NASA/BAE SYSTEMS SpaceWire Effort
Rakow, Glenn Parker; Schnurr, Richard G.; Kapcio, Paul
2003-01-01
This paper discusses the state of the NASA and BAE SYSTEMS developments of SpaceWire. NASA has developed intellectual property that implements SpaceWire in Register Transfer Level (RTL) VHDL for a SpaceWire link and router. This design has been extensively verified using directed tests from the SpaceWire Standard and design specification, as well as being randomly tested to flush out hard to find bugs in the code. The high level features of the design will be discussed, including the support for multiple time code masters, which will be useful for the James Webb Space Telescope electrical architecture. This design is now ready to be targeted to FPGA's and ASICs. Target utilization and performance information will be presented for Spaceflight worthy FPGA's and a discussion of the ASIC implementations will be addressed. In particular, the BAE SYSTEMS ASIC will be highlighted which will be implemented on their .25micron rad-hard line. The chip will implement a 4-port router with the ability to tie chips together to make larger routers without external glue logic. This part will have integrated LVDS drivers/receivers, include a PLL and include skew control logic. It will be targeted to run at greater than 300 MHz and include the implementation for the proposed SpaceWire transport layer. The need to provide a reliable transport mechanism for SpaceWire has been identified by both NASA And ESA, who are attempting to define a transport layer standard that utilizes a low overhead, low latency connection oriented approach that works end-to-end. This layer needs to be implemented in hardware to prevent bottlenecks.
SpaceWire: IP, Components, Development Support and Test Equipment
Parkes, S.; McClements, C.; Mills, S.; Martin, I.
SpaceWire is a communications network for use onboard spacecraft. It is designed to connect high data-rate sensors, large solid-state memories, processing units and the downlink telemetry subsystem providing an integrated data-handling network. SpaceWire links are serial, high-speed (2 Mbits/sec to 400 Mbits/sec), bi-directional, full-duplex, pointto- point data links which connect together SpaceWire equipment. Application information is sent along a SpaceWire link in discrete packets. Control and time information can also be sent along SpaceWire links. SpaceWire is defined in the ECSS-E50-12A standard [1]. With the adoption of SpaceWire on many space missions the ready availability of intellectual property (IP) cores, components, software drivers, development support, and test equipment becomes a major issue for those developing satellites and their electronic subsystems. This paper describes the work being done at the University of Dundee and STAR-Dundee Ltd with ESA, BNSC and internal funding to make these essential items available. STAR-Dundee is a spin-out company of the University of Dundee set up specifically to support users of SpaceWire.
Developing and Testing SpaceWire Devices and Networks
Parkes, Steve; Mills, Stuart
2014-08-01
SpaceWire is a data-handling network for use on-board spacecraft, which connects together instruments, mass- memory, processors, downlink telemetry, and other on- board sub-systems [1]. SpaceWire is simple to implement and has some specific characteristics that help it support data-handling applications in space: high-speed, low-power, simplicity, relatively low implementation cost, and architectural flexibility making it ideal for many space missions. SpaceWire provides high-speed (2 Mbits/s to 200 Mbits/s), bi- directional, full-duplex data-links, which connect together SpaceWire enabled equipment. Data-handling networks can be built to suit particular applications using point-to-point data-links and routing switches.Since the SpaceWire standard was published in January 2003, it has been adopted by ESA, NASA, JAXA and RosCosmos for many missions and is being widely used on scientific, Earth observation, commercial and other spacecraft. High-profile missions using SpaceWire include: Gaia, ExoMars rover, Bepi- Colombo, James Webb Space Telescope, GOES-R, Lunar Reconnaissance Orbiter and Astro-H.The development and testing of the SpaceWire links and networks used on these and many other spacecraft currently under development, requires a comprehensive array of test equipment. In this paper the requirements for test equipment fulfilling key test functions are outlined and then equipment that meets these requirements is described. Finally the all-important software that operates with the test equipment is introduced.
International Nuclear Information System (INIS)
Zhu Zhang-Ming; Hao Bao-Tian; En Yun-Fei; Yang Yin-Tang; Li Yue-Jin
2011-01-01
On-chip interconnect buses consume tens of percents of dynamic power in a nanometer scale integrated circuit and they will consume more power with the rapid scaling down of technology size and continuously rising clock frequency, therefore it is meaningful to lower the interconnecting bus power in design. In this paper, a simple yet accurate interconnect parasitic capacitance model is presented first and then, based on this model, a novel interconnecting bus optimization method is proposed. Wire spacing is a process for spacing wires for minimum dynamic power, while wire ordering is a process that searches for wire orders that maximally enhance it. The method, i.e., combining wire spacing with wire ordering, focuses on bus dynamic power optimization with a consideration of bus performance requirements. The optimization method is verified based on various nanometer technology parameters, showing that with 50% slack of routing space, 25.71% and 32.65% of power can be saved on average by the proposed optimization method for a global bus and an intermediate bus, respectively, under a 65-nm technology node, compared with 21.78% and 27.68% of power saved on average by uniform spacing technology. The proposed method is especially suitable for computer-aided design of nanometer scale on-chip buses. (interdisciplinary physics and related areas of science and technology)
LabVIEW Interface for PCI-SpaceWire Interface Card
Lux, James; Loya, Frank; Bachmann, Alex
2005-01-01
This software provides a LabView interface to the NT drivers for the PCISpaceWire card, which is a peripheral component interface (PCI) bus interface that conforms to the IEEE-1355/ SpaceWire standard. As SpaceWire grows in popularity, the ability to use SpaceWire links within LabVIEW will be important to electronic ground support equipment vendors. In addition, there is a need for a high-level LabVIEW interface to the low-level device- driver software supplied with the card. The LabVIEW virtual instrument (VI) provides graphical interfaces to support all (1) SpaceWire link functions, including message handling and routing; (2) monitoring as a passive tap using specialized hardware; and (3) low-level access to satellite mission-control subsystem functions. The software is supplied in a zip file that contains LabVIEW VI files, which provide various functions of the PCI-SpaceWire card, as well as higher-link-level functions. The VIs are suitably named according to the matching function names in the driver manual. A number of test programs also are provided to exercise various functions.
A Software Suite for Testing SpaceWire Devices and Networks
Mills, Stuart; Parkes, Steve
2015-09-01
SpaceWire is a data-handling network for use on-board spacecraft, which connects together instruments, mass-memory, processors, downlink telemetry, and other on-board sub-systems. SpaceWire is simple to implement and has some specific characteristics that help it support data-handling applications in space: high-speed, low-power, simplicity, relatively low implementation cost, and architectural flexibility making it ideal for many space missions. SpaceWire provides high-speed (2 Mbits/s to 200 Mbits/s), bi-directional, full-duplex data-links, which connect together SpaceWire enabled equipment. Data-handling networks can be built to suit particular applications using point-to-point data-links and routing switches. STAR-Dundee’s STAR-System software stack has been designed to meet the needs of engineers designing and developing SpaceWire networks and devices. This paper describes the aims of the software and how those needs were met.
A reliability analysis tool for SpaceWire network
Zhou, Qiang; Zhu, Longjiang; Fei, Haidong; Wang, Xingyou
2017-04-01
A SpaceWire is a standard for on-board satellite networks as the basis for future data-handling architectures. It is becoming more and more popular in space applications due to its technical advantages, including reliability, low power and fault protection, etc. High reliability is the vital issue for spacecraft. Therefore, it is very important to analyze and improve the reliability performance of the SpaceWire network. This paper deals with the problem of reliability modeling and analysis with SpaceWire network. According to the function division of distributed network, a reliability analysis method based on a task is proposed, the reliability analysis of every task can lead to the system reliability matrix, the reliability result of the network system can be deduced by integrating these entire reliability indexes in the matrix. With the method, we develop a reliability analysis tool for SpaceWire Network based on VC, where the computation schemes for reliability matrix and the multi-path-task reliability are also implemented. By using this tool, we analyze several cases on typical architectures. And the analytic results indicate that redundancy architecture has better reliability performance than basic one. In practical, the dual redundancy scheme has been adopted for some key unit, to improve the reliability index of the system or task. Finally, this reliability analysis tool will has a directive influence on both task division and topology selection in the phase of SpaceWire network system design.
