was coetaneous with the end-Permian mass extinctions. Likely correlation of La Esperanza- Los Menucos magmatic province with similar volcanic and plutonic rocks across other areas of northern Patagonia suggest a much larger extension than previously envisaged for this event. Its age, large volume and explosive nature suggest that the previously ignored potential role that this volcanism might have played in climatic deterioration around the Permian-Triassic boundary should be investigated.

  8. Raised cardiac enzymes in sepsis with renal failure: An encompassing umbrella or a masquerader?

    Directory of Open Access Journals (Sweden)

    Dilip Gude

    2014-01-01

    Full Text Available Elevation of cardiac enzymes and troponins particularly in settings of sepsis and renal failure may cloud the diagnostic picture of acute coronary syndrome in many cases. Interpretation of such elevated enzymes thus warrants caution. It necessitates adequate awareness amongst clinicians, of conditions with such elevation in the absence of myocardial ischemia/infarction as well as those that harbinger false positives. We discuss one such case that posed a diagnostic dilemma and review the pertinent literature.

  9. Complex regulatory network encompassing the Csr, c-di-GMP and motility systems of Salmonella Typhimurium.

    Science.gov (United States)

    Jonas, Kristina; Edwards, Adrianne N; Ahmad, Irfan; Romeo, Tony; Römling, Ute; Melefors, Ojar

    2010-02-01

    Bacterial survival depends on the ability to switch between sessile and motile lifestyles in response to changing environmental conditions. In many species, this switch is governed by (3'-5')-cyclic-diguanosine monophosphate (c-di-GMP), a signalling molecule, which is metabolized by proteins containing GGDEF and/or EAL domains. Salmonella Typhimurium contains 20 such proteins. Here, we show that the RNA-binding protein CsrA regulates the expression of eight genes encoding GGDEF, GGDEF-EAL and EAL domain proteins. CsrA bound directly to the mRNA leaders of five of these genes, suggesting that it may regulate these genes post-transcriptionally. The c-di-GMP-specific phosphodiesterase STM3611, which reciprocally controls flagella function and production of biofilm matrix components, was regulated by CsrA binding to the mRNA, but was also indirectly regulated by CsrA through the FlhDC/FliA flagella cascade and STM1344. STM1344 is an unconventional (c-di-GMP-inactive) EAL domain protein, recently identified as a negative regulator of flagella gene expression. Here, we demonstrate that CsrA directly downregulates expression of STM1344, which in turn regulates STM3611 through fliA and thus reciprocally controls motility and biofilm factors. Altogether, our data reveal that the concerted and complex regulation of several genes encoding GGDEF/EAL domain proteins allows CsrA to control the motility-sessility switch in S. Typhimurium at multiple levels.

  10. Spatial and Global Sensory Suppression Mapping Encompassing the Central 10° Field in Anisometropic Amblyopia.

    Science.gov (United States)

    Li, Jingjing; Li, Jinrong; Chen, Zidong; Liu, Jing; Yuan, Junpeng; Cai, Xiaoxiao; Deng, Daming; Yu, Minbin

    2017-01-01

    We investigate the efficacy of a novel dichoptic mapping paradigm in evaluating visual function of anisometropic amblyopes. Using standard clinical measures of visual function (visual acuity, stereo acuity, Bagolini lenses, and neutral density filters) and a novel quantitative mapping technique, 26 patients with anisometropic amblyopia (mean age = 19.15 ± 4.42 years) were assessed. Two additional psychophysical interocular suppression measurements were tested with dichoptic global motion coherence and binocular phase combination tasks. Luminance reduction was achieved by placing neutral density filters in front of the normal eye. Our study revealed that suppression changes across the central 10° visual field by mean luminance modulation in amblyopes as well as normal controls. Using simulation and an elimination of interocular suppression, we identified a novel method to effectively reflect the distribution of suppression in anisometropic amblyopia. Additionally, the new quantitative mapping technique was in good agreement with conventional clinical measures, such as interocular acuity difference (P suppression with dichoptic mapping paradigm and the results of the other two psychophysical methods (suppression mapping versus binocular phase combination, P suppression mapping versus global motion coherence, P = 0.005). The dichoptic suppression mapping technique is an effective method to represent impaired visual function in patients with anisometropic amblyopia. It offers a potential in "micro-"antisuppression mapping tests and therapies for amblyopia.

  11. From Rivers to Oceans and Back: Linking Models to Encompass the Full Salmon Life Cycle

    Science.gov (United States)

    Danner, E.; Hendrix, N.; Martin, B.; Lindley, S. T.

    2016-02-01

    Pacific salmon are a promising study subject for investigating the linkages between freshwater and coastal ocean ecosystems. Salmon use a wide range of habitats throughout their life cycle as they move with water from mountain streams, mainstem rivers, estuaries, bays, and coastal oceans, with adult fish swimming back through the same migration route they took as juveniles. Conditions in one habitat can have growth and survival consequences that manifest in the following habitat, so is key that full life cycle models are used to further our understanding salmon population dynamics. Given the wide range of habitats and potential stressors, this approach requires the coordination of a multidisciplinary suite of physical and biological models, including climate, hydrologic, hydraulic, food web, circulation, bioenergetic, and ecosystem models. Here we present current approaches to linking physical and biological models that capture the foundational drivers for salmon in complex and dynamic systems.

  12. Complementation analyses for 45 mutations encompassing the pink-eyed dilution (p) locus of the mouse

    Energy Technology Data Exchange (ETDEWEB)

    Russell, L.B.; Montgomery, C.S.; Cacheiro, N.L.A.; Johnson, D.K. [Oak Ridge National Lab., TN (United States)

    1995-12-01

    The homozygous and heterozygous phenotypes are described and characterized for 45 new pink-eyed dilution (p) locus mutations, most of them radiation-induced, that affect survival at various stages of mouse development. Cytogenetically detectable aberrations were found in three of the new p mutations (large deletion, inversion, translocation), with band 7C involved in each case. The complementation map developed from the study of 810 types of compound heterozygotes identifies five functional units: jls and jlm (two distinct juvenile-fitness functions, the latter associated with neuromuscular defects), pl-1 and pl-2 (associated with early-postimplantation and preimplantation death, respectively), and nl [neonatal lethality associated with cleft palate (the frequency of rare {open_quotes}escapers{close_quotes} from this defect varied with the genotype)]. Orientation of these units relative to genetic markers is as follows: centromere, Gas-2, pl-1, jls, jlm p, nl (equatable to cp1= Gabrb3); pl-2 probably resides in the c-deletion complex. pl-1 does not mask preimplantation lethals between Gas2 and p; and no genes affecting survival are located between p and cp1. The alleles specifying mottling or darker pigment (generically, p{sup m} and p{sup x}, respectively) probably do not represent deletions of p-coding sequences but could be small rearrangements involving proximal regulatory elements. 43 refs., 5 figs., 7 tabs.

  13. AN INTERNATIONAL COOPERATION BY USING AN ALL-ENCOMPASSING PASSIVE RADON MONITOR.

    Science.gov (United States)

    Tommasino, L; Chen, J; Falcomer, R; Janik, M; Kanda, R; DeFelice, F; Cardellini, F; Trevisi, R; Leonardi, F; Magnoni, M; Chiaberto, E; Agnesod, G; Ragani, M Faure; Espinosa, G; Golzarri, J; Kozak, K; Mazur, J

    2017-11-01

    The recently developed radon film-badge makes it possible to measure radon indoors, in soil, in water and/or in aqueous media (e.g. mud). As a result of its wide response linearity, this monitor has been successfully used to measure radon in-water with concentrations from 10 to ~10 000 Bq/L. By exploiting the unique characteristics of this badge, a mini-survey has been carried out by Health Canada in which radon in water was measured from 12 private wells, as well as in tap water originating from the Ottawa River. Due to the widespread interest of different laboratories in using these passive monitors, laboratories were provided with plastic films to construct their own badges by using in-house CR-39 detectors. Monitors were then irradiated by a known radon concentration at the National Institute of Radiation Metrology (ENEA)'s radon chamber and sent back to each laboratory for processing and counting. Even though these laboratories have been using different etching- and counting-procedures, the film-badge responses varied only within ~12%. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. E-Commerce Infusion into Business Education--Encompassing the Realities of an Emerging Business Model.

    Science.gov (United States)

    Morrison, James L.; Oladunjoye, Ganiyu Titi

    2002-01-01

    A survey of 287 business faculty found that few were infusing electronic commerce topics into existing curricula despite its growing use in business. Responses were similar regardless of faculty gender, region, and program size or level. (SK)

  15. Action, an "Encompassing Ethic" and Academics in the Midst of the Climate Crisis

    Science.gov (United States)

    Plowright, Susan

    2016-01-01

    In the midst of a crisis like the climate crisis and calls for "all hands on deck", what do academics, as a microcosm of humanity, see? In Hannah Arendt's terms, an "abyss of freedom" to act or a paralysing "abyss of nothingness"? Some from the academy themselves, including Tamboukou, Apple and Bourdieu, make…

  16. Considerable haplotype diversity within the 23kb encompassing the ADH7 gene

    DEFF Research Database (Denmark)

    Han, Yi; Oota, Hiroki; Osier, Michael V

    2005-01-01

    Of the seven known human alcohol dehydrogenase (ADH) genes, the non-liver expressed ADH7 gene codes for the enzyme with the highest maximal activity for ethanol. Previous study from our laboratory has suggested that ADH7 has an epistatic role for protection against alcoholism based on a single AD...

  17. Germ line transmission of a yeast artificial chromosome spanning the murine [alpha][sub 1](I) collagen locus

    Energy Technology Data Exchange (ETDEWEB)

    Strauss, W.M.; Dausman, J.; Beard, C.; Jaenisch, R. (Massachusetts Inst. of Technology, Cambridge (United States)); Johnson, C.; Lawrence, J.B. (Univ. of Massachusetts Medical School, Worcester (United States))

    1993-03-26

    Molecular complementation of mutant phenotypes by transgenic technology is a potentially important tool for gene identification. A technology was developed to allow the transfer of a physically intact yeast artificial chromosome (YAC) into the germ line of the mouse. A purified 150-kilobase YAC encompassing the murine gene Col1a1 was efficiently introduced into embryonic stem (ES) cells via lipofection. Chimeric founder mice were derived from two transfected ES cell clones. These chimeras transmitted the full length transgene through the germ line, generating two transgenic mouse strains. Transgene expression was visualized as nascent transcripts in interphase nuclei and quantitated by ribonuclease protection analysis. Both assays indicated that the transgene was expressed at levels comparable to the endogenous collagen gene. 32 refs., 3 figs., 1 tab.

  18. Supplier Relationship Management dalam Pendekatan Contigency dan Best Practice

    OpenAIRE

    Supriharyanti, Elisabeth

    2005-01-01

    The supplier relationship is one important type of cooperation between and among firms. Supplier relationship management (SRM) is a part of the overall supply chain management process. Over the past several years, there has been significant shift in the way organization approach supplier relationship management. Recent year have seen an increased interest and involvement in partnership model. Several authors said that partnersip will deliver superior performance. The “best practice” model of ...

  19. Variações espaço-temporais na alimentação de Pimelodus ortmanni (Siluriformes, Pimelodidae no reservatório de Segredo e áreas adjacentes (PR Spatio temporal variations in Pimelodus ortmanni (Siluriformes, Pimelodidae feeding in Segredo reservoir and contigous areas (PR

    Directory of Open Access Journals (Sweden)

    Márcia Regina Russo

    1999-07-01

    Full Text Available Este trabalho teve como objetivo conhecer a dieta de Pimelodus ortmanni (Haseman, 1911 no reservatório de Segredo e nas áreas adjacentes, em três períodos consecutivos à formação desse reservatório (rio Iguaçu-PR. As coletas foram realizadas no período de março de 93 a fevereiro de 96 no reservatório, nos tributários e jusante. Foram analisados 808 estômagos pelos métodos de freqüência de ocorrência e volumétrico, combinados no índice alimentar. A espécie foi caracterizada como omnívora-carnívora, em função do amplo espectro alimentar (41 itens, embora peixes e insetos tenham se destacado, na dieta, durante o período de estudos. Recursos alimentares de origem alóctone foram mais expressivos no reservatório e na jusante no primeiro período, diminuindo no último, ao contrário dos tributários. Através da análise de correspondência destendenciada (DCA, foram discriminados dois grupos espaço-temporais em relação à dieta: - nos menores escores, agruparam-se exemplares provenientes da jusante (2º período e do reservatório (2º e 3º período e, nos maiores escores, exemplares da jusante (1º período e dos tributários (2º e 3º períodos. Essa segregação pode estar associada à disponibilidade dos recursos alimentares nas diferentes estações e períodos de coleta.The aim of this paper is to investigate the diet of Pimelodus ortmanni in Segredo reservoir and contigous areas in three different periods after the reservoir formation (Iguaçu river, state of Paraná, Brazil. The samples were collected from March/93 to February/96 in the reservoir, tributaries and downstream. A total of 808 stomachs were analyzed by occurrence and volumetric methods combined in the food index. The species was characterized as omnivorous-carnivorous due to the ample food spectrum (41 items, though fishes and insects prevailed in the diet over the whole investigated time. In the first and second periods allocthonous food

  20. A high-resolution whole genome radiation hybrid map of human chromosome 17q22-q25.3 across the genes for GH and TK

    Energy Technology Data Exchange (ETDEWEB)

    Foster, J.W.; Schafer, A.J.; Critcher, R. [Univ. of Cambridge (United Kingdom)] [and others

    1996-04-15

    We have constructed a whole genome radiation hybrid (WG-RH) map across a region of human chromosome 17q, from growth hormone (GH) to thymidine kinase (TK). A panel of 128 WG-RH hybrid cell lines generated by X-irradiation and fusion has been tested for the retention of 39 sequence-tagged site (STS) markers by the polymerase chain reaction. This genome mapping technique has allowed the integration of existing VNTR and microsatellite markers with additional new markers and existing STS markers previously mapped to this region by other means. The WG-RH map includes eight expressed sequence tag (EST) and three anonymous markers developed for this study, together with 23 anonymous microsatellites and five existing ESTs. Analysis of these data resulted in a high-density comprehensive map across this region of the genome. A subset of these markers has been used to produce a framework map consisting of 20 loci ordered with odds greater than 1000:1. The markers are of sufficient density to build a YAC contig across this region based on marker content. We have developed sequence tags for both ends of a 2.1-Mb YAC and mapped these using the WG-RH panel, allowing a direct comparison of cRay{sub 6000} to physical distance. 31 refs., 3 figs., 2 tabs.

  1. Radiation hybrid mapping of human chromosome 18

    International Nuclear Information System (INIS)

    Francke, U.; Moon, A.J.; Chang, E.; Foellmer, B.; Strauss, B.; Haschke, A.; Chihlin Hsieh; Geigl, E.M.; Welch, S.

    1990-01-01

    The authors have generated a Chinese hamster V79/380-6 HPRT minus x human leukocyte hybrid cell line (18/V79) with chromosome 18 as the only human chromosome that is retained at high frequency without specific selection. Hybrid cells were selected in HAT medium, and 164 individual colonies were isolated. Of 110 colonies screened for human DNA by PCR amplification using a primer specific for human Alu repeats 67 (61%) were positive. These were expanded in culture for large-scale DNA preparations. Retesting expanded clones by PCR with Alu and LINE primers has revealed unique patterns of amplification products. In situ hybridization of biotin labelled total human DNA to metaphase spreads from various hybrids revealed the presence of one or more human DNA fragments integrated in hamster chromosomes. The authors have generated a resource that should allow the construction of a radiation map, to be compared with the YAC contig map also under construction in their laboratory

  2. Systematic characterisation of disease associated balanced chromosome rearrangements by FISH: cytogenetically and genetically anchored YACs identify microdeletions and candidate regions for mental retardation genes

    DEFF Research Database (Denmark)

    Wirth, J; Nothwang, H G; van der Maarel, S

    1999-01-01

    the Mendelian Cytogenetics Network (MCN), a collaborative effort of, at present, 270 cytogenetic laboratories throughout the world. In this pilot study, we have characterised 10 different MR associated chromosome regions delineating candidate regions for MR. Five of these regions are narrowed to breakpoint...

  3. Moving towards an enhanced community palliative support service (EnComPaSS): protocol for a mixed method study.

    Science.gov (United States)

    Arris, Steven M; Fitzsimmons, Deborah A; Mawson, Susan

    2015-04-30

    The challenge of an ageing population and consequential increase of long term conditions means that the number of people requiring palliative care services is set to increase. One UK hospice is introducing new information and communication technologies to support the redesign of their community services; improve experiences of existing patients; and allow efficient and effective provision of their service to more people. Community Palliative Care Nurses employed by the hospice will be equipped with a mobile platform to improve communication, enable accurate and efficient collection of clinical data at the bedside, and provide access to clinical records at the point of care through an online digital nursing dashboard. It is believed that this will ensure safer clinical interventions, enable delegated specialist care deployment, support the clinical audit of patient care and improve patient safety and patient/carer experience. Despite current attempts to evaluate the implementation of such technology into end of life care pathways, there is still limited evidence supporting the notion that this can be sustained within services and implemented to scale. This study presents an opportunity to carry out a longitudinal evaluation of the implementation of innovative technology to provide evidence for designing more efficient and effective community palliative care services. A mixed methods approach will be used to understand a wide range of organisational, economic, and patient-level factors. The first stage of the project will involve the development of an organisational model incorporating proposed changes resulting from the introduction of new novel mobile technologies. This model will guide stage two, which will consist of gathering and analysing primary evidence. Data will be collected using interviews, focus groups, observation, routinely collected data and documents. The implementation of this new approach to community-based palliative care delivery will require significant changes to established working patterns. This new service delivery model is being developed by the Hospice in collaboration with a team of international academic, industry, and clinical commissioning service improvement specialists. The findings from this initial evaluation will provide valuable baseline evidence regarding the delivery of palliative and end-of-life care services.

  4. A Patient With a Mild Holoprosencephaly Spectrum Phenotype and Heterotaxy and a 1.3 Mb Deletion Encompassing GLI2

    NARCIS (Netherlands)

    Kevelam, S.H.G.; van Harssel, J.J.; van der Zwaag, B.; Smeets, H.J.; Paulussen, A.D.; Lichtenbelt, K.D.