SpaceWire Driver Software for Special DSPs
Clark, Douglas; Lux, James; Nishimoto, Kouji; Lang, Minh
2003-01-01
A computer program provides a high-level C-language interface to electronics circuitry that controls a SpaceWire interface in a system based on a space qualified version of the ADSP-21020 digital signal processor (DSP). SpaceWire is a spacecraft-oriented standard for packet-switching data-communication networks that comprise nodes connected through bidirectional digital serial links that utilize low-voltage differential signaling (LVDS). The software is tailored to the SMCS-332 application-specific integrated circuit (ASIC) (also available as the TSS901E), which provides three highspeed (150 Mbps) serial point-to-point links compliant with the proposed Institute of Electrical and Electronics Engineers (IEEE) Standard 1355.2 and equivalent European Space Agency (ESA) Standard ECSS-E-50-12. In the specific application of this software, the SpaceWire ASIC was combined with the DSP processor, memory, and control logic in a Multi-Chip Module DSP (MCM-DSP). The software is a collection of low-level driver routines that provide a simple message-passing application programming interface (API) for software running on the DSP. Routines are provided for interrupt-driven access to the two styles of interface provided by the SMCS: (1) the "word at a time" conventional host interface (HOCI); and (2) a higher performance "dual port memory" style interface (COMI).
Manchester Coding Option for SpaceWire: Providing Choices for System Level Design
Rakow, Glenn; Kisin, Alex
2014-01-01
This paper proposes an optional coding scheme for SpaceWire in lieu of the current Data Strobe scheme for three reasons. First reason is to provide a straightforward method for electrical isolation of the interface; secondly to provide ability to reduce the mass and bend radius of the SpaceWire cable; and thirdly to provide a means for a common physical layer over which multiple spacecraft onboard data link protocols could operate for a wide range of data rates. The intent is to accomplish these goals without significant change to existing SpaceWire design investments. The ability to optionally use Manchester coding in place of the current Data Strobe coding provides the ability to DC balanced the signal transitions unlike the SpaceWire Data Strobe coding; and therefore the ability to isolate the electrical interface without concern. Additionally, because the Manchester code has the clock and data encoded on the same signal, the number of wires of the existing SpaceWire cable could be optionally reduced by 50. This reduction could be an important consideration for many users of SpaceWire as indicated by the already existing effort underway by the SpaceWire working group to reduce the cable mass and bend radius by elimination of shields. However, reducing the signal count by half would provide even greater gains. It is proposed to restrict the data rate for the optional Manchester coding to a fixed data rate of 10 Megabits per second (Mbps) in order to make the necessary changes simple and still able to run in current radiation tolerant Field Programmable Gate Arrays (FPGAs). Even with this constraint, 10 Mbps will meet many applications where SpaceWire is used. These include command and control applications and many instruments applications with have moderate data rate. For most NASA flight implementations, SpaceWire designs are in rad-tolerant FPGAs, and the desire to preserve the heritage design investment is important for cost and risk considerations. The
Fabrication of FFTF fuel pin wire wrap
International Nuclear Information System (INIS)
Epperson, E.M.
1980-06-01
Lateral spacing between FFTF fuel pins is required to provide a passageway for the sodium coolant to flow over each pin to remove heat generated by the fission process. This spacing is provided by wrapping each fuel pin with type 316 stainless steel wire. This wire has a 1.435mm (0.0565 in.) to 1.448mm (0.0570 in.) diameter, contains 17 +- 2% cold work and was fabricated and tested to exacting RDT Standards. About 500 kg (1100 lbs) or 39 Km (24 miles) of fuel pin wrap wire is used in each core loading. Fabrication procedures and quality assurance tests are described
A One Chip Hardened Solution for High Speed SpaceWire System Implementations. Session: Components
Marshall, Joseph R.; Berger, Richard W.; Rakow, Glenn P.
2007-01-01
An Application Specific Integrated Circuit (ASIC) that implements the SpaceWire protocol has been developed in a radiation hardened 0.25 micron CMOS technology. This effort began in March 2003 as a joint development between the NASA Goddard Space Flight Center (GSFC) and BAE Systems. The BAE Systems SpaceWire ASIC is comprised entirely of reusable core elements, many of which are already flight-proven. It incorporates a router with 4 SpaceWire ports and two local ports, dual PC1 bus interfaces, a microcontroller, 32KB of internal memory, and a memory controller for additional external memory use. The SpaceWire cores are also reused in other ASICs under development. The SpaceWire ASIC is planned for use on the Geostationary Operational Environmental Satellites (GOES)-R, the Lunar Reconnaissance Orbiter (LRO) and other missions. Engineering and flight parts have been delivered to programs and users. This paper reviews the SpaceWire protocol and those elements of it that have been built into the current and next SpaceWire reusable cores and features within the core that go beyond the current standard and can be enabled or disabled by the user. The adaptation of SpaceWire to BAE Systems' On Chip Bus (OCB) for compatibility with the other reusable cores will be reviewed and highlighted. Optional configurations within user systems and test boards will be shown. The physical implementation of the design will be described and test results from the hardware will be discussed. Application of this ASIC and other ASICs containing the SpaceWire cores and embedded microcontroller to Plug and Play and reconfigurable implementations will be described. Finally, the BAE Systems roadmap for SpaceWire developments will be updated, including some products already in design as well as longer term plans.
Operational environments for electrical power wiring on NASA space systems
Stavnes, Mark W.; Hammoud, Ahmad N.; Bercaw, Robert W.
1994-01-01
Electrical wiring systems are used extensively on NASA space systems for power management and distribution, control and command, and data transmission. The reliability of these systems when exposed to the harsh environments of space is very critical to mission success and crew safety. Failures have been reported both on the ground and in flight due to arc tracking in the wiring harnesses, made possible by insulation degradation. This report was written as part of a NASA Office of Safety and Mission Assurance (Code Q) program to identify and characterize wiring systems in terms of their potential use in aerospace vehicles. The goal of the program is to provide the information and guidance needed to develop and qualify reliable, safe, lightweight wiring systems, which are resistant to arc tracking and suitable for use in space power applications. This report identifies the environments in which NASA spacecraft will operate, and determines the specific NASA testing requirements. A summary of related test programs is also given in this report. This data will be valuable to spacecraft designers in determining the best wiring constructions for the various NASA applications.
SpaceWire Tiger Team Findings and Suggestions
Ishac, Joseph A.
2011-01-01
This technical report intends to highlight the key findings and recommendations of the SpaceWire Tiger Team for the CoNNeCT project. It covers findings which are technical in nature, covering design concepts and approaches.
Time Distribution Using SpaceWire in the SCaN Testbed on ISS
Lux, James P.
2012-01-01
A paper describes an approach for timekeeping and time transfer among the devices on the CoNNeCT project s SCaN Testbed. It also describes how the clocks may be synchronized with an external time reference; e.g., time tags from the International Space Station (ISS) or RF signals received by a radio (TDRSS time service or GPS). All the units have some sort of counter that is fed by an oscillator at some convenient frequency. The basic problem in timekeeping is relating the counter value to some external time standard such as UTC. With SpaceWire, there are two approaches possible: one is to just use SpaceWire to send a message, and use an external wire for the sync signal. This is much the same as with the RS- 232 messages and l pps line from a GPS receiver. However, SpaceWire has an additional capability that was added to make it easier - it can insert and receive a special "timecode" word in the data stream.
Velocity distribution measurement in wire-spaced fuel pin bundle
International Nuclear Information System (INIS)
Mizuta, Hiroshi; Ohtake, Toshihide; Uruwashi, Shinichi; Takahashi, Keiichi
1974-01-01
Flow distribution measurement was made in the subchannels of a pin bundle in air flow. The present paper is interim because the target of this work is the decision of temperature of the pin surface in contact with wire spacers. The wire-spaced fuel pin bundle used for the experiment consists of 37 simulated fuel pins of stainless steel tubes, 3000 mm in length and 31.6 mm in diameter, which are wound spirally with 6 mm stainless steel wire. The bundle is wrapped with a hexagonal tube, 3500 mm in length and 293 mm in flat-to-flat distance. The bundle is fixed with knock-bar at the entrance of air flow in the hexagonal tube. The pitch of pins in the bundle is 37.6 mm (P/D=1.19) and the wrapping pitch of wire is 1100 mm (H/D=34.8). A pair of arrow-type 5-hole Pitot tubes are used to measure the flow velocity and the direction of air flow in the pin bundle. The measurement of flow distribution was made with the conditions of air flow rate of 0.33 m 3 /sec, air temperature of 45 0 C, and average Reynolds number of 15100 (average air velocity of 20.6 m/sec.). It was found that circular flow existed in the down stream of wire spacers, that axial flow velocity was slower in the subchannels, which contained wire spacers, than in those not affected by the wire, and that the flow angle to the axial velocity at the boundary of subchannels was two thirds smaller than wire wrapping angle. (Tai, I.)
Lightweight Metal Rubber Wire and Cable for Space Power Systems, Phase I
National Aeronautics and Space Administration — The objective of this NASA STTR program is to produce ultra-lightweight electrical wire and cable harnesses to reduce the liftoff weight of future space flight...
SpaceWire model development technology for satellite architecture.
Energy Technology Data Exchange (ETDEWEB)
Eldridge, John M.; Leemaster, Jacob Edward; Van Leeuwen, Brian P.
2011-09-01
Packet switched data communications networks that use distributed processing architectures have the potential to simplify the design and development of new, increasingly more sophisticated satellite payloads. In addition, the use of reconfigurable logic may reduce the amount of redundant hardware required in space-based applications without sacrificing reliability. These concepts were studied using software modeling and simulation, and the results are presented in this report. Models of the commercially available, packet switched data interconnect SpaceWire protocol were developed and used to create network simulations of data networks containing reconfigurable logic with traffic flows for timing system distribution.
Energy Technology Data Exchange (ETDEWEB)
Amirabadizadeh, A. [Department of Physics, University of Birjand, P. O. Box 97175-615, Birjand (Iran, Islamic Republic of); Lotfollahi, Z., E-mail: lotfollahi@gmail.com [Department of Physics, University of Birjand, P. O. Box 97175-615, Birjand (Iran, Islamic Republic of); Zelati, A. [Department of Electrical Engineering, Technical Faculty of Ferdows, University of Birjand (Iran, Islamic Republic of)
2016-10-01
Giant magnetoimpedance effect (GMI) in Co{sub 68.15} Fe{sub 4.35} Si{sub 12.5} B{sub 15} amorphous wire was studied in the presence of magnetite ferrofluid and without it. Magnetite nanoparticles for ferrofluid were prepared by the traditional wet chemistry co-precipitation method. GMI was measured in the frequency range of 2 to 6 MHz. The maximum value of GMI value of the ferrofluid covered amorphous wire was increased in all frequency intervals in comparison with GMI response of the wire non-covered by ferrofluid. These results open a new way of increasing magnetoimpedance effect value useful for sensor applications. - Highlights: • Amorphous Co-based wires display GMI effect and this feature is of potential interest for developing small magnetic field sensors and biosensors. • This manuscript is dealing with the improvement of the GMI response of an amorphous Co-based wire/magnetite ferrofluid. • The effect of ferrofluid presence in the sensing element is also analyzed. • The results show that GMI maximum increases in a 100% at 4.5 MHz and the sensitivity also does about a 150%. • Amorphous Co-based wires display giant magneto impedance effect (GMI) and this intrinsic feature is of potential interest for developing small magnetic field sensors and biosensors. • This manuscript is dealing with the improvement of the GMI response of an amorphous Co{sub 68.15}Fe{sub 4.35}Si{sub 12.5}B{sub 15} wire/magnetite ferrofluid. • The effect of ferrofluid presence in the sensing element is also analyzed. • The results show that GMI maximum increases in a 100% at 4.5 MHz and the sensitivity also does about a 150%.
Heat transfer on HLM cooled wire-spaced fuel pin bundle simulator in the NACIE-UP facility
Energy Technology Data Exchange (ETDEWEB)
Di Piazza, Ivan, E-mail: ivan.dipiazza@enea.it [Italian National Agency for New Technologies, Energy and Sustainable Economic Development, C.R. ENEA Brasimone, Camugnano (Italy); Angelucci, Morena; Marinari, Ranieri [University of Pisa, Dipartimento di Ingegneria Civile e Industriale, Pisa (Italy); Tarantino, Mariano [Italian National Agency for New Technologies, Energy and Sustainable Economic Development, C.R. ENEA Brasimone, Camugnano (Italy); Forgione, Nicola [University of Pisa, Dipartimento di Ingegneria Civile e Industriale, Pisa (Italy)
2016-04-15
Highlights: • Experiments with a wire-wrapped 19-pin fuel bundle cooled by LBE. • Wall and bulk temperature measurements at three axial positions. • Heat transfer and error analysis in the range of low mass flow rates and Péclet number. • Comparison of local and section-averaged Nusselt number with correlations. - Abstract: The NACIE-UP experimental facility at the ENEA Brasimone Research Centre (Italy) allowed to evaluate the heat transfer coefficient of a wire-spaced fuel bundle cooled by lead-bismuth eutectic (LBE). Lead or lead-bismuth eutectic are very attractive as coolants for the GEN-IV fast reactors due to the good thermo-physical properties and the capability to fulfil the GEN-IV goals. Nevertheless, few experimental data on heat transfer with heavy liquid metals (HLM) are available in literature. Furthermore, just a few data can be identified on the specific topic of wire-spaced fuel bundle cooled by HLM. Additional analysis on thermo-fluid dynamic behaviour of the HLM inside the subchannels of a rod bundle is necessary to support the design and safety assessment of GEN. IV/ADS reactors. In this context, a wire-spaced 19-pin fuel bundle was installed inside the NACIE-UP facility. The pin bundle is equipped with 67 thermocouples to monitor temperatures and analyse the heat transfer behaviour in different sub-channels and axial positions. The experimental campaign was part of the SEARCH FP7 EU project to support the development of the MYRRHA irradiation facility (SCK-CEN). Natural and mixed circulation flow regimes were investigated, with subchannel Reynolds number in the range Re = 1000–10,000 and heat flux in the range q″ = 50–500 kW/m{sup 2}. Local Nusselt numbers were calculated for five sub-channels in different ranks at three axial positions. Section-averaged Nusselt number was also defined and calculated. Local Nusselt data showed good consistency with some of the correlation existing in literature for heat transfer in liquid metals
Heat transfer on HLM cooled wire-spaced fuel pin bundle simulator in the NACIE-UP facility
International Nuclear Information System (INIS)
Di Piazza, Ivan; Angelucci, Morena; Marinari, Ranieri; Tarantino, Mariano; Forgione, Nicola
2016-01-01
Highlights: • Experiments with a wire-wrapped 19-pin fuel bundle cooled by LBE. • Wall and bulk temperature measurements at three axial positions. • Heat transfer and error analysis in the range of low mass flow rates and Péclet number. • Comparison of local and section-averaged Nusselt number with correlations. - Abstract: The NACIE-UP experimental facility at the ENEA Brasimone Research Centre (Italy) allowed to evaluate the heat transfer coefficient of a wire-spaced fuel bundle cooled by lead-bismuth eutectic (LBE). Lead or lead-bismuth eutectic are very attractive as coolants for the GEN-IV fast reactors due to the good thermo-physical properties and the capability to fulfil the GEN-IV goals. Nevertheless, few experimental data on heat transfer with heavy liquid metals (HLM) are available in literature. Furthermore, just a few data can be identified on the specific topic of wire-spaced fuel bundle cooled by HLM. Additional analysis on thermo-fluid dynamic behaviour of the HLM inside the subchannels of a rod bundle is necessary to support the design and safety assessment of GEN. IV/ADS reactors. In this context, a wire-spaced 19-pin fuel bundle was installed inside the NACIE-UP facility. The pin bundle is equipped with 67 thermocouples to monitor temperatures and analyse the heat transfer behaviour in different sub-channels and axial positions. The experimental campaign was part of the SEARCH FP7 EU project to support the development of the MYRRHA irradiation facility (SCK-CEN). Natural and mixed circulation flow regimes were investigated, with subchannel Reynolds number in the range Re = 1000–10,000 and heat flux in the range q″ = 50–500 kW/m"2. Local Nusselt numbers were calculated for five sub-channels in different ranks at three axial positions. Section-averaged Nusselt number was also defined and calculated. Local Nusselt data showed good consistency with some of the correlation existing in literature for heat transfer in liquid metals for
Neudeck, Philip G.; Krasowski, Michael J.; Chen, Liang-Yu; Prokop, Norman F.