    2012-01-01

    Loss-of-function mutations of GLI2 are associated with features at the mild end of the holoprosencephaly spectrum, including abnormal pituitary gland formation and/or function, and craniofacial abnormalities. In addition patients may have branchial arch anomalies and polydactyly. Large,

  5. Encompassing the Work-Life Balance into Early Career Decision-Making of Future Employees Through the Analytic Hierarchy Process

    OpenAIRE

    Gawlik, Remigiusz

    2016-01-01

    The paper presents the results of ranking of the significance of quality of life determinants by University students that are starting professional activities. Research methodology: literature review; elaboration of an AHP decision-making model; two-stage expert selection; significance rankings by experts and a graphical and descriptive presentation of obtained results. Research sample: 14 experts out of almost 200 University students. Research outcome: a decision-making model that aims at ma...

  6. Synthesis of Symmetrical and Asymmetrical Azines Encompassing Naphtho[2,1-b]furan by a Novel Approach

    OpenAIRE

    Veena, K.; Ramaiah, M.; Vanita, G. K.; Avinash, T. S.; Vaidya, V. P.

    2011-01-01

    The starting material 3-nitro-2-acetylnaphtho[2,1-b]furan (2) was obtained by nitration of 2-acetylnaphtho[2,1-b] furan (1), under mild condition. The compound 1 was synthesized by the reaction of 2-hydroxy-1-naphthaldehyde with chloroacetone, where in both condensation and cyclization took place in single step. The reaction of 3-nitro-2-acetylnaphtho[2,1-b]furan (2) with hydrazine hydrate produced corresponding hydrazone (3) in excellent yield, which on treatment with various aromatic aldehy...

  7. Synthesis of Symmetrical and Asymmetrical Azines Encompassing Naphtho[2,1-b]furan by a Novel Approach

    Directory of Open Access Journals (Sweden)

    K. Veena

    2011-01-01

    Full Text Available The starting material 3-nitro-2-acetylnaphtho[2,1-b]furan (2 was obtained by nitration of 2-acetylnaphtho[2,1-b] furan (1, under mild condition. The compound 1 was synthesized by the reaction of 2-hydroxy-1-naphthaldehyde with chloroacetone, where in both condensation and cyclization took place in single step. The reaction of 3-nitro-2-acetylnaphtho[2,1-b]furan (2 with hydrazine hydrate produced corresponding hydrazone (3 in excellent yield, which on treatment with various aromatic aldehydes under different reaction conditions resulted in the formation of symmetrical azines (4a-e and unsymmetrical azines (5a-e. All the newly synthesized compounds have been characterized by analytical and spectral studies and were screened for antibacterial antibacterial activity against Bacillus subtilus and Alcaligenes fecalies and antifungal activity against Aspergillus nidulans, Aspergillus parasiticus and Aspergillus terrus. The Second Harmonic Generation (SHG efficiency of some of the synthesized compounds was measured by powder technique using Nd:YAG laser.

  8. Inside the polygonal walls of Amelia (Central Italy): A multidisciplinary data integration, encompassing geodetic monitoring and geophysical prospections

    Science.gov (United States)

    Ercoli, M.; Brigante, R.; Radicioni, F.; Pauselli, C.; Mazzocca, M.; Centi, G.; Stoppini, A.

    2016-04-01

    We investigate a portion of the ancient (VI and IV centuries BC) polygonal walls of Amelia, in Central Italy. After the collapse of a portion of the walls which occurred in January 2006, a wide project started in order to monitor their external facade and inspect the characteristics of the internal structure, currently not clearly known. In this specific case, the preservation of such an important cultural heritage was mandatory, therefore invasive methods like drilling or archaeological essays cannot be used. For this purpose, a multidisciplinary approach represents an innovative way to shed light on their inner structure. We combine several non-invasive techniques such as Ground Penetrating Radar (GPR) and Electrical Resistivity Tomography (ERT), specifically adapted for this study, Laser Scanning and Digital Terrestrial Photogrammetry, integrated with other geomatic measures provided by a Total Station and Global Navigation Satellite Systems (GNSS). After collecting some historical information, we gather the whole datasets exploring for their integration an interpretation approach borrowed from the reflection seismic (attribute analysis and three dimensional visualization). The results give rise for the first time to the internal imaging of this ancient walls, highlighting features associable to different building styles related to different historical periods. Among the result, we define a max wall thickness of about 3.5 m for the cyclopic sector, we show details of the internal block organization and we detect low resistivity values interpretable with high water content behind the basal part of the walls. Then, quantitative analyses to assess their reliable geotechnical stability are done, integrating new geometrical constrains provided by the geophysics and geo-technical ground parameters available in literature. From this analysis, we highlight how the Amelia walls are interested, in the investigated sector, by a critical pseudo-static equilibrium.

  9. Enhancing the concept of corporate diplomacy : encompassing political corporate social responsibility, international relations, and peace through commerce

    NARCIS (Netherlands)

    Westermann-Behaylo, M.K.; Rehbein, K.; Fort, T.

    2015-01-01

    Corporate diplomacy is an emerging concept within the management literature. It describes corporate conduct in the international arena, particularly in challenging political and social environments. Management scholarship and practitioner literature have focused on the communication processes and

  10. Gene expression microarray analysis encompassing metamorphosis and the onset of calcification in the scleractinian coral Montastraea faveolata.

    Science.gov (United States)

    Reyes-Bermudez, Alejandro; Desalvo, Michael K; Voolstra, Christian R; Sunagawa, Shinichi; Szmant, Alina M; Iglesias-Prieto, Roberto; Medina, Mónica

    2009-01-01

    Similar to many marine invertebrates, scleractinian corals experience a dramatic morphological transformation, as well as a habitat switch, upon settlement and metamorphosis. At this time, planula larvae transform from non-calcifying, demersal, motile organisms into sessile, calcifying, benthic juvenile polyps. We performed gene expression microarray analyses between planulae, aposymbiotic primary polyps, and symbiotic adult tissue to elucidate the molecular mechanisms underlying coral metamorphosis and early stages of calcification in the Robust/Short clade scleractinian coral Montastraea faveolata. Among the annotated genes, the most abundant upregulated transcripts in the planula stage are involved in protein synthesis, chromatin assembly and mitochondrial metabolism; the polyp stage, morphogenesis, protein catabolism and organic matrix synthesis; and the adult stage, sexual reproduction, stress response and symbiosis. We also present evidence showing that the planula and adult transcriptomes are more similar to each other than to the polyp transcriptome. Our results also point to a large number of uncharacterized adult coral-specific genes likely involved in coral-specific functions such as symbiosis and calcification.

  11. In vitro neutralization of HCV by goat antibodies against peptides encompassing regions downstream of HVR-1 of E2 glycoprotein.

    Science.gov (United States)

    Tabll, Ashraf A; Atef, Khaled; Bader El Din, Noha G; El Abd, Yasmine S; Salem, Ahmed; Sayed, Ahmed A; Dawood, Reham M; Omran, Moataza H; El-Awady, Mostafa K

    2014-01-01

    This article aims at testing several in vitro systems with various viral sources and cell lines for propagation of HCV to evaluate goat antibodies raised against three E2 epitopes in viral neutralization experiments. Four human cell lines (Huh-7, Huh-7.5, HepG2, and CaCo2) were tested using two different HCV viral sources; Genotype 4 infected sera and J6/JFH HCV cc particles. Neutralization capacity of goat Abs against conserved E2 epitopes; p412 (a.a 412-419), p517 (a.a 517-531), and p430 (a.a 430-447) were examined in the above mentioned in vitro systems. Although infection with patients' sera seems to mimic the in vitro situation, it has limited replication rates as compared with HCV cc particularly in Huh7.5 cells. Non-HCV adapted Huh-7 cells were also found susceptible for transfection with J6/JFH virus but at much slower kinetics. The results of the neutralization assay showed that anti p412 and anti p517 were highly neutralizing to HCVcc. Our data demonstrate that antibodies directed against the viral surface glycoprotein E2 reduced the infectivity of the J6/JFH virus and are promising agents for immunotherapy and HCV vaccine development.

  12. Kafka, Borges, and the creation of consciousness, Part II: Borges--a life of letters encompassing everything and nothing.

    Science.gov (United States)

    Ogden, Thomas H

    2009-04-01

    The ways in which Kafka and Borges struggled with the creation of consciousness in their lives and in their literary works are explored in this two-part essay. In Part II, a biographical sketch of Jorge Luis Borges is juxtaposed with a close reading of one of his fictions, "The Library of Babel" (1941a). In this story, the universe is an infinite Library, a psychological/literary space comprised of books that contain everything that has ever been or ever will be written. By the end of the story, Borges becomes a character in his own fiction. This development was paralleled in Borges's "real life" as he invented a persona named "Borges," a literary creation that allowed Borges to become a character in a story that was his life. The essay concludes with a comparison of the ways in which Borges and Kafka each used writing as a way of creating his own distinctive form of consciousness, and, in so doing, contributed to the creation of twentieth-century consciousness.

  13. Adapting Traditional Ideas for a New Reality: Cosmographers and Physicians Updating Astrology to Encompass the New World.

    Science.gov (United States)

    Lanuza Navarro, Tayra M C

    2016-08-01

    This paper aims to demonstrate that astrology was one of the disciplines that most strongly experienced the process that led European natural philosophers, once they were confronted with the nature of the New World, to recognise that previous knowledge was not as complete or absolute as previously assumed, and that the content of several disciplines had to be renewed, both epistemologically and methodologically. This paper focuses on the work by the cosmographer Henrico Martinez, Repertorio de los tiempos (1606), in which he established the astrological influences specific to Mexico, and the work Sitio, naturatezay propiedades de la Ciudad de Mexico (1618) by the physician Diego Cisneros, who refuted Martinez's astrology for Mexico and created his own instructions for the use of astrology in the practice of medicine in New Spain.

  14. Microduplications encompassing the Sonic Hedgehog Limb Enhancer ZRS are Associated with Haas Type Polysyndactyly and Laurin-Sandrow Syndrome

    DEFF Research Database (Denmark)

    Lohan, Silke; Spielmann, Malte; Doelken, Sandra C

    2014-01-01

    Laurin-Sandrow syndrome (LSS) is a rare autosomal dominant disorder characterized by polysyndactyly of hands and/or feet, mirror image duplication of the feet, nasal defects, and loss of identity between fibula and tibia. The genetic basis of LSS is currently unknown. LSS shows phenotypic overlap...

  15. A new microduplication syndrome encompassing the region of the Miller-Dieker (17p13 deletion) syndrome

    DEFF Research Database (Denmark)

    Roos, L; Jønch, A E; Kjaergaard, S

    2009-01-01

    BACKGROUND: The use of array comparative genome hybridisation (CGH) analyses for investigation of children with mental retardation has led to the identification of a growing number of new microdeletion and microduplication syndromes, some of which have become clinically well characterised and som...

  16. A 380-kb Duplication in 7p22.3 Encompassing the LFNG Gene in a Boy with Asperger Syndrome

    NARCIS (Netherlands)

    Vulto-van Silfhout, A.T.; de Brouwer, A.F.; de Leeuw, N.; Obihara, C.C.; Brunner, H.G.; Vries, L.B.A. de

    2012-01-01

    De novo genomic aberrations are considered an important cause of autism spectrum disorders. We describe a de novo 380-kb gain in band p22.3 of chromosome 7 in a patient with Asperger syndrome. This duplicated region contains 9 genes including the LNFG gene that is an important regulator of NOTCH

  17. Taxonomy of Aspergillus section Petersonii sect. nov encompassing indoor and soil-borne species with predominant tropical distribution

    Czech Academy of Sciences Publication Activity Database

    Jurjevič, Ž.; Kubátová, A.; Kolařík, Miroslav; Hubka, Vít

    2015-01-01

    Roč. 301, č. 10 (2015), s. 2441-2462 ISSN 0378-2697 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Aspergillus arenarius * Multilocus phylogeny * Scanning electron microscopy Subject RIV: EE - Microbiology, Virology Impact factor: 1.361, year: 2015

  18. Content analysis of resident evaluations of faculty anesthesiologists: supervision encompasses some attributes of the professionalism core competency.

    Science.gov (United States)

    Dexter, Franklin; Szeluga, Debra; Hindman, Bradley J

    2017-05-01

    Anesthesiology departments need an instrument with which to assess practicing anesthesiologists' professionalism. The purpose of this retrospective analysis of the content of a cohort of resident evaluations of faculty anesthesiologists was to investigate the relationship between a clinical supervision scale and the multiple attributes of professionalism. From July 1, 2013 to the present, our department has utilized the de Oliveira Filho unidimensional nine-item supervision scale to assess the quality of clinical supervision of residents provided by our anesthesiologists. The "cohort" we examined included all 13,664 resident evaluations of all faculty anesthesiologists from July 1, 2013 through December 31, 2015, including 1,387 accompanying comments. Words and phrases associated with the core competency of professionalism were obtained from previous studies, and the supervision scale was analyzed for the presence of these words and phrases. The supervision scale assesses some attributes of anesthesiologists' professionalism as well as patient care and procedural skills and interpersonal and communication skills. The comments that residents provided with the below-average supervision scores included attributes of professionalism, although numerous words and phrases related to professionalism were not present in any of the residents' comments. The de Oliveira Filho clinical supervision scale includes some attributes of anesthesiologists' professionalism. The core competency of professionalism, however, is multidimensional, and the supervision scale and/or residents' comments did not address many of the other established attributes of professionalism.

  19. Molecular Docking Characterization of a Four-Domain Segment of Human Fibronectin Encompassing the RGD Loop with Hydroxyapatite

    Directory of Open Access Journals (Sweden)

    Tailin Guo

    2013-12-01

    Full Text Available Fibronectin adsorption on biomaterial surfaces plays a key role in the biocompatibility of biomedical implants. In the current study, the adsorption behavior of the 7–10th type III modules of fibronectin (FN-III7–10 in the presence of hydroxyapatite (HAP was systematically investigated by using molecular docking approach. It was revealed that the FN-III10 is the most important module among FN-III7–10 in promoting fibronectin binding to HAP by optimizing the interaction energy; the arginine residues were observed to directly interact with the hydroxyl group of HAP through electrostatic forces and hydrogen bonding. Moreover, it was found that the HAP-binding sites on FN-III10 are mainly located at the RGD loop region, which does not affect the interaction between the fibronectin protein and its cognate receptors on the cell surface.

  20. Naming as Strategic Communication: Understanding Corporate Name Change through an Integrative Framework Encompassing Branding, Identity and Institutional Theory

    DEFF Research Database (Denmark)

    Schmeltz, Line; Kjeldsen, Anna Karina

    2016-01-01

    This article presents a framework for understanding corporate name change as strategic communication. From a corporate branding perspective, the choice of a new name can be seen as a wish to stand out from a group of similar organizations. Conversely, from an institutional perspective, name change...

  1. Inflammatory peeling skin syndrome caused by homozygous genomic deletion in the PSORS1 region encompassing the CDSN gene.

    Science.gov (United States)

    Ishida-Yamamoto, Akemi; Furio, Laetitia; Igawa, Satomi; Honma, Masaru; Tron, Elodie; Malan, Valerie; Murakami, Masamoto; Hovnanian, Alain

    2014-01-01

    Peeling skin syndrome (PSS) type B is a rare recessive genodermatosis characterized by lifelong widespread, reddish peeling of the skin with pruritus. The disease is caused by small-scale mutations in the Corneodesmosin gene (CDSN) leading to premature termination codons. We report for the first time a Japanese case resulting from complete deletion of CDSN. Corneodesmosin was undetectable in the epidermis, and CDSN was unamplifiable by PCR. QMPSF analysis demonstrated deletion of CDSN exons inherited from each parent. Deletion mapping using microsatellite haplotyping, CGH array and PCR analysis established that the genomic deletion spanned 49-72 kb between HCG22 and TCF19, removing CDSN as well as five other genes within the psoriasis susceptibility region 1 (PSORS1) on 6p21.33. This observation widens the spectrum of molecular defects underlying PSS type B and shows that loss of these five genes from the PSORS1 region does not result in an additional cutaneous phenotype. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  2. CERN readies world's biggest science grid The computing network now encompasses more than 100 sites in 31 countries

    CERN Multimedia

    Niccolai, James

    2005-01-01

    If the Large Hadron Collider (LHC) at CERN is to yield miraculous discoveries in particle physics, it may also require a small miracle in grid computing. By a lack of suitable tools from commercial vendors, engineers at the famed Geneva laboratory are hard at work building a giant grid to store and process the vast amount of data the collider is expected to produce when it begins operations in mid-2007 (2 pages)

  3. Ethics needs principles—four can encompass the rest—and respect for autonomy should be "first among equals"

    Science.gov (United States)

    Gillon, R

    2003-01-01

    It is hypothesised and argued that "the four principles of medical ethics" can explain and justify, alone or in combination, all the substantive and universalisable claims of medical ethics and probably of ethics more generally. A request is renewed for falsification of this hypothesis showing reason to reject any one of the principles or to require any additional principle(s) that can't be explained by one or some combination of the four principles. This approach is argued to be compatible with a wide variety of moral theories that are often themselves mutually incompatible. It affords a way forward in the context of intercultural ethics, that treads the delicate path between moral relativism and moral imperialism. Reasons are given for regarding the principle of respect for autonomy as "first among equals", not least because it is a necessary component of aspects of the other three. A plea is made for bioethicists to celebrate the approach as a basis for global moral ecumenism rather than mistakenly perceiving and denigrating it as an attempt at global moral imperialism. PMID:14519842

  4. Ethics needs principles--four can encompass the rest--and respect for autonomy should be "first among equals".

    Science.gov (United States)

    Gillon, R

    2003-10-01

    It is hypothesised and argued that "the four principles of medical ethics" can explain and justify, alone or in combination, all the substantive and universalisable claims of medical ethics and probably of ethics more generally. A request is renewed for falsification of this hypothesis showing reason to reject any one of the principles or to require any additional principle(s) that can't be explained by one or some combination of the four principles. This approach is argued to be compatible with a wide variety of moral theories that are often themselves mutually incompatible. It affords a way forward in the context of intercultural ethics, that treads the delicate path between moral relativism and moral imperialism. Reasons are given for regarding the principle of respect for autonomy as "first among equals", not least because it is a necessary component of aspects of the other three. A plea is made for bioethicists to celebrate the approach as a basis for global moral ecumenism rather than mistakenly perceiving and denigrating it as an attempt at global moral imperialism.