2009-01-01
The NASA Glenn Research Center has previously reported prolonged stable operation of simple prototype 6H-SiC JFET integrated circuits (logic gates and amplifier stages) for thousands of hours at +500 C. This paper experimentally investigates the ability of these 6H-SiC JFET devices and integrated circuits to also function at cold temperatures expected to arise in some envisioned applications. Prototype logic gate ICs experimentally demonstrated good functionality down to -125 C without changing circuit input voltages. Cascaded operation of gates at cold temperatures was verified by externally wiring gates together to form a 3-stage ring oscillator. While logic gate output voltages exhibited little change across the broad temperature range from -125 C to +500 C, the change in operating frequency and power consumption of these non-optimized logic gates as a function of temperature was much larger and tracked JFET channel conduction properties.
Transient Response of Thin Wire above a Layered Half-Space Using TDIE/FDTD Hybrid Method
Directory of Open Access Journals (Sweden)
Bing Wei
2012-01-01
Full Text Available The TDIE/FDTD hybrid method is applied to calculate the transient responses of thin wire above a lossy layered half-space. The time-domain reflection of the layered half space is computed by one-dimensional modified FDTD method. Then, transient response of thin wire induced by two excitation sources (the incident wave and reflected wave is calculated by TDIE method. Finally numerical results are given to illustrate the feasibility and high efficiency of the presented scheme.
Bobkov, S. G.; Serdin, O. V.; Arkhangelskiy, A. I.; Arkhangelskaja, I. V.; Suchkov, S. I.; Topchiev, N. P.
The problem of electronic component unification at the different levels (circuits, interfaces, hardware and software) used in space industry is considered. The task of computer systems for space purposes developing is discussed by example of scientific data acquisition system for space project GAMMA-400. The basic characteristics of high reliable and fault tolerant chips developed by SRISA RAS for space applicable computational systems are given. To reduce power consumption and enhance data reliability, embedded system interconnect made hierarchical: upper level is Serial RapidIO 1x or 4x with rate transfer 1.25 Gbaud; next level - SpaceWire with rate transfer up to 400 Mbaud and lower level - MIL-STD-1553B and RS232/RS485. The Ethernet 10/100 is technology interface and provided connection with the previously released modules too. Systems interconnection allows creating different redundancy systems. Designers can develop heterogeneous systems that employ the peer-to-peer networking performance of Serial RapidIO using multiprocessor clusters interconnected by SpaceWire.
Detection of a buried wire with two resistively loaded wire antennas
Vossen, S.H.J.A.; Tijhuis, A.G.; Lepelaars, E.S.A.M.; Zwamborn, A.P.M.
2002-01-01
The use of two identical straight thin-wire antennas for the detection of a buried wire is analyzed with the aid of numerical calculations. The buried wire is located below an interface between two homogeneous half-spaces. The detection setup, which is formed by a transmitting and a receiving wire,
Thermal poling of multi-wire array optical fiber
DEFF Research Database (Denmark)
Huang, Lin; An, Honglin; Hayashi, Juliano G.
2018-01-01
We demonstrate in this paper thermal poling of multi-wire array fibers, which extends poling of fibers with two anodes to similar to 50 and similar to 500 wire array anodes. The second harmonic microscopy observations show that second order nonlinearity (SON) layers are developed surrounding all...... the rings of wires in the similar to 50 anode array fiber with poling of 1.8kV, 250 degrees C and 30min duration, and the outer rings of the similar to 500 anode array fiber at lower poling temperature. Our simulations based on a two-dimensional charge dynamics model confirm this can be explained...
Niobium Titanium and Copper wire samples
2009-01-01
Two wire samples, both for carrying 13'000Amperes. I sample is copper. The other is the Niobium Titanium wiring used in the LHC magnets. The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. Magnet coils are made of copper-clad niobium–titanium cables — each wire in the cable consists of 9’000 niobium–titanium filaments ten times finer than a hair. The cables carry up to 12’500 amps and must withstand enormous electromagnetic forces. At full field, the force on one metre of magnet is comparable ...
Simulated Space Environmental Effects on Thin Film Solar Array Components
Finckenor, Miria; Carr, John; SanSoucie, Michael; Boyd, Darren; Phillips, Brandon
2017-01-01
The Lightweight Integrated Solar Array and Transceiver (LISA-T) experiment consists of thin-film, low mass, low volume solar panels. Given the variety of thin solar cells and cover materials and the lack of environmental protection typically afforded by thick coverglasses, a series of tests were conducted in Marshall Space Flight Center's Space Environmental Effects Facility to evaluate the performance of these materials. Candidate thin polymeric films and nitinol wires used for deployment were also exposed. Simulated space environment exposures were selected based on SSP 30425 rev. B, "Space Station Program Natural Environment Definition for Design" or AIAA Standard S-111A-2014, "Qualification and Quality Requirements for Space Solar Cells." One set of candidate materials were exposed to 5 eV atomic oxygen and concurrent vacuum ultraviolet (VUV) radiation for low Earth orbit simulation. A second set of materials were exposed to 1 MeV electrons. A third set of samples were exposed to 50, 100, 500, and 700 keV energy protons, and a fourth set were exposed to >2,000 hours of near ultraviolet (NUV) radiation. A final set was rapidly thermal cycled between -55 and +125degC. This test series provides data on enhanced power generation, particularly for small satellites with reduced mass and volume resources. Performance versus mass and cost per Watt is discussed.
14 CFR 125.145 - Firewall construction.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewall construction. 125.145 Section 125.145 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Requirements § 125.145 Firewall construction. Each firewall and shroud must— (a) Be so made that no hazardous...
Rucinski, Marek; Coates, Adam; Montano, Giuseppe; Allouis, Elie; Jameux, David
2015-09-01
The Lightweight Advanced Robotic Arm Demonstrator (LARAD) is a state-of-the-art, two-meter long robotic arm for planetary surface exploration currently being developed by a UK consortium led by Airbus Defence and Space Ltd under contract to the UK Space Agency (CREST-2 programme). LARAD has a modular design, which allows for experimentation with different electronics and control software. The control system architecture includes the on-board computer, control software and firmware, and the communication infrastructure (e.g. data links, switches) connecting on-board computer(s), sensors, actuators and the end-effector. The purpose of the control system is to operate the arm according to pre-defined performance requirements, monitoring its behaviour in real-time and performing safing/recovery actions in case of faults. This paper reports on the results of a recent study about the feasibility of the development and integration of a novel control system architecture for LARAD fully based on the SpaceWire protocol. The current control system architecture is based on the combination of two communication protocols, Ethernet and CAN. The new SpaceWire-based control system will allow for improved monitoring and telecommanding performance thanks to higher communication data rate, allowing for the adoption of advanced control schemes, potentially based on multiple vision sensors, and for the handling of sophisticated end-effectors that require fine control, such as science payloads or robotic hands.
Flow of ideal fluid through a central region of a nuclear reactor wire-spaced fuel subassembly
International Nuclear Information System (INIS)
Schmid, J.
1991-04-01
The results are given of calculations of the flow of an ideal fluid through the central region of a nuclear reactor wire-spaced fuel subassembly. The computer code used is briefly described. (author). 10 figs., 4 refs
X-ray reciprocal space mapping of GaAs.AIAs quantum wires and quantum dots
Darhuber, A.A.; Koppensteiner, E.; Bauer, G.; Wang, P.D.; Song, Y.P.; Sotomayor Torres, C.M.; Holland, M.C.
1995-01-01
Periodic arrays of 150 and 175 nm-wide GaAs–AlAs quantum wires and quantum dots were investigated, fabricated by electron beam lithography, and SiCl4/O2 reactive ion etching, by means of reciprocal space mapping using triple axis x-ray diffractometry. From the x-ray data the lateral periodicity of
International Nuclear Information System (INIS)
Nowik, I.; Felner, I.; Garcia-Miquel, H.
2007-01-01
Thermo-gravimetric, differential scanning calorimetry and comprehensive 57 Fe Moessbauer spectroscopy studies of amorphous and crystalline ferromagnetic glass coated (Co 0.2 Fe 0.8 ) 72.5 Si 12.5 B 15 micro-wires have been recorded. The Curie temperature of the amorphous phase is T C (amorp) ∼730 K. The analysis of the Moessbauer spectra reveals that below 623 K the easy axis of the magnetization is axial-along the wires, and that a tangential or/and radial orientation occurs at higher temperatures. At 770 K, in the first 4 hours the Moessbauer spectrum exhibits a pure paramagnetic doublet. Crystallization and decomposition to predominantly α-Fe(Si) and Fe 2 B occurs either by raising the temperature above 835 K or isothermally in time at lower temperatures. Annealing for a day at 770 K, leads to crystallization. In the crystalline material the magnetic moments have a complete random orientation. After cooling back to ambient temperature, both α-Fe(Si) and Fe 2 B in the glass coated wire show pure axial magnetic orientation like in the original amorphous state. The observed spin reorientations are associated with changes in the stress induced by the glass coating
Tensile stress dependence of the magnetostatic interaction between Fe-rich wires
International Nuclear Information System (INIS)
Gawronski, P.; Zhukov, A.; Blanco, J.M.; Gonzalez, J.; KuIakowski, K.
2005-01-01
We study the influence of the applied tensile stress on the magnetostatic interaction between two amorphous Fe-rich wires. The hysteresis loop is measured for: (i) conventional wires produced by in-rotation-water method, with diameter of 125μm (ii) cold-drawn wires with diameter of 50μm. The stress dependence of the interaction field is evaluated from the shape of the hysteresis loops, which show characteristic two-step behaviour. These steps mark the values of the switching field of the wires. For the conventional wires the tensile stress dependence of the interaction field can be explained as a result of the tensile stress dependence of the magnetization. For the cold-drawn wires, the interaction field shows a maximum with the applied stress. This behaviour is interpreted as a consequence of a local variation of the domain structure at the wire ends. It modifies the stray field, and-as a consequence-the switching field of the neighbouring wire
Takashima, Takeshi; Ogawa, Emiko; Asamura, Kazushi; Hikishima, Mitsuru
2018-05-01
Arase is a small scientific satellite program conducted by the Institute of Space and Astronautical Science/Japan Aerospace Exploration Agency, which is dedicated to the detailed study of the radiation belts around Earth through in situ observations. In particular, the goal is to directly observe the interaction between plasma waves and particles, which cause the generation of high-energy electrons. To observe the waves and particles in detail, we must record large volumes of burst data with high transmission rates through onboard mission network systems. For this purpose, we developed a high-speed and highly reliable mission network based on SpaceWire, as well as a new and large memory data recorder equipped with a data search function based on observation time (the time index, TI, is the satellite time starting from when the spacecraft is powered on.) with respect to the orbital data generated in large quantities. By adopting a new transaction concept of a ring topology network with SpaceWire, we could secure a redundant mission network system without using large routers and having to suppress the increase in cable weight. We confirmed that their orbit performs as designed.[Figure not available: see fulltext.
Sheftman, D; Shafer, D; Efimov, S; Gruzinsky, K; Gleizer, S; Krasik, Ya E
2012-10-01
A time- and space-resolved hard x-ray source was developed as a diagnostic tool for imaging underwater exploding wires. A ~4 ns width pulse of hard x-rays with energies of up to 100 keV was obtained from the discharge in a vacuum diode consisting of point-shaped tungsten electrodes. To improve contrast and image quality, an external pulsed magnetic field produced by Helmholtz coils was used. High resolution x-ray images of an underwater exploding wire were obtained using a sensitive x-ray CCD detector, and were compared to optical fast framing images. Future developments and application of this diagnostic technique are discussed.
Wiring Damage Analyses for STS OV-103
Thomas, Walter, III
2006-01-01
This study investigated the Shuttle Program s belief that Space Transportation System (STS) wiring damage occurrences are random, that is, a constant occurrence rate. Using Problem Reporting and Corrective Action (PRACA)-derived data for STS Space Shuttle OV-103, wiring damage was observed to increase over the vehicle s life. Causal factors could include wiring physical deterioration, maintenance and inspection induced damage, and inspection process changes resulting in more damage events being reported. Induced damage effects cannot be resolved with existent data. Growth analysis (using Crow-AMSAA, or CA) resolved maintenance/inspection effects (e.g., heightened awareness) on all wire damages and indicated an overall increase since Challenger Return-to-Flight (RTF). An increasing failure or occurrence rate per flight cycle was seen for each wire damage mode; these (individual) rates were not affected by inspection process effects, within statistical error.
Heat treatment effect on the mechanical properties of industrial drawn copper wires
International Nuclear Information System (INIS)
Beribeche, Abdellatif; Boumerzoug, Zakaria; Ji, Vincent
2013-01-01
In this present investigation, the mechanical properties of industrial drawn copper wires have been studied by tensile tests. The effect of prior heat treatments at 500°C on the drawn wires behavior was the main goal of this investigation. We have found that the mechanical behavior of drawn wires depends strongly on those treatments. SEM observations of the wire cross section after tensile tests have shown that the mechanism of rupture was mainly controlled by the void formation
Directory of Open Access Journals (Sweden)
Tom Baines
2018-04-01
Full Text Available CdTe wires have been fabricated via a catalyst free method using the industrially scalable physical vapor deposition technique close space sublimation. Wire growth was shown to be highly dependent on surface roughness and deposition pressure, with only low roughness surfaces being capable of producing wires. Growth of wires is highly (111 oriented and is inferred to occur via a vapor-solid-solid growth mechanism, wherein a CdTe seed particle acts to template the growth. Such seed particles are visible as wire caps and have been characterized via energy dispersive X-ray analysis to establish they are single phase CdTe, hence validating the self-catalysation route. Cathodoluminescence analysis demonstrates that CdTe wires exhibited a much lower level of recombination when compared to a planar CdTe film, which is highly beneficial for semiconductor applications.