  5. Duplication of 7q36.3 encompassing the Sonic Hedgehog (SHH) gene is associated with congenital muscular hypertrophy

    DEFF Research Database (Denmark)

    Kristensen, Lone Krøldrup; Kjaergaard, S; Kirchhoff, Marianne

    2012-01-01

    with muscular hypertrophy and mildly retarded psychomotor development. Array-CGH identified a small duplication of 7q36.3 including the Sonic Hedgehog (SHH) gene in both the aborted foetus and the live born male sib. Neither of the parents carried the 7q36.3 duplication. The consequences of overexpression...

  6. Sequence analysis and transcript identification within 1.5 MB of DNA deleted together with the NDP and MAO genes in atypical Norrie disease patients presenting with a profound phenotype.

    Science.gov (United States)

    Suárez-Merino, B; Bye, J; McDowall, J; Ross, M; Craig, I W

    2001-06-01

    Mutations at the Norrie disease gene locus, NDP, manifest in a broad range of defects. These range from a relatively mild, late-onset, exudative vitreoretinopathy to congenital blindness and sensorineural deafness combined, in some cases, with mental retardation. In addition, extensive deletions involving the NDP locus, located at Xp11.3, the adjacent monoamine oxidadase genes MAOA and MAOB, and additional material, result in a more severe pattern of symptoms. The phenotypes include all or some of the following; mental retardation, involuntary movements, hypertensive crises and hypogonadism. We extended an existing YAC contig to embrace the boundaries of three of the largest deletions and converted this into four PAC contigs. Computer analysis and experimental data have resulted in the identification of several putative loci, including a phosphatase inhibitor 2-like gene (dJ154.1) and a 250-bp sequence which resembles a homeobox domain (dA113.3), 1.2 Mb and 400 kb respectively from the MAO/NDP cluster. The pattern of expression of dJ154.1 suggests that it may represent an important factor contributing to the complex phenotypes of these deletion patients. Hum Mutat 17:523, 2001. Copyright 2001 Wiley-Liss, Inc.

  7. INE: a rice genome database with an integrated map view.

    Science.gov (United States)

    Sakata, K; Antonio, B A; Mukai, Y; Nagasaki, H; Sakai, Y; Makino, K; Sasaki, T

    2000-01-01

    The Rice Genome Research Program (RGP) launched a large-scale rice genome sequencing in 1998 aimed at decoding all genetic information in rice. A new genome database called INE (INtegrated rice genome Explorer) has been developed in order to integrate all the genomic information that has been accumulated so far and to correlate these data with the genome sequence. A web interface based on Java applet provides a rapid viewing capability in the database. The first operational version of the database has been completed which includes a genetic map, a physical map using YAC (Yeast Artificial Chromosome) clones and PAC (P1-derived Artificial Chromosome) contigs. These maps are displayed graphically so that the positional relationships among the mapped markers on each chromosome can be easily resolved. INE incorporates the sequences and annotations of the PAC contig. A site on low quality information ensures that all submitted sequence data comply with the standard for accuracy. As a repository of rice genome sequence, INE will also serve as a common database of all sequence data obtained by collaborating members of the International Rice Genome Sequencing Project (IRGSP). The database can be accessed at http://www. dna.affrc.go.jp:82/giot/INE. html or its mirror site at http://www.staff.or.jp/giot/INE.html

  8. Automated integration of genomic physical mapping data via parallel simulated annealing

    Energy Technology Data Exchange (ETDEWEB)

    Slezak, T.

    1994-06-01

    The Human Genome Center at the Lawrence Livermore National Laboratory (LLNL) is nearing closure on a high-resolution physical map of human chromosome 19. We have build automated tools to assemble 15,000 fingerprinted cosmid clones into 800 contigs with minimal spanning paths identified. These islands are being ordered, oriented, and spanned by a variety of other techniques including: Fluorescence Insitu Hybridization (FISH) at 3 levels of resolution, ECO restriction fragment mapping across all contigs, and a multitude of different hybridization and PCR techniques to link cosmid, YAC, AC, PAC, and Pl clones. The FISH data provide us with partial order and distance data as well as orientation. We made the observation that map builders need a much rougher presentation of data than do map readers; the former wish to see raw data since these can expose errors or interesting biology. We further noted that by ignoring our length and distance data we could simplify our problem into one that could be readily attacked with optimization techniques. The data integration problem could then be seen as an M x N ordering of our N cosmid clones which ``intersect`` M larger objects by defining ``intersection`` to mean either contig/map membership or hybridization results. Clearly, the goal of making an integrated map is now to rearrange the N cosmid clone ``columns`` such that the number of gaps on the object ``rows`` are minimized. Our FISH partially-ordered cosmid clones provide us with a set of constraints that cannot be violated by the rearrangement process. We solved the optimization problem via simulated annealing performed on a network of 40+ Unix machines in parallel, using a server/client model built on explicit socket calls. For current maps we can create a map in about 4 hours on the parallel net versus 4+ days on a single workstation. Our biologists are now using this software on a daily basis to guide their efforts toward final closure.

  9. Empowering Youth to Take Charge of School Wellness

    Science.gov (United States)

    Hughes, Luanne J.; Savoca, LeeAnne; Grenci, Alexandra

    2015-01-01

    Youth Advisory Councils (YACs) ensure that students are represented in school wellness discussions. YACs empower students to present ideas, insights, and input on nutrition and physical activity; work alongside peers to assess wellness needs; and develop recommendations for enhancing/expanding the school wellness environment. YACs provide a…

  10. Dicty_cDB: Contig-U11517-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available from... 62 6e-32 6 ( DQ369283 ) Anthepiscopus sp. JKM-2006 carbamoylphosphate syn... 64 8e-29 6 ( AY280699 ...U-99071950 CAD (r)... 608 e-172 DQ369283_1( DQ369283 |pid:none) Anthepiscopus sp. JKM-2006 carbamo... 607 e-

  11. Dicty_cDB: Contig-U14530-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Cyanolyca turcosa voucher ANSP 512... 35 4.5 FJ173444_1( FJ173444 |pid:none) Phylloscopus trivir...gatus isolate P... 34 5.8 FJ173443_1( FJ173443 |pid:none) Phylloscopus trivirgatu...1( FJ598176 |pid:none) Cyanolyca pulchra voucher QCAZ 300... 34 7.6 FJ173456_1( FJ173456 |pid:none) Phylloscopus

  12. Dicty_cDB: Contig-U15223-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( EF468149 |pid:none) Aplonis grandis isolate Agran67899... 42 0.007 EU481444_1( EU481444 |pid:none) Phylloscopus...mixtata voucher s... 42 0.007 EU481443_1( EU481443 |pid:none) Phylloscopus borealis NADH dehydro... 42 0.007...solate ZMUC 115... 42 0.007 EU481445_1( EU481445 |pid:none) Phylloscopus borealis

  13. Dicty_cDB: Contig-U12971-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *vviwfvxxx Frame C: fiiftitaslatkviseqiiysniklpekwkyf*fiy*l*wiis*frryeyikriifiii *esk*s**ikvfssnti*ts*ckiiis...fliyilvimdh*liqkvrvh*edyiyhh iriqviivnqsi*q*hnlnqlmqdyhfhvlmnhh*kpigqfglhiqiiikhsqicqpi*w kiir*pikqpldsilpqr

  14. Dicty_cDB: Contig-U12390-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .......................done Score E Sequences producing significant alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmog...nathus marmoratus isolate 69... 40 0.18 AY612344_1( AY612344 |pid:none) Desmog...isolate 75356 NADH... 38 0.92 AY612348_1( AY612348 |pid:none) Desmognathus quadramaculatus vouch... 36 3.5 A...Y698038_1( AY698038 |pid:none) Desmognathus marmoratus isolate T0... 36 3.5 AY698...041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 36 3.5 CP000270_2676( CP000270 |pid:none) B

  15. Dicty_cDB: Contig-U16385-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rrifsnl*kv***iynv*kg fgn*kih*r*inskke*kgekrngd*kieigndsfeikenwftfilq*nsc***iitnlf hkfsgsst***r*rnyqrvyq*sksi...knstrrifsnl*kv***iynv*kg fgn*kih*r*inskke*kgekrngd*kieigndsfeikenwftfilq*nsc***iitnlf hkfsgsst***r*rnyqrvyq*

  16. Dicty_cDB: Contig-U15516-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ldhifalcdqflsiqa yhtelteylksrmeaiapnltilvgeivgarlicragslmnlakypastiqilgaekalf ral...lddltteiniyamrarewygwhfpelgklitnhtqyanaik amgnrksavdtdftdilpeevaeevkeaaqismgteispedldhifalcdqflsiqayht elteylksrmeaiapnltilvgeivgarli...pelgklitnhtqyan aikamgnrksavdtdftdilpeevaeevkeaaqismgteispedldhifalcdqflsiqa yhtelteylksrmeaiapnltilvgeivgarlic

  17. Dicty_cDB: Contig-U04138-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available voucher 109... 64 3e-16 3 ( AF338075 ) Blackburnia kamehameha clone JK190 cytochrome b (... 78 4e-16 3 ( AB...44 ) Bruchidius saudicus cytochrome b (cytb) gene, par... 74 5e-16 2 ( AF534959 ) Blackburnia kamehameha iso

  18. Dicty_cDB: Contig-U15258-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rlehlgklyqllnsvgeikkikeswqsyikqtgiqmlndkekextliqdll dykdrldrilsqsfsknelltyalkesfeyfintkqnkpaelvarfid...mvngdrledlgklyqllnsvgeik kikeswqsyikqtgiqmlndkekextliqdlldykdrldrilsqsfsknelltyalkesf eyfintkqnkpaelvarfidsk...liqdll dykdrldrilsqsfsknelltyalkesfeyfintkqnkpaelvarfidsklkvggkrml* EELETVLNKSLILFRYIQGKDVFEAFYKQDLSKRLLLDKS

  19. Dicty_cDB: Contig-U07117-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss7...6.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddb

  20. Dicty_cDB: Contig-U15448-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss7...2.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  1. Dicty_cDB: Contig-U12980-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  2. Dicty_cDB: Contig-U01474-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq;

  3. Dicty_cDB: Contig-U14460-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80

  4. Dicty_cDB: Contig-U04482-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82.seq; ddbjgss83.se

  5. Dicty_cDB: Contig-U14383-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available jgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82.seq; ddbjgss83.seq;

  6. Dicty_cDB: Contig-U08573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss7...7.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddb

  7. Dicty_cDB: Contig-U13590-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80

  8. Dicty_cDB: Contig-U02644-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss7...7.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82.seq; d

  9. Dicty_cDB: Contig-U01243-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss7...6.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81

  10. Dicty_cDB: Contig-U14612-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss7...2.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  11. Dicty_cDB: Contig-U00778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.se

  12. Dicty_cDB: Contig-U14108-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbj

  13. Dicty_cDB: Contig-U01684-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  14. Dicty_cDB: Contig-U01012-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.s

  15. Dicty_cDB: Contig-U14358-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  16. Dicty_cDB: Contig-U15382-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq

  17. Dicty_cDB: Contig-U05786-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available bjgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; d

  18. Dicty_cDB: Contig-U02918-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq;

  19. Dicty_cDB: Contig-U05674-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available jgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.s

  20. Dicty_cDB: Contig-U12930-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; dd

  1. Dicty_cDB: Contig-U14043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.se...q; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss7...6.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss

  2. Dicty_cDB: Contig-U14623-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss7...2.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  3. Dicty_cDB: Contig-U06926-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss

  4. Dicty_cDB: Contig-U13745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss7...2.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  5. Dicty_cDB: Contig-U14125-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.se

  6. Dicty_cDB: Contig-U07065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available jgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq

  7. Dicty_cDB: Contig-U01767-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available jgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; dd

  8. Dicty_cDB: Contig-U13005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss7...6.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss8

  9. Dicty_cDB: Contig-U14671-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  10. Dicty_cDB: Contig-U12760-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.se...q; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss

  11. Dicty_cDB: Contig-U04485-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  12. Dicty_cDB: Contig-U14444-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq

  13. Dicty_cDB: Contig-U03723-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.s

  14. Dicty_cDB: Contig-U06594-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81

  15. Dicty_cDB: Contig-U15380-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  16. Dicty_cDB: Contig-U13253-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82.seq; ddbjgss83

  17. Dicty_cDB: Contig-U14406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss7...5.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.se

  18. Dicty_cDB: Contig-U06177-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss7...7.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82

  19. Dicty_cDB: Contig-U12687-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss7...1.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss7...7.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjg

  20. Dicty_cDB: Contig-U14432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbj

  1. Dicty_cDB: Contig-U13294-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss7...3.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  2. Dicty_cDB: Contig-U14004-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss7

  3. Dicty_cDB: Contig-U14661-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss7...4.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgs...1.seq; ddbjgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.s

  4. Dicty_cDB: Contig-U08565-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7.seq; ddbjgss7...0.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss76.seq; ddbjgss77.seq; ddbjgss7...8.seq; ddbjgss79.seq; ddbjgss8.seq; ddbjgss80.seq; ddbjgss81.seq; ddbjgss82.seq; ddbj

  5. Dicty_cDB: Contig-U03915-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q; ddbjgss62.seq; ddbjgss63.seq; ddbjgss64.seq; ddbjgss65.seq; ddbjgss66.seq; ddbjgss67.seq; ddbjgss68.seq; ddbjgss69.seq; ddbjgss7....seq; ddbjgss70.seq; ddbjgss71.seq; ddbjgss72.seq; ddbjgss73.seq; ddbjgss74.seq; ddbjgss75.seq; ddbjgss7...6.seq; ddbjgss77.seq; ddbjgss78.seq; ddbjgss79.seq; ddbjgss8.s

  6. Dicty_cDB: Contig-U02008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .9 2 ( DJ019323 ) Molecular Nephrotoxicology Modeling. 38 4.9 2 ( DJ007404 ) Prim... 2 ( DD269614 ) Molecular Hepatotoxicology Modeling. 38 4.9 2 ( BD391245 ) Methods for the toxicity predicti

  7. Dicty_cDB: Contig-U16143-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 54 0.012 1 ( DJ019361 ) Molecular Nephrotoxicology Modeling. 54 0.012 1 ( DD316380 ) Primary Rat Hepatocyt...e Toxicity Modeling. 54 0.012 1 ( DD269668 ) Molecular Hepatotoxicology Modeling.

  8. Dicty_cDB: Contig-U11532-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cology Modeling. 62 6e-05 1 ( AC004912 ) Homo sapiens PAC clone RP5-871B15 from 7, ...n chromo... 62 6e-05 1 ( AC122028 ) Mus musculus BAC clone RP24-394D4 from 2, complet... 62 6e-05 1 ( DD267290 ) Molecular Hepatotoxi

  9. Dicty_cDB: Contig-U06506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3e-08 3 ( DJ019170 ) Molecular Nephrotoxicology Modeling. 54 3e-08 3 ( DJ007525 ) Primary rat hepatocyte tox...icity modeling. 54 3e-08 3 ( DD269914 ) Molecular Hepatotoxicology Modeling. 54 3e-08 3 ( BD301471 ) Identif

  10. Dicty_cDB: Contig-U01734-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ementina cDNA 5'... 32 4.4 2 ( DQ988057 ) Sepia pharaonis GofC1 16S ribosomal RNA gene, par... 32 4.6 2 ( DQ180983 ) Idiopteron bipla...giatum voucher UPOL 000M44 large ... 32 4.6 2 ( AF466309

  11. Dicty_cDB: Contig-U12414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E009949_772( AE009949 |pid:none) Streptococcus pyogenes MGAS8232,... 79 4e-13 AB015024_1( AB015024 |pid:none...) Elizabethkingia meningoseptica gyr... 79 4e-13 AM295250_2458( AM295250 |pid:none) Staphylococcus carnosus

  12. Dicty_cDB: Contig-U11322-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 CP001389_3336( CP001389 |pid:none) Rhizobium sp. NGR234, complete ... 39 0.50 AB471639_28( AB471639 |pid:none) Desulfotignum baltic...um genomic DN... 39 0.50 CP000092_304( CP000092 |pid:none) Ralstonia eutropha JMP13

  13. Dicty_cDB: Contig-U16395-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available virus 241ext gene for puta... 41 0.060 C72174( C72174 ) D8R protein - variola minor virus (strain Garcia...rio proteasome (prosome, m... 40 0.10 C72175( C72175 ) G1R protein - variola minor virus (strain Garcia-...