X-ray backlighting of two-wire Z-pinch plasma using X-pinch
International Nuclear Information System (INIS)
Tong, Zhao; Xiao-Bing, Zou; Ran, Zhang; Xin-Xin, Wang
2010-01-01
Two 50-μm Mo wires in parallel used as a Z-pinch load are electrically exploded with a pulsed current rising to 275 kA in 125 ns and their explosion processes are backlighted using an X-pinch as an x-ray source. The backlighting images show clearly the processes similar to those occurring in the initial stages of a cylindrical wire-array Z-pinch, including the electric explosion of single wires characterised by the dense wire cores surrounded by a low-density coronal plasma, the expansion of the exploding wire, the sausage instability (m = 0) in the coronal plasma around each wire, the motion of the coronal plasma as well as the wire core toward the current centroid, the formation of the precursor plasma column with a twist structure something like that of higher mode instability, especially the kink instability (m = 1). (fluids, plasmas and electric discharges)
Model-Based Testability Assessment and Directed Troubleshooting of Shuttle Wiring Systems
Deb, Somnath; Domagala, Chuck; Shrestha, Roshan; Malepati, Venkatesh; Cavanaugh, Kevin; Patterson-Hine, Ann; Sanderfer, Dwight; Cockrell, Jim; Norvig, Peter (Technical Monitor)
2000-01-01
We have recently completed a pilot study on the Space shuttle wiring system commissioned by the Wiring Integrity Research (WIRe) team at NASA Ames Research Center, As the space shuttle ages, it is experiencing wiring degradation problems including arcing, chaffing insulation breakdown and broken conductors. A systematic and comprehensive test process is required to thoroughly test and quality assure (QA) the wiring systems. The NASA WIRe team recognized the value of a formal model based analysis for risk-assessment and fault coverage analysis. However. wiring systems are complex and involve over 50,000 wire segments. Therefore, NASA commissioned this pilot study with Qualtech Systems. Inc. (QSI) to explore means of automatically extracting high fidelity multi-signal models from wiring information database for use with QSI's Testability Engineering and Maintenance System (TEAMS) tool.
Corrections to air kerma rate measurements of 125I brachytherapy sources to free space conditions
International Nuclear Information System (INIS)
Shipley, D.R.; Duane, S.
1994-05-01
Air kerma rate measurements have been made between 40 cm and 100 cm from one of a set of 125 I reference sources within the facilities of Amersham International plc. Monte Carlo techniques have been used to calculate the air kerma rate components over the same range of distances from this source. After comparing the calculated data with measurements, the compliance of the data with the inverse square law was investigated, and corrections were derived to obtain the air kerma rate at 1 m in free space from each source. Simulations of the experimental setup with an isotropic monoenergetic point source close to the effective energy of 125 I were found to reproduce the air kerma rate measurements reasonably accurately, and indicated that the contribution due to scattered photons was significant. The overall correction (which is defined as the product of individual corrections for chamber size effect, air attenuation and radiation scatter) required to the inverse square law to obtain the air kerma rate at 1 m in free space was found to be 0.981, 0.984 and 0.980, respectively, for air kerma rate measurements at 40 cm, 60 cm and 100 cm from the 125 I reference source. The total uncertainty in these corrections was estimated to be 0.88% at the 1σ level. (author)
B218 Weld Filler Wire Characterization for Al-Li Alloy 2195
Bjorkman, Gerry; Russell, Carolyn
2000-01-01
NASA Marshall Space Flight Center, Lockheed Martin Space Systems- Michoud Operations, and McCook Metals have developed an aluminum-copper weld filler wire for fusion welding aluminum lithium alloy 2195. The aluminum-copper based weld filler wire has been identified as B218, a McCook Metals designation. B218 is the result of six years of weld filler wire development funded by NASA, Lockheed Martin, and McCook Metals. The filler wire chemistry was developed to produce enhanced 2195 weld and repair weld mechanical properties over the 4043 aluminum-silicon weld filler wire, which is currently used to weld 2195 on the Super Lightweight External Tank for the NASA Space Shuttle Program. An initial characterization was performed consisting of a repair weld evaluation using B218 and 4043 weld filler wires. The testing involved room temperature and cryogenic repair weld tensile testing along with fracture toughness testing. From the testing, B218 weld filler wire produce enhanced repair weld tensile strength, ductility, and fracture properties over 4043. B218 weld filler wire has proved to be a superior weld filler wire for welding aluminum lithium alloy 2195 over 4043.
Characterization of NbTi multifilamentary superconducting wires
International Nuclear Information System (INIS)
Vellego, G.
1988-01-01
Pirelli is developing superconducting mulfilamentary NbTi wires, with current carrying capacities of up to 500 A, for use in magnetic resonance imaging (MRI) systems and in small research magnets. Pirelli and IFUSP have developed a system for assessing wire performance, whose quality is comparable to the equivalent systems at the Brookhaven National Laboratory (BNL) and at the National Bureau of Standards (NBS). In particular, a high sensitivity is required for critical current measurements, so that the modern criteria for definition of critical current can be used. These involve conductor resistivities of the order of 10 -12 ohm-cm. The methods of measurements of critical current in applied magnetic fields, of residual resistance ratio and of copper to superconductor ratio are described. The results of the first tests performed in Pirelli wires and in wires of other manufacturers are described. These include tests on a NBS standard reference material. These results are of the same quality as results obtained at BNL or NBS on the same wires. So this system can be very useful throughout the Pirelli program. (author) [pt
14 CFR 135.125 - Aircraft security.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Aircraft security. 135.125 Section 135.125....125 Aircraft security. Certificate holders conducting operators conducting operations under this part must comply with the applicable security requirements in 49 CFR chapter XII. [67 FR 8350, Feb. 22, 2002] ...
14 CFR 1203.500 - Use of derivative classification.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of derivative classification. 1203.500 Section 1203.500 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INFORMATION SECURITY PROGRAM Derivative Classification § 1203.500 Use of derivative classification. The application of...
A laser-wire system for the International Linear Collider
Indian Academy of Sciences (India)
A new laser-wire has been installed in the extraction line of the ATF at KEK. It aims at demonstrating ... beam size measurements to extract the phase space of the electron and positron ... the laser-wire (LW), instead of a conventional solid wire.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Firewalls. 125.143 Section 125.143....143 Firewalls. Each engine, auxiliary power unit, fuel-burning heater, or other item of combusting... of firewalls or shrouds, or by other equivalent means. ...
National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project will investigate a new architecture for photovoltaic devices based on nanotechnology: photovoltaic wire. The...
14 CFR 125.355 - Airplane equipment.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane equipment. 125.355 Section 125.355...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Release Rules § 125.355 Airplane...
14 CFR 125.93 - Airplane limitations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations. 125.93 Section 125.93...: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements § 125.93 Airplane...
International Nuclear Information System (INIS)
Yang, Y.S.; Bae, J.G.; Park, C.G.
2008-01-01
In this study, the effects of annealing at a low temperature on the bending fatigue resistance have been investigated in the hyper-eutectoid steel wires drawn to an extreme strain of 4.12. The annealing temperature was varied from 100 to 500 deg. C. The bending fatigue resistance of the steel wires was measured by a Hunter rotating beam tester specially designed for thin-sized steel wires. The results showed that fatigue resistance as well as tensile strength improved as the annealing temperature increased up to 200 deg. C (Region I) and gradually decreased after annealing above 200 deg. C (Region II). In order to elucidate this behavior, residual stress was measured by dual beam FIB, surface defects observed by an optical 3D profiler and the microstructure in terms of lamellar spacing (λ p ) and cementite thickness (t c ) was observed by TEM
Tumor therapy with 125I-octreotide and 125I-UdR
International Nuclear Information System (INIS)
Fan, W.; Zhu, R.; Yang, C.; Sun, J.J.; Xu, Y.J.; Zhang, Y.J.; Wu, M.J.; Wang, D.J.
2005-01-01
Purpose: To determine the tumor cell damage effect with Auger-electron emitter 125 I in different chemical states. Methods: (1) [Tyr 3 ] octreotide (TOC) and UdR are labeled with 125 I,respectively. (2) Receptor analysis of 125 I-TOC on small cell lung cancer (SCLC) NCI-H446 cell lines is performed comparing with normal lymph cells. NCI-H446 cells added various dose of 125 I-TOC are incubated for different time with 125 I-Nal and non-labeled TOC as control. The capacity of NCI-H446 cell lines bound and internalization of 125 I TOC are determined. The radiation damage of tumor cells is measured by MTF methods. (3) The killing effects of 125 I-UdR in human pancreatic cancer cell line Bax-Pc and Sca-BER bladder carcinoma cells are evaluated with the similar methods. I-UdR penetrating into the Sca-BER cell nucleus is observed with confocal microscope. The grow suppression and clonogenic formation of Sca-BER cells after incubation with 125 I-UdR are analyzed. Proliferation fraction and S phase cell fraction of Sca-BER cell added 125 I-UdR is measured with flow cytometric analysis. Results: (1) Kd=(0.56∼2.0) x 10 -11 mol/L and B max =(1.17∼2.0) x 10 5 cell site are obtained by receptor analysis of 125 I-TOC on NCI-H446 cells. Comparatively, the difference between total binding and non-specific binding is low and there is no saturation of specific binding for normal lymphocyte. About 50% of 125 I-TOC is internalized into the NCI-H446 cell nucleus at 24h after incubation. The damige of NCI-H446 cells by 125 I-TOC is clearly observed. (2) The penetration amount of 125 I-UdR into cell nucleus increases with the incubate time when the concentration of 125 I-UdR is in the range of 10∼500 kBq/mL and reaches the peak fraction of 94% at 36 h after incubation. The radioactivity of 125 I-UdR is then achieved equelibration and no more increased with time. The linear correlation with γ=0.867∼0.978 between the concentration of 125 I-UdR in cell nucleus and the incubation time
Enhancement of giant magnetoimpedance in composite wire with insulator layer
International Nuclear Information System (INIS)
Wang, X.Z.; Yuan, W.Z.; Li, X.D.; Ruan, J.Z.; Zhao, Z.J.; Yang, J.X.; Yang, X.L.; Sun, Z.
2007-01-01
CuBe/NiFeB and CuBe/Insulator/NiFeB composite wires have been prepared by electroless-deposition. The giant magnetoimpedance (GMI) effect for NiFeB layer with thickness of 3 μm on CuBe core with diameter of 100 μm has been studied. After adding an insulator layer, the maximal GMI ratio of CuBe/Insulator/NiFeB composite wire is much higher than that of CuBe/NiFeB composite wire, and can reach to about 250% at the frequency range of 500 kHz-1 MHz. The results are explained in terms of difference of magnetic structure and different frequency dependence of resistance and reactance of the two kinds of composite wires
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Employment. 1253.500 Section 1253.500... in Employment in Education Programs or Activities Prohibited § 1253.500 Employment. (a) General. (1..., or be subjected to discrimination in employment, or recruitment, consideration, or selection therefor...
14 CFR 125.363 - Flight release over water.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight release over water. 125.363 Section 125.363 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED... Flight release over water. (a) No person may release an airplane for a flight that involves extended...
Development of wire wrapping technology for FBR fuel pin
International Nuclear Information System (INIS)
Nogami, Tetsuya; Seki, Nobuo; Sawayama, Takeo; Ishibashi, Takashi
1991-01-01
For the FBR fuel assembly, the spacer wire is adopted to maintain the space between fuel pins. The developments have been carried out to achieve automatically wire wrapping with high precision. Based on the fundamental technology developed through the mock-up test operation, Joyo 'MK-I', fuel pin fabrication was started using partially mechanized wire wrapping machine in 1973. In 1978, an automated wire wrapping machine for Joyo 'MK-II' was developed by the adoption of some improvements for the wire inserting system to end plug hole and the precision of wire pitch. On the bases of these experiences, fully automated wire wrapping machine for 'Monju' fuel pin was installed at Plutonium Fuel Production Facility (PFPF) in 1987. (author)
Dipole model slice made in 1994 by Ansaldo. The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. 50’000 tonnes of steel sheets are used to make the magnet yokes that keep the wiring firmly in place. The yokes constitute approximately 80% of the accelerator's weight and, placed side by side, stretch over 20 km!
Diamond wire cutting of heat exchangers
International Nuclear Information System (INIS)
Beckman, T.R.; Bjerler, J.
1991-01-01
With the change-out of equipment at nuclear power plants comes large quantities of low level contaminated metallic waste. Of particular concern are large heat exchangers, preheaters and steam generators. These bulky items consume huge volumes of burial space. The need for volume reduction and recycling of these metals has created new demands for 'how' to cut heat exchangers into useful sizes for decontamination, melting or compaction. This paper reviews the cutting solution provided by a diamond wire system, with particular regard for cutting of a Ringhals Preheater Bundle at Studsvik Nuclear in 1989. The background of diamond wire sawing is discussed and basic components of wire sawing are explained. Other examples of wire cutting decommissioned components are also given. (author)
14 CFR 125.7 - Display of certificate.
2010-01-01
... OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT General § 125.7 Display of certificate. (a) The certificate holder must display a true copy of the certificate in each of its aircraft. (b... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Display of certificate. 125.7 Section 125.7...
Sample of superconducting wiring from the LHC
The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. Magnet coils are made of copper-clad niobium–titanium cables — each wire in the cable consists of 9’000 niobium–titanium filaments ten times finer than a hair. The cables carry up to 12’500 amps and must withstand enormous electromagnetic forces. At full field, the force on one metre of magnet is comparable to the weight of a jumbo jet. Coil winding requires great care to prevent movements as the field changes. Friction can create hot spots wh...
Detection of a buried object with pulse-compensated wire antennas
Vossen, S.H.J.A.; Tijhuis, A.G.; Lepelaars, E.S.A.M.; Zwamborn, A.P.M.
2003-01-01
For the detection of a buried object we consider two straight thin-wire antennas above an interface between two homogeneous dielectric half spaces. One antenna is a transmitting wire and the other is a receiving wire. Our aim is to use this simple antenna set up for the detection of buried objects
14 CFR 125.127 - Location of fuel tanks.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Location of fuel tanks. 125.127 Section 125... Requirements § 125.127 Location of fuel tanks. (a) Fuel tanks must be located in accordance with § 125.153. (b... compartment may be used as the wall of an integral tank. (c) Fuel tanks must be isolated from personnel...
International Nuclear Information System (INIS)
Pinitsoontorn, S.; Badini Confalonieri, G.A..; Davies, H.A.; Gibbs, M.R.J.
2005-01-01
Amorphous alloy wires of composition (Co x Fe y Ni z ) 72.5 Si 12.5 B 15 , with Ni substituted for both Co and Fe, were prepared by the rotating water bath chill cast technique. The maximum Ni content that can be substituted in order to cast amorphous wire is reported. The effects of Ni addition on the hysteresis loop parameters and the major magnetic properties of the as-cast wire are reported
Metallization of a Rashba wire by a superconducting layer in the strong-proximity regime
Reeg, Christopher; Loss, Daniel; Klinovaja, Jelena
2018-04-01
Semiconducting quantum wires defined within two-dimensional electron gases and strongly coupled to thin superconducting layers have been extensively explored in recent experiments as promising platforms to host Majorana bound states. We study numerically such a geometry, consisting of a quasi-one-dimensional wire coupled to a disordered three-dimensional superconducting layer. We find that, in the strong-coupling limit of a sizable proximity-induced superconducting gap, all transverse subbands of the wire are significantly shifted in energy relative to the chemical potential of the wire. For the lowest subband, this band shift is comparable in magnitude to the spacing between quantized levels that arises due to the finite thickness of the superconductor (which typically is ˜500 meV for a 10-nm-thick layer of aluminum); in higher subbands, the band shift is much larger. Additionally, we show that the width of the system, which is usually much larger than the thickness, and moderate disorder within the superconductor have almost no impact on the induced gap or band shift. We provide a detailed discussion of the ramifications of our results, arguing that a huge band shift and significant renormalization of semiconducting material parameters in the strong-coupling limit make it challenging to realize a topological phase in such a setup, as the strong coupling to the superconductor essentially metallizes the semiconductor. This metallization of the semiconductor can be tested experimentally through the measurement of the band shift.