  14. Dicty_cDB: Contig-U15939-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nlkeklvnylh*ilvkqmmvwgsaciaslygwdfekkqqfgtpfadcfcittdahp mikavlsvadgsghgedpkraaqm...slygwdfekkqqfgtpfadcfcittdahp mikavlsvadgsghgedpkraaqmsilganqyieslfdqdipttndlltvvgnsifeghk riiedeyyqnqeihiep...QQTLLPIPTLSSSPS TTNTNTNTNTNTNTNINTNTPLSSSNTTSNDNNNNTNSNGLSPRLPEKPKDSAKPKCYSS *in*nlkeklvnylh*ilvkqmmvwgsacia

  15. Dicty_cDB: Contig-U02854-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FDSANAANFS LYSMAPFKLYLPLMFESSGTPCFLKNSFAFVLPPCFIFSNCWSFH*sivklltklk*tpk llctplhskqm*ip*etdahcgfadlhskqtlfdes...KNSFAFVLPPCFIFSNCWSFH*sivklltklk*tpk llctplhskqm*ip*etdahcgfadlhskqtlfdesssfnllkisfalailllyllidix xkxikxkrxk

  16. Dicty_cDB: Contig-U16473-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clavatum 18S ribosomal RNA gene, pa... 54 0.022 1 ( AY230088 ) Chama sp. Seychelles...-GS-2003 isolate b 18S riboso... 54 0.022 1 ( AY230087 ) Chama sp. Seychelles-GS-2003 isolate a 18S riboso

  17. Dicty_cDB: Contig-U16078-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 346 |pid:none) Bactrocera cucurbitae white eye pr... 99 5e-19 CR382139_636( CR382...rain Friedlin,... 63 5e-08 AY055816_1( AY055816 |pid:none) Bactrocera cucurbitae ABC membrane... 63 5e-08 AL

  18. Dicty_cDB: Contig-U12372-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-11 AP005795_18( AP005795 |pid:none) Oryza sativa Japonica Group genom... 74 2e-11 AY155346_1( AY155346 |pid:none) Bactrocera cucu...rbitae white eye pr... 73 2e-11 (Q9M9E1) RecName: Full=Pleiotropic drug resistance

  19. Dicty_cDB: Contig-U11897-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-17 AY155346_1( AY155346 |pid:none) Bactrocera cucurbitae white eye pr... 93 2e-...816 |pid:none) Bactrocera cucurbitae ABC membrane... 67 1e-09 U73828_1( U73828 |pid:none) Aedes albopictus w

  20. Dicty_cDB: Contig-U11980-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Debaryomyces hansenii chromosome... 75 1e-11 AY155346_1( AY155346 |pid:none) Bactrocera cucurbita... |pid:none) Bactrocera tryoni scarlet gene, co... 52 2e-04 AY055816_1( AY055816 |pid:none) Bactrocera cucu...rbitae ABC membrane... 52 2e-04 CP000497_149( CP000497 |pid:none) Pichia stipitis C

  1. Dicty_cDB: Contig-U05695-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -709P8, WORKING... 44 1.2 3 ( EU926921 ) Bactrocera cucurbitae voucher YSUW95011901 16S ri... 40 1.2 2 ( CP0...01056 ) Clostridium botulinum B str. Eklund 17B, complete... 34 1.6 16 ( AB048754 ) Bactrocera cucurbitae mi...tochondrial genes for 16S... 40 1.6 2 ( AB048748 ) Bactrocera cucurbitae mitochon...drial genes for 16S... 40 1.6 2 ( AB035113 ) Bactrocera cucurbitae mitochondrial genes for 16S... 40 1.6 2 (... AB035112 ) Bactrocera cucurbitae mitochondrial genes for 16S... 40 1.6 2 ( AB048746 ) Bactrocera tau mitoch

  2. Dicty_cDB: Contig-U02967-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available thaliana DNA chromosome 5, BAC clone ... 44 1.2 2 ( EU494535 ) Scaptodrosophila pattersoni voucher 105497 16.... 38 1.3 2 ( EU494534 ) Scaptodrosophila lebanonensis voucher 105639 16S ... 38 1.3 2 ( EU494492 ) Drosophil

  3. Dicty_cDB: Contig-U11778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 43 2e-32 AF093214_1( AF093214 |pid:none) Hirtodrosophila pictiventris xanth... 14... 8e-30 AF543143_1( AF543143 |pid:none) Drosophila nannoptera strain 2 xan... 134 8e-30 AF058984_1( AF058984 |pid:none) Scaptodrosophi...la lebanonensis xant... 134 8e-30 AF543107_1( AF543107 |pid:none) Drosophila eremop

  4. Dicty_cDB: Contig-U13293-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 093214_1( AF093214 |pid:none) Hirtodrosophila pictiventris xanth... 206 6e-52 FB7...23 |pid:none) Sequence 7019 from Patent WO200903... 191 2e-47 AF058984_1( AF058984 |pid:none) Scaptodrosophila

  5. Dicty_cDB: Contig-U16348-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available on DNA. 46 1.8 1 ( V00221 ) Mobile dispersed genetic element MDG1 (drosophila) ... 46 1.8 1 ( V00220 ) Mobil...e dispersed genetic element MDG1 (drosophila) ... 46 1.8 1 ( M36681 ) D.melanogaster mobile dispersed gene 1

  6. Dicty_cDB: Contig-U11298-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ondrial gene for sma... 48 1.5 1 ( CU466524 ) Pig DNA sequence from clone CH242-95O23 on chromo... 48 1.5 1 ( EU494534 ) Scaptodrosop...hila lebanonensis voucher 105639 16S ... 48 1.5 1 ( AC11

  7. Dicty_cDB: Contig-U06052-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 22_1( AF021822 |pid:none) Scaptodrosophila lebanonensis supe... 58 5e-07 ( P93407 ) RecName: Full=Superoxide...tase [Cu-Zn]; EC... 55 5e-06 AF021824_1( AF021824 |pid:none) Hirtodrosophila pictiventris super... 55 5e-06

  8. Dicty_cDB: Contig-U06499-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 46 1.0 1 ( EU494536 ) Zaprionus lineosus voucher 103961 16S ribosomal R... 46 1.0 1 ( EU494535 ) Scaptodrosophila... pattersoni voucher 105497 16S ri... 46 1.0 1 ( EU494534 ) Scaptodrosophila lebanonensis voucher 10

  9. Dicty_cDB: Contig-U08145-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 50 1e-04 AF021822_1( AF021822 |pid:none) Scaptodrosophila lebanonensis supe... ...emonia viridis copper/zinc super... 49 6e-04 AF021824_1( AF021824 |pid:none) Hirtodrosophila pictiventris su

  10. Dicty_cDB: Contig-U05646-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available HLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcsfnw*iif*iyiyiyi**nki Translat...WTILEPFVPIDSTHLNVLKIFIFSILILVLCNILGNVHLWFY HYHQDY*kl*llislgfywllfllslvi*l*lvvlqi*l*lkxxx*nwffrifkiwctfn yishfnwctdcs

  11. Dicty_cDB: Contig-U06544-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7 ) Zea mays chromosome 5 clone CH201-250N7; ZMMBBc02... 34 3.0 2 ( CO164117 ) FLD1_46_A02.b1_A029 Root flood...Mixed stage fo... 36 3.4 2 ( CO164196 ) FLD1_46_A02.g1_A029 Root flooded Pinus taeda cDNA... 38 3.5 2 ( AC21

  12. Dicty_cDB: Contig-U15762-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 Root cold Pinus taeda cDNA c... 46 6.7 1 ( CO166910 ) FLD1_65_A02.g1_A029 Root flood...ed Pinus taeda cDNA... 46 6.7 1 ( CO161061 ) FLD1_26_H12.b1_A029 Root flooded Pinus taeda cDNA... 46 6.

  13. Dicty_cDB: Contig-U14913-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FLD1_53_G01.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO165241 ) FLD1_53_G01.b1_A029 Root flooded... Pinus taeda cDNA... 50 0.16 1 ( CO163000 ) FLD1_38_G07.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 (... CO162917 ) FLD1_38_G07.b1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO15...9866 ) FLD1_16_B12.g1_A029 Root flooded Pinus taeda cDNA... 50 0.16 1 ( CO158395 ) FLD1_6_D06.g1_A029 Root flood

  14. Dicty_cDB: Contig-U12920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available complete sequence. 38 0.70 2 ( DQ230318 ) Shuttle/allelic-replacement vector pMQ8...complete sequence. 38 0.70 2 ( DQ230317 ) Shuttle/allelic-replacement vector pMQ30, complet... 38 0.70 2 ( A...ACT.1 complete sequence. 38 0.70 2 ( DQ230319 ) Shuttle/allelic-replacement vecto

  15. Dicty_cDB: Contig-U15843-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BHY5562.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 ( BQ114953 ) EST600529 mixed potato tissues Sol...lus trich... 36 7.1 2 ( FD665298 ) CBBW522.rev CBBW Mycosphaerella fijiensis MfEST4 ... 36 7.1 2 ( FD692768 ...) CBHY4190.rev CBHY Mycosphaerella fijiensis MfEST5... 36 7.1 2 ( BP035364 ) Lotus japonicus cDNA, clone:MFB... 7.3 2 ( BF053354 ) EST438584 potato leaves and petioles Solanum tube... 36 7.3 2 ( FD686209 ) CBHX5588.rev CBHX Mycosphaerella fiji...ensis MfEST4... 36 7.3 2 ( FD687727 ) CBHY1213.rev CBHY Mycosphaerella fijiensis MfE

  16. Dicty_cDB: Contig-U15690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ta cDNA 5', mRNA seq... 46 7.4 1 ( FD689772 ) CBHY2434.fwd CBHY Mycosphaerella fijiensis MfEST5... 46 7.4 1 ...( FD689771 ) CBHY2434.rev CBHY Mycosphaerella fijiensis MfEST5... 46 7.4 1 ( FD681956 ) CBHW747.rev CBHW Mycosphaerella fiji...ensis MfEST4 ... 46 7.4 1 ( FD681900 ) CBHW717.rev CBHW Mycosphaerella fiji...ensis MfEST4 ... 46 7.4 1 ( FD680197 ) CBHW396.rev CBHW Mycosphaerella fijiensis MfEST4 ... 46 7.4... 1 ( FD679925 ) CBHW3049.rev CBHW Mycosphaerella fijiensis MfEST4... 46 7.4 1 ( FD505746 ) Pam01b_67_B04_C01

  17. Dicty_cDB: Contig-U10820-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 107.fwd CBHU Mycosphaerella fijiensis MfEST3... 54 2e-05 2 ( FD673984 ) CBHU3107....rev CBHU Mycosphaerella fijiensis MfEST3... 54 2e-05 2 ( FD672075 ) CBHU2044.rev CBHU Mycosphaerella fijiens

  18. Dicty_cDB: Contig-U12496-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E8.r CHORI-242 Sus scrofa genomic clone C... 44 9.1 1 ( FD687842 ) CBHY1281.fwd CBHY Mycosphaerella fijiensi...s MfEST5... 44 9.1 1 ( FD687633 ) CBHY1157.rev CBHY Mycosphaerella fijiensis MfEST5... 44 9.1 1 ( FD687295 )... CBHX6118.fwd CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD682112 ) CBHX1...985.rev CBHX Mycosphaerella fijiensis MfEST4... 44 9.1 1 ( FD677743 ) CBHW1795.rev CBHW Mycosphaerella fijie...nsis MfEST4... 44 9.1 1 ( FD666344 ) CBHT1283.rev CBHT Mycosphaerella fijiensis MfEST3... 44 9.1 1 >( AC1155

  19. Dicty_cDB: Contig-U16022-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available te synthase... 70 5e-08 2 ( FD671552 ) CBHU1735.fwd CBHU Mycosphaerella fijiensis...5 7 ( DY578838 ) A038-F9 Acropora millepora postsettlement library... 52 0.085 1 ( FD671551 ) CBHU1735.rev CBHU Mycosphaerella fiji

  20. Dicty_cDB: Contig-U16126-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gariensis ... 52 0.090 1 ( FD694085 ) CBHY4909.fwd CBHY Mycosphaerella fijiensis ...eri f. nagariensis ... 50 0.35 1 ( FD674561 ) CBHU3431.fwd CBHU Mycosphaerella fijiensis MfEST3... 50 0.35 1...eri f. nagariensis i... 48 1.4 1 ( FD689804 ) CBHY2454.fwd CBHY Mycosphaerella fijiensis MfEST5... 48 1.4 1

  1. Dicty_cDB: Contig-U14801-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAZO Naegleria gruberi Flagellate Sta... 42 1.1 2 ( FD681213 ) CBHW4480.rev CBHW Mycosphaerella fiji...ensis MfEST4... 46 1.9 1 ( FD669540 ) CBHT4023.rev CBHT Mycosphaerella fijiensis MfEST3...... 46 1.9 1 ( FD669082 ) CBHT3400.rev CBHT Mycosphaerella fijiensis MfEST3... 46 1.9 1 ( AE017194 ) Bacillus

  2. Dicty_cDB: Contig-U15415-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BHX5888.fwd CBHX Mycosphaerella fijiensis MfEST4... 46 8.1 1 ( FD686821 ) CBHX5888.rev CBHX Mycosphaerella fiji...ensis MfEST4... 46 8.1 1 ( FD686533 ) CBHX5748.rev CBHX Mycosphaerella fijiens

  3. Dicty_cDB: Contig-U12232-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 15 EF494754_1( EF494754 |pid:none) Sorbus aucuparia isolate SaucS7b s... 87 1e-15 EU247098_1( EU247098 |pid:none) Pyrus syria...or S... 79 5e-13 EU247101_1( EU247101 |pid:none) Pyrus syriaca S5 RNase gene, par...247097 |pid:none) Pyrus syriaca S1 RNase gene, parti... 94 1e-17 CR382132_1073( CR382132 |pid:none) Yarrowia...EU294324 |pid:none) Prunus webbii S10-RNase gene, part... 94 1e-17 EU247097_1( EU

  4. Dicty_cDB: Contig-U11323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF134321 |pid:none) Dissostichus mawsoni clone Dm7m ch... 84 3e-14 AM747721_702( ...S101... 81 2e-13 U58944_1( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 81 2e-13 AM182501_1( ...017194_2467( AE017194 |pid:none) Bacillus cereus ATCC 10987, com... 75 1e-11 U43149_1( U43149 |pid:none) Dissostichus mawson

  5. Dicty_cDB: Contig-U15057-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( U58944 |pid:none) Dissostichus mawsoni AFGP antifreeze g... 44 0.012 C81265( C81265 )probable lipoprotein ...U43149_1( U43149 |pid:none) Dissostichus mawsoni antifreeze glycop... 36 3.2 ( P24856 ) RecName: Full=Ice-st

  6. Dicty_cDB: Contig-U15936-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s Petromyzon m... 38 7.2 2 ( FE200565 ) B332G05 Antarctic fish Dissostichus mawsoni adult... 40 7.2 2 ( EF71...rctic fish Dissostichus mawsoni adult... 40 5.5 2 ( CQ311760 ) Sequence 22865 fro...tivus var. oleiformi... 46 5.5 1 ( Y10744 ) L.meyeri metY and metX genes. 46 5.5 1 ( FE196946 ) B206A08 Anta

  7. Dicty_cDB: Contig-U15728-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 054-501 Normalized CNS library (juven... 34 0.99 2 ( FE200246 ) B328E04 Antarctic fish Dissostichus mawsoni ...adult... 38 0.99 2 ( FE225391 ) O067F02 Antarctic fish Dissostichus mawsoni adult... 38 0.99 2 ( FI095335 )

  8. Dicty_cDB: Contig-U04369-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 1 ( FG083940 ) CMRC-FF-IH0-abv-c-22-0-CMRC.r1 Ceratitis capitata... 44 6.3 1 ( FE199855 ) B322G01 Antarctic fish Dissostichus mawso...ni adult... 44 6.3 1 ( FE194211 ) B169G05 Antarctic fish Dissostichus mawsoni adult...... 44 6.3 1 ( FE194209 ) B169G03 Antarctic fish Dissostichus mawsoni adult... 44... 6.3 1 ( FE194180 ) B169D07 Antarctic fish Dissostichus mawsoni adult... 44 6.3 1 ( EW982994 ) EST_sras_evg_

  9. Dicty_cDB: Contig-U15259-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0006742 rw_mgpallid Polysphondylium pallidum ... 50 4e-10 2 ( FE218415 ) L110G07 Antarctic fish Dissostichus mawson...i adult... 56 0.001 1 ( FE208600 ) K060D09 Antarctic fish Dissostichus mawsoni adult... 56 0.001 1 ( ...FE205438 ) K012C10 Antarctic fish Dissostichus mawsoni adult... 56 0.001 1 ( FE20...5424 ) K012A12 Antarctic fish Dissostichus mawsoni adult... 56 0.001 1 ( CT754403 ) Paramecium tetraurelia 5...A01 Antarctic fish Dissostichus mawsoni adult... 48 0.28 1 ( ES894727 ) LET081_2007-02-10/LET081_G11_042_1 S

  10. Dicty_cDB: Contig-U15444-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3H04SK PhyRootSw1 Citrus sinensis cDNA clone... 52 0.001 2 ( FE207941 ) K052G01 Antarctic fish Dissostichus mawson...E224119 ) O052F03 Antarctic fish Dissostichus mawsoni adult... 38 0.002 3 ( EW770...2 2 ( FE205779 ) K020F10 Antarctic fish Dissostichus mawsoni adult... 38 0.003 3 ( FE205204 ) K010B01 Antarctic fish Dissostichus maw...cDNA clone:whsct13p03, 3' end. 52 0.003 2 ( FE207197 ) K043G11 Antarctic fish Dissostichus mawsoni adult... ... Antarctic fish Dissostichus mawsoni adult... 38 0.003 3 ( FE223392 ) O043F12 Ant

  11. Dicty_cDB: Contig-U16365-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sps*sssppssssssssssssssssssssssssssxr xx*sssxrx****ss*rxrxrxxsxsxxxxxsxsssssxrxx*xss*xssxxrxxxcssx *xsxxc...sssssssssssssssssssssssxr xx*sssxrx****ss*rxrxrxxsxsxxxxxsxsssssxrxx*xss*xssxxrxxxcssx *xsxxcxsx*ss*XXXXCXSX

  12. Dicty_cDB: Contig-U15574-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available x sssssxsxx*sssxxssx*sxxxcxsxxxsxxcxsx*ssxxxxscxsxxsxsxxssxxxx sxxsxxxxsxxxxxsxss...KASIYDKNINN IQPSSSSSSSSSSSSSSXS*x*sssxsxr*sssxsxrxxxsscrxx*x*ssxsxx*xxxx sssssxsxx*sssxxssx*sxxxcxsxxxsxxcxs

  13. Dicty_cDB: Contig-U12549-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS*dfttlfstnrscfrcit*cncssiivrsk*lrsfrrgcfta irrts*etfcft*g*kiyffreststlg*sllenhstc*tsipwyssfqxvflgeisp*n rl...ELERLKF KIPLMIGGATTLTNSHSS*dfttlfstnrscfrcit*cncssiivrsk*lrsfrrgcfta irrts*etfcft

  14. Dicty_cDB: Contig-U15606-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LLIILNIIFFKL**kwifiif*itiiqtiiflilk iivillilvkiiknamakvkcyhhlh**hhpikmiq*liipmvvqslfqerc*liqiql* tvapmvsclll... ---TVGLLDIFFIINNLIICIIILLLLIILNIIFFKL**kwifiif*itiiqtiiflilk iivillilvkiiknamakvkcyhhlh**hhpikmiq*liipmvvqs

  15. Dicty_cDB: Contig-U14348-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 94 3e-18 AC124968_9( AC124968 |pid:none) Med... 5e-17 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kinase-c... 90 5e-17 AE014298_1862( AE01429...08048_1( AY708048 |pid:none) Zea mays salt-inducible putative p... 90 5e-17 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda

  16. Dicty_cDB: Contig-U14112-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Oryza sativa Japonica Group genom... 77 8e-14 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda protein kin..._1( FJ787369 |pid:none) Nicotiana repanda protein kinase-c... 79 1e-13 AC004260_13( AC004260 |pid:none) Arab...8... 72 2e-12 FJ787371_1( FJ787371 |pid:none) Nicotiana repanda protein kinase-c... 75 2e-12 FB875947_1( FB8

  17. Dicty_cDB: Contig-U11213-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6105 |pid:none) Picea sitchensis clone WS0278_P15 ... 54 2e-05 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda...909 |pid:none) Synthetic construct DNA, clone: pF... 54 2e-05 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda

  18. Dicty_cDB: Contig-U13035-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntis NADH dehydrogenase subunit 1 (ND1... 46 0.37 1 ( AJ505593 ) Alcis repandata mitochondrion 16S rRNA gene... (part... 46 0.37 1 ( AJ438725 ) Alcis repandata mitochondrion nd1 gene (partial),... 46 0.37 1 ( AJ416938 ) Alcis repanda

  19. Dicty_cDB: Contig-U14908-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Oryza sativa (japonica cultivar... 86 2e-15 FJ787361_1( FJ787361 |pid:none) Nicotiana repanda prote...|pid:none) Oryza sativa (japonica cultivar-gr... 84 8e-15 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda ...15 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda protein kinase-c... 84 8e-15 EU722820_1( EU722820 |pid:... 1e-14 AB016885_14( AB016885 |pid:none) Arabidopsis thaliana genomic DNA,... 83 1e-14 FJ787371_1( FJ787371 |pid:none) Nicotiana repan...da protein kinase-c... 83 1e-14 A84518( A84518 ) probable receptor-like protein kin

  20. Dicty_cDB: Contig-U12922-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-11 2 ( EA053492 ) Sequence 221 from patent US 7157621. 62 2e-11 4 ( DY329960 ) OB_MEa0004O04.r OB_MEa Ocimum basil...hql*mvfiknfkkkkkkkk Frame B: llaywxyyyyskyifvyt*niyk*fllvvnfv*lisivsnf*nnkekkngxk...CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 70 2e-10 (A4JHJ8) RecName...... 56 4e-06 CP000852_1193( CP000852 |pid:none) Caldivirga maquilingensis IC-16... 55 5e-06 ...cc*frfw**awklw*i fr*sk*rgys*icmhfnfignqks*f*tksiinwwwyc*fy*cgchfqryh*sn*rvs** yh*iksfhfr*krwsklsigfttyernws*ity

  1. Dicty_cDB: Contig-U15678-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nating seedlings, TAMU Sola... 52 6e-10 3 ( DY336852 ) OB_SEa04P11.r OB_SEa Ocimum basil...efly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end simi...qyiyiffiyiffffpklyif*kiilhpstqkkkkkkkkniisqhtv fcisi*ssp*nyffykkkik*ivfvfvliivifffpllnk*kkksffffliiyivi...qmyqphfkciliqaqtlte*lveqvmiqitf*lilq *rvklsiveplkfsinslinvlilvstlqvnkmqiplvevlkmf*dpskvvhnnhhhkyq nhnhnnhhnh... ... 60 5e-14 4 ( GE464933 ) 294762759 Nasonia vitripennis Adult Female Nasoni... 70 5e-14 2 ( BU819448 ) UA43BPG03 Populus trem

  2. Dicty_cDB: Contig-U05246-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ; Sh... 54 2e-06 AY082612_1( AY082612 |pid:none) Ocimum basilicum p-coumaroyl shiki... 54 2e-06 AM465802_1( AM465802 |pid:none) Vit... 1e-05 T03275( T03275 ) probable cytochrome P450, hypersensitivity-relate... 51 1e-05 AY056284_1( AY056284 |pid:none) Arabidopsis...one) Bos taurus cytochrome P450, family... 55 1e-06 DQ667171_1( DQ667171 |pid:none) Artemisia annua P450 mon...) RecName: Full=Cytochrome P450 2B1; EC=1.14.14.... 52 9e-06 DQ453967_1( DQ453967 |pid:none) Artemisia annua...16 |pid:none) Danio rerio cytochrome P450, famil... 52 9e-06 DQ315671_1( DQ315671 |pid:none) Artemisi

  3. Dicty_cDB: Contig-U15883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi

  4. Dicty_cDB: Contig-U15609-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available H641784 ) CHO_OF4972xp21r1.ab1 CHO_OF4 Nicotiana tabacum ge... 54 0.002 2 ( DY336731 ) OB_SEa04L12.r OB_SEa Ocimum basil...nt WO2007093776. 38 0.029 3 ( DQ508732 ) Perkinsus marinus delta9-elongating activity prot... 38 0.029 3 ( D...Y036171 ) CAIY2568.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.33 2 ( AW6512...9 2 ( EY042621 ) CAIY6316.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.39 2 ( EH069644 ) PMDAD81TO Perki...nsus marinus small insert cDNA lib... 38 0.41 2 ( EY042620 ) CAIY6316.rev CAIY Artemisia annua leaf Artemi

  5. Dicty_cDB: Contig-U12032-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iviii*fyn*kkdqk ielvvllicivil*gdnnkl*iinyk**iinnnnk*yyi*kikf*k*ikk Frame C: lin**...l *lksil*tqi*knntlnwvvywvkv*cf*ihqpidnvkp*pyqsienlvplknvaksvvi lmncyiiyiilivvvpiilv*nvqskk*plis*iifkdlgqitsl

  6. Dicty_cDB: Contig-U03612-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 71 ) CCUA7192.g1 CCUA Peromyscus polionotus subgrisieu... 44 5.2 1 ( GH460959 ) C...CUA3377.g1 CCUA Peromyscus polionotus subgrisieu... 44 5.2 1 ( GH459069 ) CCUA2347.g1 CCUA Peromyscus polion

  7. Dicty_cDB: Contig-U04628-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 'e... 44 3.5 1 ( BB649149 ) Mus musculus 16 days embryo head cDNA, RIKEN full... 44 3.5 1 ( GH465909 ) CCUA5...860.b1 CCUA Peromyscus polionotus subgrisieu... 44 3.5 1 ( FG170345 ) AGN_RNC002x

  8. Dicty_cDB: Contig-U16480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 64 2e-08 AF021822_1( AF021822 |pid:none) Scaptodrosophila lebanonensis supe... 64 2e-08 DQ088819_1( DQ08881...ocheilonema viteae mRNA for ... 59 5e-07 AF021824_1( AF021824 |pid:none) Hirtodrosophila pictiventris super.

  9. Dicty_cDB: Contig-U04005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available G898233 ) pastbac066xb17.b1.ab1 Res147 1 Pasteuria penetran... 48 0.86 1 ( CG897330 ) pastbac049xe11.b1.ab1 Res147 1 Pasteuria... penetran... 48 0.86 1 ( CG896500 ) pastbac026xc21.b1.ab1 Res147 1 Pasteuria

  10. Dicty_cDB: Contig-U03456-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2xh16.g6 T. reesei HindIII BAC library Hypo... 44 2.5 1 ( CG898233 ) pastbac066xb17.b1.ab1 Res147 1 Pasteuria... penetran... 44 2.5 1 ( CG897330 ) pastbac049xe11.b1.ab1 Res147 1 Pasteuria penetran... 44 2.5 1 ( CG896500... ) pastbac026xc21.b1.ab1 Res147 1 Pasteuria penetran... 44 2.5 1 ( EL572858 ) Phy

  11. Dicty_cDB: Contig-U08397-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6 |pid:none) Polaromonas sp. JS666, complete... 43 1e-06 U40031_3( U40031 |pid:none) Reithrodontomys megalot...ogena... 53 1e-06 U83832_3( U83832 |pid:none) Reithrodontomys fulvescens NADH dehydr... 52 1e-06 U83822_3( U...83822 |pid:none) Sigmodon ochrognathus NADH dehydrogena... 51 1e-06 U83831_3( U83831 |pid:none) Reithrodon...tomys megalotis NADH dehydro... 52 1e-06 AP009385_2172( AP009385 |pid:none) Burkhol

  12. Dicty_cDB: Contig-U16202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 31F6, WO... 42 0.19 6 ( DQ504303 ) Amia calva parahox gene cluster, complete sequence. 46 0.20 3 ( CO378266 ) Lr_CHECF_25G09_M13R Ear...thworm Head Enriched libra... 46 0.22 2 ( FD758872 ) Afi

  13. Dicty_cDB: Contig-U15480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available O048247 ) Lr_PAHCF_71H01_SKplus Earthworm Fluorantene Expos... 46 2e-04 2 ( BU328244 ) 603494622F1 CSEQCHN64...le, Le... 42 0.030 2 ( DR697195 ) Lr_AT1CF_37E11_SKplus Earthworm Atrazine Exposure... 38 0.033 2 ( AM398681

  14. Dicty_cDB: Contig-U12974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 7.1 1 ( DR697196 ) Lr_AT1CF_38E04_SKplus Earthworm Atrazine Exposure... 44 7.1 1 ( DR009256 ) Lr_Cu2CF_32B07 Earth...worm Copper Exposure Library ... 44 7.1 1 ( DR008956 ) Lr_Cu2CF_11A10 Earth

  15. Dicty_cDB: Contig-U15786-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( CI997489 ) Marsupenaeus japonicus cDNA, clone:YAQ01A01NGRM00... 48 1.0 1 ( CF799486 ) Lr_PAHCF_20E09_M13R Earth...worm Fluorantene Exposur... 48 1.0 1 ( CF799089 ) Lr_PAHCF_14B09_M13R Earthworm Fluorantene Exposur.

  16. Dicty_cDB: Contig-U00886-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone XX-231B7, co... 44 8.7 1 ( FJ393927 ) Schistocerca cancellata isolate C2J 12S ribosomal... 44 8.7 1 ( ...FJ393926 ) Schistocerca cancellata isolate C1J 12S ribosomal... 44 8.7 1 ( CP000372 ) Drosophila melanogaste

  17. Dicty_cDB: Contig-U16181-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s taurus Y Chr NOVECTOR CH240-507F20 (Children'... 48 0.79 1 ( AC232941 ) Bos taurus Y Chr NOVECTOR CH240-255J15 (Children...'... 48 0.79 1 ( AC232940 ) Bos taurus Y Chr NOVECTOR CH240-62I11 (Children's... 48 0.79 1 ( A...C232929 ) Bos taurus Y Chr NOVECTOR CH240-291F15 (Children'... 48 0.79 1 ( AC232768 ) Bos taurus Y Chr NOVECTOR CH240-460C15 (Childre...n'... 48 0.79 1 ( AC232755 ) Bos taurus Y Chr NOVECTOR CH240-409J7 (Children...'s... 48 0.79 1 ( AC232753 ) Bos taurus Y Chr NOVECTOR CH240-45P20 (Children's... 48 0.7

  18. Dicty_cDB: Contig-U16505-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ino Acid sequence tvtseetrswsqtlnegsyivyqnvlvyayiiyggsykhkpyidqmnkfnpglnikffre dkciffvpinrddaftlryqdntwdpvey...yggsykhkpyidqmnkfnpglnikffre dkciffvpinrddaftlryqdntwdpveydvlidylgqnqdkwfsgglp*k*

  19. Dicty_cDB: Contig-U14298-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um botulinum Ba4 str. 6... 34 7.0 AF078128_1( AF078128 |pid:none) Plasmodium knowlesi from Malaysia ... 34 7...ne) Plasmodium knowlesi from Malaysia ... 34 7.0 AL844508_86( AL844508 |pid:none)

  20. Dicty_cDB: Contig-U14523-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 110 8e-23 (Q803I8) RecName: Full=E3 ubiquitin-protein ligase synoviolin; ... 109 2e-22 BC044465_1( BC044... (Q5XHH7) RecName: Full=E3 ubiquitin-protein ligase synoviolin-B;... 100 1e-19 AB058713_1( AB058713 |pid:non

  1. Dicty_cDB: Contig-U08887-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 FN317772_1( FN317772 |pid:none) Schistosoma japonicum isolate Anhu... 72 6e-11 X98769_1( X98769 |pid:none) Megaselia scala...ris mRNA for Sex-lethal... 71 1e-10 AJ000546_1( AJ000546 |pid:none) Megaselia scala...a cruzi RNA-binding prot... 67 2e-09 AF110846_1( AF110846 |pid:none) Megaselia scalaris sex-lethal homo... 6

  2. Dicty_cDB: Contig-U12039-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 |pid:none) Mougeotia scalaris neochrome gene,... 101 7e-20 AB206962_1( AB206962 |pid:none) Mougeotia scala...AB206961_1( AB206961 |pid:none) Mougeotia scalaris NEO1 mRNA for n... 97 2e-18 ( ...01 7e-20 AY813860_1( AY813860 |pid:none) Schistosoma japonicum SJCHGC06050 ... 101 7e-20 AY878549_1( AY87854

  3. Dicty_cDB: Contig-U13351-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BC046045_1( BC046045 |pid:none) Danio rerio splicing factor, argin... 36 3.1 AJ000546_1( AJ000546 |pid:none) Megaselia scala..._1( X98769 |pid:none) Megaselia scalaris mRNA for Sex-lethal... 35 4.1 AY814302_1( AY814302 |pid:none) Schis

  4. Dicty_cDB: Contig-U11436-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ryptococcus neoformans var. neo... 119 3e-25 AY878549_1( AY878549 |pid:none) Mougeotia scala...ris neochrome gene,... 118 4e-25 AB206962_1( AB206962 |pid:none) Mougeotia scalaris NEO2 mRNA for...9836_1( D49836 |pid:none) Rat mRNA for RAC protein kinase gamma,... 101 5e-20 AB206961_1( AB206961 |pid:none) Mougeotia scala

  5. Dicty_cDB: Contig-U06538-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 0.090 2 ( DJ207695 ) Method for identification of useful proteins deri... 38 0.090 2 ( BD343987 ) Method of monitoring... gene expression. 38 0.090 2 ( BD341931 ) Method of monitoring gene

  6. Dicty_cDB: Contig-U16226-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VSF150F ,597,1057 est13= VFL352Z ,630,982 est14= VSI215Z ,1142,1286 Translated Amino Acid sequence claywyff...kkdnkk kkkkkkkkkkkkkkkkkkkk--- ---xsxkl*txxklxelqxxsxtkxx*fynktgtxnvyxxsxpixaptkkt Frame C: claywyffs*s*ktkk

  7. Dicty_cDB: Contig-U16006-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne 01 Psig64s-55C regio... 50 0.22 1 ( EU648429 ) Psiguria umbrosa clone 05 Psig6...4s-55C region geno... 50 0.22 1 ( EU648428 ) Psiguria umbrosa clone 04 Psig64s-55C region geno... 50 0.22 1 ( EU648427 ) Psiguri...a umbrosa clone 03 Psig64s-55C region geno... 50 0.22 1 ( EU648426 ) Psiguria umbrosa cl...one 02 Psig64s-55C region geno... 50 0.22 1 ( EU648425 ) Psiguria umbrosa clone 0...1 Psig64s-55C region geno... 50 0.22 1 ( EU648423 ) Psiguria pedata clone 07 Psig64s-55C region genom... 50

  8. Dicty_cDB: Contig-U04426-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MMBB... 32 2.9 5 ( AC174151 ) Homo sapiens chromosome 4 clone WI2-1953O14, comp... 42 2.9 2 ( CD147127 ) ML1...1-734E9, WORKI... 42 2.8 3 ( CC262481 ) CH261-167M9_Sp6.1 CH261 Gallus gallus gen...omic clo... 32 2.8 3 ( CD147117 ) ML1-0002T-M115-B10-U.G ML1-0002 Schistosoma manso... 38 2.8 2 ( BX842699 )

  9. Dicty_cDB: Contig-U10389-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available oxylase-lik... 46 2e-05 2 ( BI742499 ) kt51f12.y4 Strongyloides ratti L1 pAMP1 v3 Chiape... 48 4e-05 2 ( CD147...0014 Schistosoma manso... 46 4e-05 3 ( CD147604 ) ML1-0007T-V110-D04-U.B ML1-0007 Schistosoma manso... 46 4e

  10. Dicty_cDB: Contig-U15201-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-04 2 ( EX698640 ) GF_AW109651c08 AW1 Schistosoma mansoni cDNA clone... 44 2e-04 2 ( CD147...-0107T-L395-E12-U.B MG1-0107 Schistosoma manso... 44 2e-04 2 ( CD147233 ) ML1-0002T-M131-E11-U.G ML1-0002 Sc

  11. Dicty_cDB: Contig-U04058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 09 |pid:none) Gossypium thurberi ubiquitin-conju... 130 2e-29 CP000585_249( CP000585 |pid:none) Ostreococcus...83533.... 130 2e-29 (Q9SLE4) RecName: Full=Ubiquitin carrier protein E2 29; ... 130 2e-29 AY082009_1( AY0820

  12. Dicty_cDB: Contig-U11840-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AJ304826 |pid:none) Vombatus ursinus complete mitochon... 278 1e-72 AY083457_1(... AY083457 |pid:none) Roboastra europaea mitochondrion, ... 278 1e-72 EU877953_2( EU877953 |pid:none) Tetraph

  13. Dicty_cDB: Contig-U11784-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Y844113_1( AY844113 |pid:none) Hypsiboas sp. CWM 19512 tyrosinase... 40 0.19 EF364207_1( EF364207 |pid:none)...re... 40 0.24 AY844112_1( AY844112 |pid:none) Hypsiboas nympha tyrosinase precur... 40 0.24 AY844148_1( AY84... Natalobatrachus bonebergi isolate ... 40 0.24 AY844081_1( AY844081 |pid:none) Hypsiboas...ensis tyrosine... 39 0.41 AY844110_1( AY844110 |pid:none) Hypsiboas sibleszi tyrosinase prec... 39 0.41 DQ28...aradrahyla nephila tyrosinase pr... 39 0.41 AY844057_1( AY844057 |pid:none) Hypsiboas

  14. Dicty_cDB: Contig-U00877-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1027.fwd CAFU Pichia stipitis oxygen limited ... 34 5.7 2 ( FE846674 ) CAFI859.fwd CAFI Pichia stipitis aerobic dextrose...46890 ) CAFI972.fwd CAFI Pichia stipitis aerobic dextrose... 34 5.8 2 ( EB808360 ) 3490_H19 Botrytis cinerea

  15. Dicty_cDB: Contig-U00920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6392 ) CAFI710.fwd CAFI Pichia stipitis aerobic dextrose... 38 1.00 2 ( FE860511 ) CAFY671.fwd CAFY Pichia s...FE846118 ) CAFI560.fwd CAFI Pichia stipitis aerobic dextrose... 38 1.0 2 ( EY097831 ) CAZI23434.fwd CAZI Art

  16. Dicty_cDB: Contig-U14494-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 46 0.030 2 ( FE846409 ) CAFI720.rev CAFI Pichia stipitis aerobic dextrose... 46 0.032 2 ( FE846410 ) CAFI...720.fwd CAFI Pichia stipitis aerobic dextrose... 46 0.033 2 ( CP000497 ) Pichia stipitis CBS 6054 chromosome

  17. Dicty_cDB: Contig-U15717-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lla elegans pBluescript (E... 64 2e-48 8 ( FE845220 ) CAFH852.fwd CAFH Pichia stipitis aerobic dextrose... 8...CAFH Pichia stipitis aerobic dextrose... 80 3e-46 6 ( AL405454 ) T3 end of clone AU0AA004D09 of library AU0A...55 ) CAFO466.fwd CAFO Pichia stipitis aerobic xylose M... 66 1e-29 5 ( FE844991 ) CAFH726.fwd CAFH Pichia stipitis aerobic dextrose...61.fwd CAFH Pichia stipitis aerobic dextros... 66 2e-29 5 ( FE844747 ) CAFH587.fwd CAFH Pichia stipitis aerobic dextrose...... 66 2e-29 5 ( FE841858 ) CAFG433.fwd CAFG Pichia stipitis aerobic dextrose

  18. Dicty_cDB: Contig-U16482-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aerobic xylose ... 68 5e-07 1 ( FE846828 ) CAFI940.fwd CAFI Pichia stipitis aerobic dextrose...... 68 5e-07 1 ( FE846827 ) CAFI940.rev CAFI Pichia stipitis aerobic dextrose... 68 5e-07 1 ( FE8...46676 ) CAFI860.fwd CAFI Pichia stipitis aerobic dextrose... 68 5e-07 1 ( FE846675 ) CAFI860.rev CAFI Pichia stipitis aerobic dextros...e... 68 5e-07 1 ( FE846539 ) CAFI786.fwd CAFI Pichia stipitis aerobic dextrose... 6...8 5e-07 1 ( FE846521 ) CAFI777.fwd CAFI Pichia stipitis aerobic dextrose... 68 5e

  19. Dicty_cDB: Contig-U14349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 0.10 2 ( FE846078 ) CAFI539.rev CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( FE846079 ) CAFI539.f...wd CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( AC176598 ) Strongylocentrotus purpuratus clone R3-30

  20. Dicty_cDB: Contig-U15493-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rongyloides ratti L2 SL1 TOPO v2 Str... 100 3e-33 2 ( FE846057 ) CAFI528.fwd CAFI Pichia stipitis aerobic dextrose..... 62 2e-32 6 ( FE846193 ) CAFI603.fwd CAFI Pichia stipitis aerobic dextrose... 62 2e-32 6 ( GE907061 ) 9545...erobic dextros... 62 3e-32 6 ( FE846897 ) CAFI976.rev CAFI Pichia stipitis aerobic dextrose... 62 3e-32 6 ( ...Pichia stipitis aerobic dextrose... 62 4e-33 7 ( FG074107 ) UI-FF-IF0-abh-b-20-0-...Pichia stipitis aerobic dextrose... 62 3e-32 6 ( EE006326 ) ROE00003876 Rhizopus oryzae Company Rhizopus ory

  1. Dicty_cDB: Contig-U16447-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pitis CBS 6054 chromosome 3, complete s... 34 0.002 3 ( FE845068 ) CAFH771.fwd CAFH Pichia stipitis aerobic dextrose..... 34 0.004 3 ( FE845067 ) CAFH771.rev CAFH Pichia stipitis aerobic dextrose... 3

  2. Dicty_cDB: Contig-U15484-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FI687.fwd CAFI Pichia stipitis aerobic dextrose... 78 2e-12 2 ( FE846349 ) CAFI687.rev CAFI Pichia stipitis aerobic dextrose...IH_MGC_172 Homo sapiens cDNA ... 46 2e-12 4 ( FE846884 ) CAFI969.fwd CAFI Pichia stipitis aerobic dextrose..... CAFI Pichia stipitis aerobic dextrose... 74 2e-11 2 ( CD390130 ) AGENCOURT_14339

  3. Dicty_cDB: Contig-U11442-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 8 2 ( FE844906 ) CAFH679.rev CAFH Pichia stipitis aerobic dextrose... 32 9.8 2 ( FE857272 ) CAFW1111.rev CAF...... 34 9.8 2 ( FE846369 ) CAFI697.rev CAFI Pichia stipitis aerobic dextrose... 32 9.8 2 ( FE856098 ) CAFU451

  4. Dicty_cDB: Contig-U16175-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se ... 76 4e-09 1 ( FE846729 ) CAFI888.fwd CAFI Pichia stipitis aerobic dextrose... 76 4e-09 1 ( FE846728 ) ...CAFI888.rev CAFI Pichia stipitis aerobic dextrose... 76 4e-09 1 ( FE846485 ) CAFI759.fwd CAFI Pichia stipitis aerobic dextrose...... 76 4e-09 1 ( FE846484 ) CAFI759.rev CAFI Pichia stipitis aerobic dextrose...... 76 4e-09 1 ( FE845925 ) CAFI458.fwd CAFI Pichia stipitis aerobic dextrose... 76 4e-09 1 ( ...FE845924 ) CAFI458.rev CAFI Pichia stipitis aerobic dextrose... 76 4e-09 1 ( FE845522 ) CAFI1010.fwd CAFI Pi

  5. Dicty_cDB: Contig-U16270-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( FE846071 ) CAFI535.fwd CAFI Pichia stipitis aerobic dextrose... 60 1e-04 1 ( ...FE846070 ) CAFI535.rev CAFI Pichia stipitis aerobic dextrose... 60 1e-04 1 ( CR382131 ) Yarrowia lipolytica

  6. Dicty_cDB: Contig-U15461-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available useful proteins deri... 48 6e-10 4 ( FE846476 ) CAFI755.rev CAFI Pichia stipitis aerobic dextrose... 42 1e-...is aerobic dextros... 42 3e-06 3 ( FE846494 ) CAFI764.rev CAFI Pichia stipitis aerobic dextrose... 42 3e-06 .... 42 3e-06 3 ( FE846495 ) CAFI764.fwd CAFI Pichia stipitis aerobic dextrose... 42 3e-06 3 ( FE856826 ) CAFU8...c xylose ... 42 3e-06 3 ( FE846477 ) CAFI755.fwd CAFI Pichia stipitis aerobic dextrose... 42 3e-06 3 ( FF325... 2 ( FE845880 ) CAFI436.rev CAFI Pichia stipitis aerobic dextrose... 42 0.001 2 ( FE852837 ) CAFP2452.fwd CA

  7. Dicty_cDB: Contig-U16276-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a... 40 3.5 2 ( FE846223 ) CAFI620.rev CAFI Pichia stipitis aerobic dextrose... 4...d CAGN Nematostella vectensis Nemve m... 40 3.5 2 ( FE846046 ) CAFI523.rev CAFI Pichia stipitis aerobic dextrose...gen limited x... 44 3.7 2 ( FE846047 ) CAFI523.fwd CAFI Pichia stipitis aerobic dextrose... 44 3.7 2 ( FE855...845941 ) CAFI467.rev CAFI Pichia stipitis aerobic dextrose... 44 3.7 2 ( FE851411 ) CAFP1701.rev CAFP Pichia... stipitis aerobic xylose ... 44 3.8 2 ( FE846903 ) CAFI979.rev CAFI Pichia stipitis aerobic dextrose

  8. Dicty_cDB: Contig-U15453-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available obic xylose ... 46 6e-14 4 ( FE846587 ) CAFI812.fwd CAFI Pichia stipitis aerobic dextrose... 46 6e-14 4 ( FE...CAFI996.rev CAFI Pichia stipitis aerobic dextrose... 46 7e-14 4 ( FE852631 ) CAFP...3014 ) CAFP2544.fwd CAFP Pichia stipitis aerobic xylose ... 46 7e-14 4 ( FE846134 ) CAFI568.fwd CAFI Pichia stipitis aerobic dextrose...937 ) CAFI996.fwd CAFI Pichia stipitis aerobic dextrose... 46 9e-13 4 ( BJ346855 ...e-09 3 ( FE842517 ) CAFG826.rev CAFG Pichia stipitis aerobic dextrose... 46 2e-09 3 ( FE851504 ) CAFP1749.re

  9. Dicty_cDB: Contig-U15992-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .9 2 ( FE842793 ) CAFG988.fwd CAFG Pichia stipitis aerobic dextrose... 32 1.9 2 (...G Pichia stipitis aerobic dextrose... 32 1.9 2 ( FE858139 ) CAFW952.fwd CAFW Pichia stipitis oxygen limited ...x... 32 1.9 2 ( FE841961 ) CAFG496.fwd CAFG Pichia stipitis aerobic dextrose... 32 1.9 2 ( FE841838 ) CAFG42...2.fwd CAFG Pichia stipitis aerobic dextrose... 32 1.9 2 ( FE847546 ) CAFN749.fwd ...gen limited x... 32 1.9 2 ( FE842065 ) CAFG560.fwd CAFG Pichia stipitis aerobic dextrose... 32 1.9 2 ( CO090

  10. Dicty_cDB: Contig-U15212-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available I Pichia stipitis aerobic dextrose... 46 3e-04 2 ( FE846176 ) CAFI593.rev CAFI Pichia stipitis aerobic dextrose...529.fwd CAFI Pichia stipitis aerobic dextrose... 46 3e-04 2 ( FE851967 ) CAFP1996.rev CAFP Pichia stipitis a

  11. Dicty_cDB: Contig-U15113-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rev CAFH Pichia stipitis aerobic dextrose... 86 7e-25 4 ( FE856969 ) CAFU914.fwd CAFU Pichia stipitis oxygen...hia stipitis aerobic xylose ... 86 8e-25 4 ( FE846404 ) CAFI716.fwd CAFI Pichia stipitis aerobic dextrose...... 86 8e-25 4 ( FE844479 ) CAFH437.fwd CAFH Pichia stipitis aerobic dextrose... 86 8e-25 4 ( EC762481 ) PSE000...trose... 86 6e-25 4 ( FE851519 ) CAFP1757.fwd CAFP Pichi... FE856968 ) CAFU914.rev CAFU Pichia stipitis oxygen limited d... 86 6e-25 4 ( FE846403 ) CAFI716.rev CAFI Pichia stipitis aerobic dex

  12. Dicty_cDB: Contig-U16149-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available se ... 42 6e-05 4 ( FE846919 ) CAFI987.rev CAFI Pichia stipitis aerobic dextrose... 42 7e-05 4 ( FE859704 ) ...CAFY1016.rev CAFY Pichia stipitis oxygen limited ... 42 7e-05 4 ( FE846736 ) CAFI892.rev CAFI Pichia stipitis aerobic dextrose... stipitis oxygen limited ... 42 7e-05 4 ( FE846737 ) CAFI892.fwd CAFI Pichia stipitis aerobic dextrose... 42...AFY Pichia stipitis oxygen limited x... 42 7e-05 4 ( FE845859 ) CAFI425.fwd CAFI Pichia stipitis aerobic dextrose...... 42 7e-05 4 ( FE845858 ) CAFI425.rev CAFI Pichia stipitis aerobic dextrose... 42 8e-05 4 ( FE852579

  13. Dicty_cDB: Contig-U05773-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AB100044 ) Papilio polytes mitochondrial ND5 gene for NADH d... 48 0.20 1 ( AB095666 ) Papilio machao.... 48 0.20 1 ( AB013150 ) Papilio machaon mitochondrial ND5 gene for NADH d... 48 0.20 1 ( AB013147 ) Graphiu

  14. Dicty_cDB: Contig-U01742-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uences producing significant alignments: (bits) Value EU124719_11( EU124719 |pid:none) Friesea grisea mitoch...ondrion, com... 33 3.1 >EU124719_11( EU124719 |pid:none) Friesea grisea mitochondrion, complete genome. Leng

  15. Dicty_cDB: Contig-U16311-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hfkltihiytylynfiinkk*yeni*nlfinkfymink*kifviykn* fsfnk Frame C: fskhykrrifflffsiiqifinifqnkyiyklkmkvlsalcvll...vsvatakqqlseveyr naftnwmiahqrhysseefngrynifkanmdyvnewntkgsetvlglnvfadisneeyra tylgtpfdasslemtesdkifdasaqvdwr

  16. Dicty_cDB: Contig-U16217-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ometrium gilt D6 of estrou... 38 2.3 2 ( BX322617 ) Zebrafish DNA sequence from clo...93A2 in l... 44 2.3 7 ( CT349010 ) Sus scrofa genomic clone CH242-333G11, genomic su... 38 2.3 2 ( CO992400 ) UMC-pd6end2-001-e11 End

  17. Dicty_cDB: Contig-U10340-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MCC Neurons Aplysi... 34 0.54 2 ( CO993311 ) UMC-pd6end2-014-g08 Endometrium gilt D6 of estrou... 34 0.54 2... ( CO987161 ) UMC-pd10en3-012-f02 Endometrium gilt D10 of estro... 34 0.54 2 ( CO987823 ) UMC-pd10en3-021-c11 Endometr...ium gilt D10 of estro... 34 0.54 2 ( CO992701 ) UMC-pd6end2-006-b04 Endometr

  18. Dicty_cDB: Contig-U15920-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t... 44 10.0 1 ( EU019869 ) Aphis gossypii from Hibiscus elongation factor 1 ... ...44 10.0 1 ( EU019868 ) Aphis gossypii from Hibiscus mutabilis elongation... 44 10.0 1 ( EF660855 ) Myzus per

  19. Dicty_cDB: Contig-U16566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _GS-35-01-01-1... 64 3e-27 3 ( EJ044277 ) 1095454111632 Global-Ocean-Sampling_GS-...male Pupae Nasoni... 105 8e-21 2 ( EJ805472 ) 1093017455782 Global-Ocean-Sampling_GS-30-02-01-1... 68 8e-21 3 ( EK141129 ) 1095454111

  20. Dicty_cDB: Contig-U15891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ylelikqtgrlenalgwyhshpgygcwlsgidvgtqsvnqqy sepwlgividptrtvsagkveigafrtypqgykppnegpseyqsiplskiedfgvhck*y ysle...kisaiallkmvmharsggklevmgmlmgkvenntmiimdsfalpve gtetrvnaqveayeymveylelikqtgrlenalgwyhshpgygcwlsgidvgtqsvnqqy sepwlgividptrtvsagkveiga

  1. Dicty_cDB: Contig-U15603-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available btracted libraries from oysters exposed ... 36 0.90 3 ( CP000399 ) Borrelia afzelii PKo plasmid lp32, comple...yostelium discoideum kinesin family member 12... 36 0.90 4 ( EE677780 ) EST641 su

  2. Dicty_cDB: Contig-U16137-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5_CCNN1457_b1 Cowpea IT84S-2049 Mixed Tissu... 58 1e-08 3 ( DQ324264 ) Moraxella oslo...civorans... 235 3e-60 DQ324264_1( DQ324264 |pid:none) Moraxella osloensis acetyl-CoA car... 181 5e-60 CP0002

  3. Dicty_cDB: Contig-U15913-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EEEQQQN--- ---XXGXXXLISLKNLSXXDFSSGSLKTXNGP*xsgfgxxlkxlissdxisrftik*pcl sxi*xiiiiesiexxgnfkgxlvvsisyaxxfgsgx...te--- ---XXGXXXLISLKNLSXXDFSSGSLKTXNGP*xsgfgxxlkxlissdxisrftik*pcl sxi*xiiiiesiexxgnfkgxlvvsisyaxxfgsgxstrvv

  4. Dicty_cDB: Contig-U11617-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A... 91 9e-37 AB097421_1( AB097421 |pid:none) Umbelopsis ramanniana RPB1 gene fo... 115 2e-36 DQ294591_1( DQ...erii RNA polymera... 94 1e-35 DQ294598_1( DQ294598 |pid:none) Umbelopsis ramannia

  5. Dicty_cDB: Contig-U11764-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4600_1( DQ294600 |pid:none) Boothiomyces macroporosum isolate ... 377 e-103 AB097421_1( AB097421 |pid:none) Umbelopsis raman...te AF... 377 e-102 DQ294598_1( DQ294598 |pid:none) Umbelopsis ramanniana isolate AFTO... 377 e-102 CP000590_

  6. Dicty_cDB: Contig-U10467-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N ( BJ433957 ) Dictyostelium discoideum cDNA clone:ddv23p10, 3' ... 1084 0.0 2 ( EU868611 ) Human enterovirus...73 ) Xenopus tropicalis cDNA clone MGC:172876 IMAGE:76... 44 7.1 1 ( EF063152 ) Human enterovirus... 71 strain E2005125-TW polyprote... 44 7.1 1 ( DQ868521 ) Human enterovirus 71 isolate E2006...249-TW VP1 stru... 44 7.1 1 ( DQ846663 ) Human enterovirus 71 isolate NTU1551-TW-06 VP1 st... 44 7.1 1 ( DQ846662 ) Human enterovirus... 71 isolate NTU1482-TW-06 VP1 st... 44 7.1 1 ( DQ841970 ) Human enterovirus 71 isol

  7. Dicty_cDB: Contig-U14689-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-137 ( P68541 ) RecName: Full=ATP synthase subunit alpha, mitochondrial... 489 e-137 EU281005_1( EU281005 |pid:none) Hydnora...7705 |pid:none) Orontium aquaticum ATPase alpha su... 486 e-136 AF503356_1( AF503356 |pid:none) Hydnora

  8. Dicty_cDB: Contig-U10738-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-69 DQ782871_1( DQ782871 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 248 1e-69 AY803750_1( AY803750 |...... 258 3e-67 AY485622_1( AY485622 |pid:none) Dibaeis baeomyces DNA-dependent RN... 241 3e-67 AY641049_1( AY641049 |pid:none) Lecanor

  9. Dicty_cDB: Contig-U03781-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 135 3e-31 EF421063_1( EF421063 |pid:none) Lyophyllum ambustum strain CBS452.... 135 3e-31 DQ782901_1( D...Q782901 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 135 3e-31 DQ782892_1( DQ782892 |pid:none) Physcia a

  10. Dicty_cDB: Contig-U11863-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aea NRR... 90 2e-16 FJ227583_1( FJ227583 |pid:none) Lecanora sp. BCC 12113 isolate F1R... 90 2e-16 CP001506_...89 4e-16 FJ227582_1( FJ227582 |pid:none) Lecanora sp. BCC 12113 isolate F1R... 89

  11. Dicty_cDB: Contig-U13747-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Simonyella variegata isolate AFTOL... 146 5e-34 DQ986817_1( DQ986817 |pid:none) Lecanora...chinus voucher TSJ... 141 1e-32 DQ782829_1( DQ782829 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 141 1e...DQ447888_1( DQ447888 |pid:none) Cheimonophyllum candidissimum isol... 140 3e-32 EF105431_1( EF105431 |pid:none) Lecanora...2_1( EF105432 |pid:none) Lecanora sulphurea RNA polymerase ... 136 6e-31 AF389538_1( AF389538 |pid:none) Ino

  12. Dicty_cDB: Contig-U13129-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AF435785 |pid:none) Pleurocera walkeri UAG592 cytochro... 338 8e-91 EU106528_1( EU106528 |pid:none) Pleuro...mitochondrio... 337 1e-90 EU106549_1( EU106549 |pid:none) Pleurocera walkeri isolate JS0116A... 337 1e-90 AJ

  13. Dicty_cDB: Contig-U15693-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ixed Tissue and... 111 1e-19 1 ( AZ917266 ) 4911.fd64h15.x1 Saccharomyces bayanus MCYC 623-6C... 100 3e-19 2 ( EF650282 ) Diogm...EF650282_1( EF650282 |pid:none) Diogmites grossus alanyl-tRNA synt... 273 1e-71 (B1IJG7) RecName: Full=Alany

  14. Dicty_cDB: Contig-U12025-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available elated... 115 5e-24 AF292095_1( AF292095 |pid:none) Xenopus laevis imitation swit...-08 3 ( AX683150 ) Sequence 124 from Patent EP1279744. 42 9e-08 3 ( L27127 ) Drosophila melanogaster imita...tion-SWI protein (ISWI... 42 9e-08 3 ( AY094908 ) Drosophila melanogaster RH13158 f

  15. Dicty_cDB: Contig-U12133-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mplicated in... 40 1.0 2 ( AX683150 ) Sequence 124 from Patent EP1279744. 40 1.0 2 ( L27127 ) Drosophila melanogaster imitation...none) Trypanosoma brucei chromosome 2 cl... 122 5e-30 AF292095_1( AF292095 |pid:none) Xenopus laevis imitation

  16. Dicty_cDB: Contig-U15239-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *hkfqstmdlqwvvvlvcqytansewpqriqysqcqrpasvsfatsva ptssqdcqitmaci*hspaan*rvtmft*palplislam...hl*lnvwkwnsvslnislrhrfllrrrvaptssqdcqitmac i*hspaan*rvtmft*palplislamsifklwkrr*rnariqppkpsipsspstmtslnp hpmn

  17. Dicty_cDB: Contig-U15499-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ius ervi isolate NYG2 cytochrome oxidase sub... 40 9.8 2 ( AY427909 ) Aphidius ervi isolate Morocco...ochro... 40 9.9 2 ( AY262773 ) Aphidius ervi clone Morocco2 mitochondrial cytoch... 40 9.9 2 ( AY262772 ) Ap

  18. Dicty_cDB: Contig-U04919-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available b... 44 3.3 1 ( AY427910 ) Aphidius ervi isolate NYG2 cytochrome oxidase sub... 44 3.3 1 ( AY427909 ) Aphidius ervi isolate Morocco...us ervi clone Japan2 mitochondrial cytochro... 44 3.3 1 ( AY262773 ) Aphidius ervi clone Morocco

  19. Dicty_cDB: Contig-U12284-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nogaster LD14594 fu... 185 3e-45 AF107797_1( AF107797 |pid:none) Capronia mansonii DNA-dependent RN... 185 3...1( AF107798 |pid:none) Capronia pilosella DNA-dependent R... 120 9e-26 AJ634168_1( AJ634168 |pid:none) Silen..._1( AY699223 |pid:none) Musa velutina RNA polymerase II se... 120 9e-26 AF107798_

  20. Dicty_cDB: Contig-U13501-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 054061 ) Phrynocephalus przewalskii isolate RM3939 NADH de... 44 1.7 1 ( AY054060 ) Phrynocephalus przewal...skii isolate 0790 NADH dehy... 44 1.7 1 ( AY054059 ) Phrynocephalus przewalskii iso

  1. Dicty_cDB: Contig-U15476-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uropathic Pain. 70 7e-10 2 ( DL002422 ) Methods for Molecular Toxicology Modeling. 70 7e-10 2 ( DJ019585 ) M...ology Modeling. 70 7e-10 2 ( DD041463 ) Molecular Toxicology Modeling. 70 7e-10 2 (...e Toxicity Modeling. 70 7e-10 2 ( DD270805 ) Molecular Hepatotoxicology Modeling. 70 7e-10 2 ( DD193888 ) Cardiotoxin Molecular Toxic

  2. Dicty_cDB: Contig-U00957-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 46 0.71 3 ( J04943 ) Rat nucleolar protein B23.2 mRNA, complete cds, clo... 46 0.75 2 ( DL486166 ) Molecular Toxicology... Modeling. 46 0.75 2 ( DL002044 ) Methods for Molecular Toxicology Modeling. 46 0.75 2 ( DJ019...atocyte toxicity modeling. 46 0.75 2 ( DD041343 ) Molecular Toxicology Modeling. 46 0.75 2 ( BD390609 ) Meth...( DL002041 ) Methods for Molecular Toxicology Modeling. 46 2.5 1 ( DJ019204 ) Molecular Nephrotoxicology Mod...ecular Hepatotoxicology Modeling. 46 2.5 1 ( DD193521 ) Cardiotoxin Molecular Toxicology

  3. Dicty_cDB: Contig-U11740-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cds. 46 3.0 1 ( AB016988 ) Mus musculus mRNA for Nibrin, complete cds. 46 3.0 1 ( DL001650 ) Methods for Molecular Toxicology...eling. 46 3.0 1 ( DD040769 ) Molecular Toxicology Modeling. 46 3.0 1 ( AX401127 ) Sequence 803 from Patent W

  4. Dicty_cDB: Contig-U16458-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ggpnfneipinrp vcpfannqrdgihrmtinkggasyfpnsidkgypllkepsankggfrpypenisgtksyd rsetfedhfsqatmfwnsmsqheknhiiaaytf...lc*qylgkh*fstr* kscqeswckd*tnfnpivagrifsyldtqlsrlggpnfneipinrpvcpfannqrdgihr mtinkggasyfpnsidkgypllkepsankggfrpypenis

  5. Dicty_cDB: Contig-U03475-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 Translated Amino Acid sequence ixxxxxxxhx*xgxlxpxdlxxxx*x*KXXXXLKXXXNXKLXXXXQXXPPKKXGIGFGXI NYXXKIIXNNNXXX...XXXXXXXXXNFXXMXNFXXXPQN*xxxpxxx* Translated Amino Acid sequence (All Frames) Frame A: yfxxx...kxxtxlgxxixsxgsxxxnxglkxxxxtexxixfxtxxpkxtxppqkxwnwxwxy *lxxxnnxqqqxxxxxxxxxqxxxfxxxexfxxstpklxxxspxxlx Frame B: ixxxxxxx...hx*xgxlxpxdlxxxx*x*KXXXXLKXXXNXKLXXXXQXXPPKKXGIGFGXI NYXXKIIXNNNXXXXXXXXXXXXNFXXMXNFXXXPQN*xxxpxxx...* Frame C: fxx*xxxxmxrxxx*xxwifxxxxrxkkxxxn*xxyxixn*xxxxnxxppkkxelxlgll iixxk**xttttttttttttxxxistx*xixxxxpkixxxx

  6. Dicty_cDB: Contig-U14657-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence FFXXFFXFFLKXLFFLKTXFFFKNPFFFFF*kknfxxxxxgxxx Trans...lated Amino Acid sequence (All Frames) Frame A: pfxxxffxff*xpfff*kpxfflktxfffffkkkifxxxfxgxx Frame B: lfxxxf...lxffkxpfffknpfff*kpxfffflkkkfxxxxfxxxx Frame C: FFXXFFXFFLKXLFFLKTXFFFKNPFFFFF*kknfxxxxxgxxx own update ----

  7. Dicty_cDB: Contig-U14405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KXXFXFFLGXGGGGGGX XFXGGGGGXXFXGGPXXXPXXGXXXXXXFXKKKXXXFPXXXXPPPXFFF*kkxxx Translated Amino Acid sequence (Al...l Frames) Frame A: ffxxkkkkkkkfffxxkxfxxxkxxxxxxkxxxfxkxfffxkkkxflxxf*kkkkxxfff xxxxxgfxki*kkxxxgxkkkxfxkxggxxlxxqkkxkkxfxxx...ggxxppxkkkgxpxkx ppxxxxkxfgxxxxfxgppkkkkxppfxxlxxkxxrgxxxxxxkxpfs...xffwxggggggg xfsxgggggxxfxgapxxxpxgaxxxxpxxkkknxxxspxxxxppxffffkkkxxx Frame B: ffxkkkkkkknffxxlkxxxxkkxxxxxx...kxxffxkxfffxkkxxf*xxfkkkkrxffff xxxxgxxkkfkkxxxxgkkkxxxkkxgxxpfxpkkkxkkxfxxggxxxppxkkkxprxkx ppxxxxxxlgxxxxfxapqkkkxaplfxx*xxkxkgvxxx

  8. Dicty_cDB: Contig-U14032-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IIIIIITIIIXXIXIXKXXXXXYXY Frame B: xxxxxxkxxxxxkxkkx*kkx*k*x********q***xx*xxkkxxxxxxii Frame C: xxxxxxxxkxxxx...kkxnkkxnknxnnnnnnnnnnnnxnxxnxkkxxxxxxls own update ---------- Homology vs CSM-c

  9. Dicty_cDB: Contig-U13782-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 344A08.... 38 0.065 2 ( EA354773 ) Sequence 153 from patent US 7307069. 48 0.43 1 ( DJ338669 ) Antisense Oligonucleotide Modulation... of STAT3 Exp... 48 0.43 1 ( DI114419 ) Antisense Oligonucleotide Modulation of STAT3

  10. Dicty_cDB: Contig-U16520-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone:brP-1694, 5' end sequence. 80 3e-25 4 ( FG294645 ) 1108770716176 New World... Screwworm Larvae 9387 EST... 92 3e-25 4 ( FG290015 ) 1108793313320 New World Screwworm Egg 9261 ESTs C... 9...2 3e-25 4 ( FG298875 ) 1108793322674 New World Screwworm Larvae 9387 EST... 92 3e-25 4 ( FG291251 ) 1108793336342 New World... ) CNSM3375.b1_N04.ab1 CNS(LMS) yellow starthistle C... 68 5e-23 5 ( FG285330 ) 1108770700782 New World Scre

  11. Dicty_cDB: Contig-U04458-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available um L. Gossypium hi... 36 7.6 2 ( FG288839 ) 1108793284722 New World Screwworm Egg 9261 ESTs C... 28 7.7 4 ( ... 32 8.5 3 ( FG283787 ) 1108770637102 New World Screwworm Egg 9261 ESTs C... 28 8.

  12. Dicty_cDB: Contig-U02501-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Aster yellows witches'-broom phytoplasma AYWB, co... 38 0.006 12 ( FG289263 ) 1108793295629 New World Scre...FG290297 ) 1108793315558 New World Screwworm Egg 9261 ESTs C... 44 9.4 1 ( FE7256

  13. Dicty_cDB: Contig-U02849-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tuberosum RHPOTKEY BAC ends Sol... 38 6.3 2 ( FG286656 ) 1108770723735 New World Screwworm Egg 9261 ESTs C...... 32 6.4 2 ( FG294233 ) 1108770704625 New World Screwworm Larvae 9387 EST... 32 6.4 2 ( AC177392 ) Strongyl

  14. Dicty_cDB: Contig-U03161-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 v1 Meloidog... 44 1.6 1 ( FG284560 ) 1108770677796 New World Screwworm Egg 9261 ESTs C... 44 1.6 1 ( FG284...300 ) 1108770663835 New World Screwworm Egg 9261 ESTs C... 44 1.6 1 ( CP000123 ) Mycoplasma capricolum subsp

  15. Dicty_cDB: Contig-U02384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 143 ) Haemophilus ducreyi strain 35000HP complete genome. 46 1.9 1 ( FG294264 ) 1108770706308 New World Scre...wworm Larvae 9387 EST... 36 2.0 3 ( FG299783 ) 1108793347126 New World Screwworm

  16. Dicty_cDB: Contig-U03788-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e RP24-231O24 map ... 52 0.026 1 ( FG300143 ) 1108793359387 New World Screwworm L...arvae 9387 EST... 36 0.078 2 ( FG286554 ) 1108770721481 New World Screwworm Egg 9261 ESTs C... 36 0.078 2 ( ...FG287767 ) 1108770753655 New World Screwworm Egg 9261 ESTs C... 36 0.079 2 ( EY203968 ) PRAG-aaa88e08.g1 San

  17. Dicty_cDB: Contig-U05606-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available odium falciparum 3D7 chromosome 13. 34 8.3 17 ( FG295791 ) 1108770741540 New World Screwworm Larvae 9387 EST...... 42 8.3 2 ( FG293345 ) 1108770669958 New World Screwworm Larvae 9387 EST... 42 8.3 2 ( GO218251 ) CAGB272

  18. Dicty_cDB: Contig-U05632-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 58 3e-04 1 ( ES807179 ) UFL_616_93 Cotton fiber 0-10 day post anthesis Go... 58 3e-04 1 ( FG283844 ) 1108770637166 New World... Screwworm Egg 9261 ESTs C... 46 7e-04 2 ( FG292433 ) 1108457729555 New World...lyco... 46 1.2 1 ( FG293879 ) 1108770683237 New World Screwworm Larvae 9387 EST... 46 1.2 1 ( EG366862 ) USD

  19. Dicty_cDB: Contig-U03165-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AE017243 ) Mycoplasma hyopneumoniae J, complete genome. 34 0.17 19 ( FG300881 ) 1108799246317 New World... Screwworm Larvae 9387 EST... 38 0.18 2 ( FG283409 ) 1108770613864 New World Screww...orm Egg 9261 ESTs C... 38 0.18 2 ( FG289850 ) 1108793308025 New World Screwworm Egg 9261 ESTs C... 38 0.18 2

  20. Dicty_cDB: Contig-U01961-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available X4 chromosome 2 ... 36 0.006 7 ( FG294486 ) 1108770708306 New World Screwworm Larvae 9387 EST... 34 0.006 3 ...075 13 ( AF063866 ) Melanoplus sanguinipes entomopoxvirus, complete g... 38 0.076 9 ( FG288768 ) 1108793276281 New World...25 6 ( AC103770 ) Homo sapiens chromosome 8, clone RP11-122A3, comp... 36 0.27 7 ( FG288746 ) 1108793276233 New World... Screwworm Egg 9261 ESTs C... 34 0.28 3 ( FG288720 ) 1108793274846 New World... Screwworm Egg 9261 ESTs C... 34 0.28 3 ( FG282925 ) 1108383360962 New World Screwworm Egg 9261 ESTs C..

  1. Dicty_cDB: Contig-U04484-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available F04, complete se... 37 7.4 4 ( FG300472 ) 1108793371523 New World Screwworm Larvae 9387 EST... 35 7.4 3 ( AC...258-141F23, WORKING DRAFT... 39 7.5 3 ( FG293793 ) 1108770683019 New World Screww

  2. Dicty_cDB: Contig-U01674-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BI504888 ) BB170014A10H03.5 Bee Brain Normalized/Subtracted ... 44 5.5 1 ( FG298153 ) 1108793301044 New World... Screwworm Larvae 9387 EST... 44 5.5 1 ( FG283949 ) 1108770645175 New World Scre

  3. Dicty_cDB: Contig-U03062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.2 11 ( CP000685 ) Flavobacterium johnsoniae UW101, complete genome. 36 1.3 17 ( FG292300 ) 1108457713646 New World... Screwworm Larvae 9387 EST... 36 1.3 2 ( FG293205 ) 1108770666478 New World Screwworm Larvae 9387 ES

  4. Dicty_cDB: Contig-U01212-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( FG296845 ) 1108793265031 New World Screwworm Larvae 9387 EST... 48 0.80 1 ( FG293922 ) 1108770691078 New World... Screwworm Larvae 9387 EST... 48 0.80 1 ( FG293568 ) 1108770679006 New World

  5. Dicty_cDB: Contig-U01139-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 179314 ) Strongylocentrotus purpuratus clone R3-1102P16, W... 32 6.6 5 ( FG289388 ) 1108793297216 New World ...Screwworm Egg 9261 ESTs C... 38 6.9 2 ( FG286433 ) 1108770714983 New World Screww

  6. Dicty_cDB: Contig-U01295-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 215673-... 38 0.14 7 ( FG288127 ) 1108793259903 New World Screwworm Egg 9261 ESTs C... 40 0.14 2 ( DQ855586...p. nucleatum ATCC 255... 50 0.15 1 ( FG286381 ) 1108770714831 New World Screwworm Egg 9261 ESTs C... 40 0.15...( FM992688 ) Candida dubliniensis CD36 chromosome 1, complete ... 44 0.55 6 ( FG296422 ) 1108793252569 New World

  7. Dicty_cDB: Contig-U16449-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pe... 48 2e-14 5 ( BC113336 ) Bos taurus Obg-like ATPase 1, mRNA (cDNA clone MG... 54 2e-14 4 ( FG283006 ) 1108383361067 New World... Screwworm Egg 9261 ESTs C... 70 2e-14 3 ( FG286073 ) 1108770713503 New World Screwwor...m Egg 9261 ESTs C... 70 2e-14 3 ( FG286027 ) 1108770713408 New World Screwworm Eg...g 9261 ESTs C... 70 3e-14 3 ( FG285996 ) 1108770710777 New World Screwworm Egg 9261 ESTs C... 70 3e-14 3 ( F...G283733 ) 1108770634630 New World Screwworm Egg 9261 ESTs C... 70 3e-14 3 ( EZ001364 ) TSA: Acropora millepo

  8. Dicty_cDB: Contig-U06595-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ilus oremlandii OhILAs, ... 32 9.1 FJ563415_1( FJ563415 |pid:none) Rodriguezia arevaloi voucher Willi... 32 ...TCC ... 32 9.1 (Q8T305) RecName: Full=Paramyosin; &AJ439882_1( AJ439882 |pid:none) 32 9.1 FJ563162_1( FJ563162 |pid:none) Rodriguez

  9. Dicty_cDB: Contig-U01710-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FK******ynn *iskermyw*rwydn*cl*mfnk*l*taimyfktnisfk*ykl**fqilknv*fph*fks nqsncklynsfiff*fsiifiiiiiiik*l*fi*fffky*yyfnnciiinfinit...myw*rwydn*cl*mfnk*l*taimyfktnisfk*ykl**fqilknv*fph*fks nqsncklynsfiff*fsiifiiiiiiik*l*fi*fffky*yyfnnciiinfinit

  10. Dicty_cDB: Contig-U16336-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 90 |pid:none) Thulinius stephaniae clone Thul63f... 42 0.16 CP001325_660( CP00132.... 44 0.055 AF486293_1( AF486293 |pid:none) Giardia intestinalis alpha adaptin... 43 0.072 EU020990_1( EU0209

  11. Dicty_cDB: Contig-U16263-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 66 |pid:none) Thulinius stephaniae clone Thul320... 192 3e-47 EU020863_1( EU02086...194 7e-48 EU020862_1( EU020862 |pid:none) Narceus americanus clone Nam3202f1... 192 3e-47 EU020866_1( EU0208

  12. Dicty_cDB: Contig-U12867-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.018 CP000581_85( CP000581 |pid:none) Ostreococcus lucimarinus CCE9901 ... 42 0.018 EU020406_1( EU020406 |pid:none) Thulinius steph...aniae clone Thul25f... 42 0.023 AE005673_3627( AE005673 |pid:none) Caulobacter cres

  13. Dicty_cDB: Contig-U12014-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 1 ( CB395139 ) OSTR149E1_1 AD-wrmcDNA Caenorhabditis elegans cDN... 60 3e-04 1 ( DY584025 ) C017-D11 Acropora millepora presettleme...nt library... 58 0.001 1 ( CJ336144 ) Molgula tectiformis cDNA, embryo just before

  14. Dicty_cDB: Contig-U15363-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ary B A... 137 6e-28 2 ( DY584155 ) C018-G11 Acropora millepora presettlement library... 137 7e-28 2 ( EY026...7e-28 2 ( DY585393 ) C007-G9 Acropora millepora presettlement library ... 137 7e-28 2 ( DY584007 ) C017-B4 Acropora millepora presett...library... 137 7e-28 2 ( DY584872 ) C002-A4 Acropora millepora presettlement library ... 137 8e-28 2 ( DR985...tlement library... 137 7e-28 2 ( DY581272 ) B031-D3 Acro...7e-28 2 ( DY583096 ) B029-D4 Acropora millepora prawn chip library B A... 137 7e-28 2 ( DY584396 ) C012-G11 Acropora millepora preset

  15. Dicty_cDB: Contig-U05360-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ent library ... 74 1e-08 1 ( DY584577 ) C014-F9 Acropora millepora presettlement li...-08 1 ( EK287310 ) 1095462317178 Global-Ocean-Sampling_GS-31-01-01-1... 74 1e-08 1 ( DY585529 ) C009-D1 Acropora millepora presettlem

  16. Dicty_cDB: Contig-U16302-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9523, 5' end, exp... 117 5e-28 3 ( EU020782 ) Mastigoproctus giganteus clone Mga3136f1 putative... 113 8e-28...clone Stu3... 210 1e-60 EU020782_1( EU020782 |pid:none) Mastigoproctus giganteus

  17. Dicty_cDB: Contig-U15810-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Fat body ... 44 3e-08 3 ( EU020373 ) Mastigoproctus giganteus clone Mga226f1 putative ... 42 3e-07 4 ( FC18...2) RecName: Full=GMP synthase [glutamine-hydrolyzing]; ... 207 2e-51 EU020373_1( EU020373 |pid:none) Mastigopro

  18. Dicty_cDB: Contig-U15645-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available D021940 ) Packaging cell systems for use in promotion of th... 168 6e-78 2 ( AX35... BD021943 ) Packaging cell systems for use in promotion of th... 168 8e-78 2 ( AX356044 ) Sequence 15 from P

  19. Dicty_cDB: Contig-U15642-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available packaging cell line, compositi... 258 0.0 5 ( BD021940 ) Packaging cell systems for use in promotion of th....., compositi... 258 0.0 5 ( BD021943 ) Packaging cell systems for use in promotion of th... 258 0.0 5 ( AX356

  20. Dicty_cDB: Contig-U15867-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ieksw*pssiwww*w*n*i*rrd*nl*g**fitiilfgsnftrikcy gncnhswy*rd*s*tig**n*grt*yrsirefn*ftifk*r**kttyhw*isfifkhlqr *d*ygiqwfkik*tngs*ynctm...ttyhw*isfifkhlqr*d*ygiqwfkik* tngs*ynctmfrkssklfilfigwyrwfglfmaiwytrgidclstpsktknr*m*iqskw h*iwcm--- ---sccg...ftifk*r**kttyhw*isfifkhlqr *d*ygiqwfkik*tngs*ynctmfrkssklfilfigwyrwfglfmaiwytrgid

  1. Dicty_cDB: Contig-U14965-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 028445 ) LscoSEQ9007 Leucosporidium scottii pBluescript (E... 48 1.1 1 ( EB026166... ) LscoSEQ6305 Leucosporidium scottii pBluescript (E... 48 1.1 1 ( DY379548 ) ZO__Eg0006I14.r ZO__Eg Zingibe

  2. Dicty_cDB: Contig-U13443-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value N ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome... 529 0.0 10 ( BJ3... AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene...icant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott...0_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds

  3. Dicty_cDB: Contig-U03971-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 52 2e-05 FJ771006_1( FJ771006 |pid:none) HIV-1 isolate 02BR082 from Brazil,... 52 2e-05 AY352275_1( AY35227...Y727522_1( AY727522 |pid:none) HIV-1 isolate 04BR013 from Brazil ... 51 3e-05 AF516184_1( AF516184 |pid:none...pid:none) HIV-1 isolate 110PA from Brazil, c... 50 4e-05 DQ792987_1( DQ792987 |pi

  4. Dicty_cDB: Contig-U16372-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IV-1 isolate 01BAB094 from Brazil... 45 0.017 FJ786365_1( FJ786365 |pid:none) HIV-1 isolate ahi97_04 from US...ne) HIV-1 isolate 06BR564 from Brazil,... 44 0.022 DQ375283_1( DQ375283 |pid:none) HIV-1 isolate J11471 from...Q358806_2( DQ358806 |pid:none) HIV-1 isolate 02BR005 from Brazil,... 44 0.029 FJ1... prote... 44 0.038 EF150597_1( EF150597 |pid:none) HIV-1 isolate 01GOB031 from Brazil... 44 0.038 EU170141_2...DQ375268 |pid:none) HIV-1 isolate J11451 from Saudi Ar... 44 0.038 EF150603_1( EF150603 |pid:none) HIV-1 isolate 38154 from Brazil

  5. Dicty_cDB: Contig-U11717-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Mycobacterium phage Pukovnik, com... 87 2e-15 EF101928_838( EF101928 |pid:none) ...00875_4745( CP000875 |pid:none) Herpetosiphon aurantiacus ATCC ... 87 1e-15 EU744250_49( EU744250 |pid:none)

  6. Dicty_cDB: Contig-U07413-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FJ973383_1( FJ973383 |pid:none) Cryptomonas paramecium strain CCAP... 52 6e-06 D...id:none) Rotaliina sp. isolate 3953 clone 5... 52 8e-06 EF455726_1( EF455726 |pid:none) Cryptomonas parame...cium actin gene,... 52 8e-06 ( P30164 ) RecName: Full=Actin-1; &S25488(S25488) &X67

  7. Dicty_cDB: Contig-U10237-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rcoralis ... 48 8e-09 3 ( EY502913 ) CBBP6629.rev CBBP Hirudo medicinalis hermaphrodit... 42 2e-08 4 ( EY483...666 ) CBBP13113.rev CBBP Hirudo medicinalis hermaphrodi... 42 2e-08 4 ( EY481295 ...) CBBP11299.rev CBBP Hirudo medicinalis hermaphrodi... 42 2e-08 4 ( DC439626 ) Gryllus bimaculatus mRNA, clo...) 1323 Sminthopsis fibroblast Library Sminthopsis c... 42 4e-06 3 ( EY505088 ) CBBP9613.fwd CBBP Hirudo medicina...lis hermaphrodit... 42 9e-06 3 ( EY483667 ) CBBP13113.fwd CBBP Hirudo medicinalis hermaphrodi... 42 9e-0

  8. Dicty_cDB: Contig-U03947-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 938 ) CBBP4410.fwd CBBP Hirudo medicinalis hermaphrodit... 48 0.31 1 ( EY498937 ) CBBP4410.rev CBBP Hirudo medicina... 1.2 1 ( EY492936 ) CBBP19197.fwd CBBP Hirudo medicinalis hermaphrodi... 46 1.2 1 ( EY492935 ) CBBP19197.rev CBBP Hirudo medicina...lis hermaphrodi... 46 1.2 1 ( EY484758 ) CBBP13781.rev CBBP Hirudo medicina...lis hermaphrodi... 46 1.2 1 ( EY482704 ) CBBP12533.rev CBBP Hirudo medicinalis hermaphrodi...

  9. Dicty_cDB: Contig-U11651-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 1 ( BJ435790 ) Dictyostelium discoideum cDNA clone:ddv28j10, 3' ... 355 2e-93 1 ( EY481033 ) CBBP11161.rev CBBP Hirudo medicina...lis hermaphrodi... 36 1.6 2 ( EY486444 ) CBBP15196.rev CBBP Hirudo medicinalis hermaphr...odi... 36 1.6 2 ( EY503165 ) CBBP6773.rev CBBP Hirudo medicinalis hermaphrodit...... 36 1.6 2 ( EY494245 ) CBBP19905.rev CBBP Hirudo medicinalis hermaphrodi... 36 1.6 2 ( EY504499 ) CBBP7545.rev CBBP Hirudo medicina...lis hermaphrodit... 36 1.6 2 ( EY503685 ) CBBP7067.rev CBBP Hirudo medicinalis hermap

  10. Dicty_cDB: Contig-U04644-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pic... 44 2.2 1 ( EY502549 ) CBBP6429.rev CBBP Hirudo medicinalis hermaphrodit... 44 2.2 1 ( EY484983 ) CBBP14303.rev CBBP Hirudo med...icinalis hermaphrodi... 44 2.2 1 ( AM180255 ) Lawsonia i

  11. Dicty_cDB: Contig-U06413-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rus EST library project... 48 0.34 1 ( EY496038 ) CBBP2673.rev CBBP Hirudo medicinalis hermaphrodit... 48 0....34 1 ( EY493522 ) CBBP19513.fwd CBBP Hirudo medicinalis hermaphrodi... 48 0.34 1 ( EY491706 ) CBBP18426.fwd CBBP Hirudo medicina...lis hermaphrodi... 48 0.34 1 ( EY491705 ) CBBP18426.rev CBBP Hirudo medicina...lis hermaphrodi... 48 0.34 1 ( EY490129 ) CBBP17464.fwd CBBP Hirudo medicinalis hermaphrodi...... 48 0.34 1 ( EY485788 ) CBBP14812.fwd CBBP Hirudo medicinalis hermaphrodi... 48 0.34 1 ( EY485787 ) CBBP14812.rev CBBP Hirudo medici

  12. Dicty_cDB: Contig-U16335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 ( EY502726 ) CBBP6523.fwd CBBP Hirudo medicinalis hermaphrodit... 44 5.3 1 ( EY502725 ) CBBP6523.rev CBBP Hirudo medicina...lis hermaphrodit... 44 5.3 1 ( EY493532 ) CBBP19518.fwd CBBP Hirudo medicinalis hermaphrodi...... 44 5.3 1 ( EY493531 ) CBBP19518.rev CBBP Hirudo medicinalis hermaphrodi... 44 ...5.3 1 ( EY489048 ) CBBP16804.fwd CBBP Hirudo medicinalis hermaphrodi... 44 5.3 1 ( EY489047 ) CBBP16804.rev CBBP Hirudo medicina

  13. Dicty_cDB: Contig-U16208-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available H306-1B3, complete sequ... 42 0.001 8 ( EY487360 ) CBBP15754.fwd CBBP Hirudo medicinalis hermaphrodi... 58 0....27 1 ( EY489283 ) CBBP16951.fwd CBBP Hirudo medicinalis hermaphrodi... 50 0.27 1 ( EY385189 ) CAXA5562.fwd ...ev CAWZ Helobdella robusta Primary Late... 42 0.37 2 ( EY485499 ) CBBP14631.fwd CBBP Hirudo medicinalis herm...zias latipes EST, clone M046--B11_093. 38 0.39 3 ( EY490006 ) CBBP17391.fwd CBBP Hirudo medicinalis hermaphr...odi... 44 0.39 2 ( EY485498 ) CBBP14631.rev CBBP Hirudo medicinalis hermaphrodi... 44 0.39 2 ( EY503416 ) CB

  14. Dicty_cDB: Contig-U05033-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 35269 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.13 2 ( EY497680 ) CBBP3693.rev CBBP Hirudo medicinalis her...maphrodit... 50 0.13 1 ( EY493998 ) CBBP19771.rev CBBP Hirudo medicinalis hermaph...rodi... 50 0.13 1 ( EY487045 ) CBBP15563.fwd CBBP Hirudo medicinalis hermaphrodi... 50 0.13 1 ( EY487044 ) C...BBP15563.rev CBBP Hirudo medicinalis hermaphrodi... 50 0.13 1 ( AC116305 ) Dictyostelium discoideum chromoso

  15. Dicty_cDB: Contig-U14872-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 50 0.082 1 ( FG553699 ) BN18DYSC_UP_009_F10_15FEB2008_070 BN18DYSC Brassi... 50 0.082 1 ( EY504882 ) CBBP847.rev CBBP Hirudo medicin...alis hermaphrodite... 50 0.082 1 ( EY489733 ) CBBP17216.rev CBBP Hirudo medicinalis... hermaphrodi... 50 0.082 1 ( EY488581 ) CBBP16523.rev CBBP Hirudo medicinalis hermaphrodi... 50 0.082 1 ( EY...487122 ) CBBP15614.rev CBBP Hirudo medicinalis hermaphrodi... 50 0.082 1 ( EY4838...66 ) CBBP13236.fwd CBBP Hirudo medicinalis hermaphrodi... 50 0.082 1 ( EY483865 ) CBBP13236.rev CBBP Hirudo medicina

  16. Dicty_cDB: Contig-U11786-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available spleen cDNA, RIKEN full-le... 52 0.057 1 ( EY502489 ) CBBP6397.rev CBBP Hirudo medicinalis hermaphrodit... ...52 0.057 1 ( EY501142 ) CBBP5660.rev CBBP Hirudo medicinalis hermaphrodit... 52 0.057 1 ( EY498689 ) CBBP4264.fwd CBBP Hirudo medicin...alis hermaphrodit... 52 0.057 1 ( EY496087 ) CBBP2702.rev CBBP Hirudo medicina...lis hermaphrodit... 52 0.057 1 ( EY495298 ) CBBP2215.fwd CBBP Hirudo medicinalis herma...phrodit... 52 0.057 1 ( EY486742 ) CBBP15371.rev CBBP Hirudo medicinalis hermaphrodi... 52 0.057 1 ( EY30352

  17. Dicty_cDB: Contig-U01764-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 44 1.4 1 ( EY870291 ) CL06-C4-500-044-E06-CT.F Rangpur lime root, green... 44 1.4 1 ( EY496941 ) CBBP3246.fwd CBBP Hirudo medicina...lis hermaphrodit... 44 1.4 1 ( EY493732 ) CBBP19624.rev CBBP Hirudo medicina...lis hermaphrodi... 44 1.4 1 ( EY488088 ) CBBP16209.fwd CBBP Hirudo medicinalis hermaphro...di... 44 1.4 1 ( EY488087 ) CBBP16209.rev CBBP Hirudo medicinalis hermaphrodi... 44 1.4 1 ( EY480105 ) CBBP10646.rev CBBP Hirudo medi...cinalis hermaphrodi... 44 1.4 1 ( EY345787 ) CAWZ14271.r

  18. Dicty_cDB: Contig-U01506-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 40 2.5 2 ( EY487035 ) CBBP15558.fwd CBBP Hirudo medicinalis hermaphrodi... 34 2.6 2 ( AG185830 ) Pan trog...aphanistrum subsp. ma... 44 3.2 1 ( EY485431 ) CBBP14590.rev CBBP Hirudo medicinalis hermaphrodi... 44 3.2 1... ( EY482420 ) CBBP12345.rev CBBP Hirudo medicinalis hermaphrodi... 44 3.2 1 ( EY359378 ) CAWZ6402.fwd CAWZ H... EY501525 ) CBBP587.rev CBBP Hirudo medicinalis hermaphrodite... 30 7.9 2 ( EY504187 ) CBBP7356.rev CBBP Hirudo medicina...2 8.0 2 ( EY495283 ) CBBP2206.rev CBBP Hirudo medicinalis hermaphrodit... 30 8.0

  19. Dicty_cDB: Contig-U15132-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N ( C22922 ) Dictyostelium discoideum gamete cDNA, clone FC-AM03. 1122 0.0 1 ( EY489954 ) CBBP17356.rev CBBP Hirudo medicina...lis hermaphrodi... 56 9e-12 4 ( EY481037 ) CBBP11163.rev CBBP Hirudo medicinalis he...( CZ542454 ) SRAA-aad44c05.g1 Strongyloides ratti whole genome... 66 1e-10 3 ( EY491469 ) CBBP18281.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY481038 ) CBBP11163.fwd CBBP Hirudo medicina...lis hermaphrodi... 56 3e-10 2 ( EY489955 ) CBBP17356.fwd CBBP Hirudo medicinalis hermaphrodi...

  20. Dicty_cDB: Contig-U12531-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SHGC-CLJ Gasterosteus aculeatus ... 48 0.77 1 ( EY497720 ) CBBP3718.rev CBBP Hirudo medicinalis hermaphrodi...t... 48 0.77 1 ( EY496316 ) CBBP2847.fwd CBBP Hirudo medicinalis hermaphrodit... 48 0.77 1 ( EY496315 ) CBBP2847.rev CBBP Hirudo medi...cinalis hermaphrodit... 48 0.77 1 ( EY484422 ) CBBP13571.fwd CBBP Hirudo medicina...lis hermaphrodi... 48 0.77 1 ( EY484421 ) CBBP13571.rev CBBP Hirudo medicinalis her...maphrodi... 48 0.77 1 ( EY483641 ) CBBP13100.fwd CBBP Hirudo medicinalis hermaphrodi... 48 0.77 1 ( EY483640