Laser shape setting of superelastic nitinol wires: Functional properties and microstructure
Tuissi, Ausonio; Coduri, Mauro; Biffi, Carlo Alberto
Shape setting is one of the most important steps in the production route of Nitinol Shape Memory Alloys (SMAs), as it can fix the functional properties, such as the shape memory effect and the superelasticity (SE). The conventional method for making the shape setting is performed at 400-500∘C in furnaces. In this work, a laser beam was adopted for performing straight shape setting on commercially available austenitic Nitinol thin wires. The laser beam, at different power levels, was moved along the wire length for inducing the functional performances. Calorimetric, pseudo-elastic and microstructural features of the laser annealed wires were studied through differential scanning calorimetry, tensile testing and high energy X-ray diffraction, respectively. It can be stated that the laser technology can induce SE in thin Nitinol wires: the wire performances can be modulated in function of the laser power and improved functional properties can be obtained.
Effect of iodine on the corrosion of Au-Al wire bonds
DEFF Research Database (Denmark)
Verdingovas, Vadimas; Müller, Lutz; Jellesen, Morten Stendahl
2015-01-01
Corrosion study was performed on Au-Al wire bonds, thin layers of sputter deposited Au and Al, and Au-Al intermetallic nuggets. The test environment was iodine-vapour in air (1. mg/L) at 85 °C with varying relative humidity, and 500 mg/L of KI in water. GDOES, XRD, SEM EDS, wire bond shear......, and electrochemical testing were used to characterize the samples. Failures of Au-Al wire bonds were found to be primarily attributed to the corrosion of Al via formation of Al iodides and consequent formation of Al oxides and/or hydroxides. Most susceptible to corrosion are Al metallization and Al rich intermetallic...
The effect of nickel electrodeposition on magnetic properties of CoFeSiB amorphous wire
International Nuclear Information System (INIS)
Atalay, F.E.
2004-01-01
Nickel films were electrodeposited on rapidly quenched amorphous wires from nitrate bath using a constant voltage. It was found that the pH of plating bath had a very strong effect on the formation of nickel films. The magnetic field, H, dependence of the impedance, of nickel plated (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 wires have been investigated using a Hewlett-Packard 4294A impedance analyser with 42941A impedance probe. The best elecroplating condition and GMI response were obtained for the plated wire at pH 5 for 30 min plating time
A space release/deployment system actuated by shape memory wires
Fragnito, Marino; Vetrella and, Sergio
2002-11-01
In this paper, the design of an innovative hold down/release and deployment device actuated by shape memory wires, to be used for the first time for the S MA RT microsatellite solar wings is shown. The release and deployment mechanisms are actuated by a Shape Memory wire (Nitinol), which allows a complete symmetrical and synchronous release, in a very short time, of the four wings in pairs. The hold down kinematic mechanism is preloaded to avoid vibration nonlinearities and unwanted deployment at launch. The deployment mechanism is a simple pulley system. The stiffness of the deployed panel-hinge system needs to be dimensioned in order to meet the on-orbit requirement for attitude control. One-way roller clutches are used to keep the panel at the desired angle during the mission. An ad hoc software has been developed to simulate both the release and deployment operations, coupling the SMA wire behavior with the system mechanics.
Thermoelectric Mechanism and Interface Characteristics of Cyanide-Free Nanogold-Coated Silver Wire
Tseng, Yi-Wei; Hung, Fei-Yi; Lui, Truan-Sheng
2016-01-01
Traditional bath-plated gold contains a cyanide complex, which is an environmental hazard. In response, our study used a green plating process to produce cyanide-free gold-coated silver (cyanide-free ACA) bonding wire that has been proven to be a feasible alternative to gold bonding wire in semiconductor packaging. In this work, ACA wire annealed at 550°C was found to have stable microstructure and superior mechanical properties. Intermetallic compounds Ag2Al and AuAl2 grew from Ag-Au balls and Al pads after aging at 175°C for 500 h. After current testing, ACA wire was found to have improved electrical properties due to equiaxed grain growth. The gold nanolayer on the Ag surface increased the oxidation resistance. These results provide insights regarding the reliability of ACA wire in advanced bonding processes.
Application of irradiation process for the production of thin wall wires
International Nuclear Information System (INIS)
Saito, E.
1977-01-01
The demand for thin wall crosslinked PVC or polyethylene insulated wires in Japan was about 15,000,000 dollars in value in 1975. Their annual sales in 1980 are estimated at about 40 million dollars which will account for approximately 20% of the sales of all thin wall thermoplastic insulated wires expected for the same year. A comparative study was made of the irradiation process and the chemical process for manufacture of wires with crosslinked PVC or polyethylene insulation. Having found the excellence of the irradiation process an accelerator (500 KeV, 65mA) was installed in 1973 and production was begun of several types of thin wall irradiation crosslinked PVC and polyethylene insulated wires ranging from 0.06 mm 2 to 2.0 mm 2 in the cross-sectional area of conductor, successfully putting them in extensive commercial application. This report compares the irradiation process and the chemical process, properties of several types of irradiation crosslinked PVC, and polyethylene insulated wires and their applications. (author)
Flow pattern assessment in tubes with wire coil inserts in laminar and transition regimes
International Nuclear Information System (INIS)
Garcia, A.; Solano, J.P.; Vicente, P.G.; Viedma, A.
2007-01-01
The paper presents an analysis of the flow mechanisms in tubes with wire coils using hydrogen bubble visualization and PIV techniques. Results have been contrasted with experimental data on pressure drop. The relation between the observed flow patterns and the friction factor has been analysed. The experimental analysis that has been carried out allows one to state that at low Reynolds numbers (Re < 400) the flow in tubes with wire coils is basically similar to the flow in smooth tubes. At Reynolds numbers between 500 and 700 and in short pitch wire coils a recirculating flow appears. The insertion of wires coils in a smooth tube accelerates significantly the transition to turbulence. This is produced at Reynolds numbers between 700 and 1000 depending on the wire pitch
Confinement has no effect on visual space perception: The results of the Mars-500 experiment
Czech Academy of Sciences Publication Activity Database
Šikl, Radovan; Šimeček, Michal
2014-01-01
Roč. 76, č. 2 (2014), s. 438-451 ISSN 1943-3921 R&D Projects: GA ČR(CZ) GAP407/12/2528 Institutional support: RVO:68081740 Keywords : visual space perception * perspective * Mars-500 * size judgment * size constancy * confinement Subject RIV: AN - Psychology Impact factor: 2.168, year: 2014 http://dx.doi.org/10.3758/s13414-013-0594-y
Temperature Diffusion Distribution of Electric Wire Deteriorated by Overcurrent
Choi, Chung-Seog; Kim, Hyang-Kon; Kim, Dong-Woo; Lee, Ki-Yeon
This study presents thermal diffusion distribution of the electric wires when overcurrent is supplied to copper wires. And then, this study intends to provide a basis of knowledge for analyzing the causes of electric accidents through hybrid technology. In the thermal image distribution analysis of the electric wire to which fusing current was supplied, it was found that less heat was accumulated in the thin wires because of easier heat dispersion, while more heat was accumulated in the thicker wires. The 3-dimensional thermal image analysis showed that heat distribution was concentrated at the center of the wire and the inclination of heat distribution was steep in the thicker wires. When 81A was supplied to 1.6mm copper wire for 500 seconds, the surface temperature of wire was maximum 46.68°C and minimum 30.87°C. It revealed the initial characteristics of insulation deterioration that generates white smoke without external deformation. In the analysis with stereoscopic microscope, the surface turned dark brown and rough with the increase of fusing current. Also, it was known that exfoliation occurred when wire melted down with 2 times the fusing current. With the increase of current, we found the number of primary arms of the dendrite structure to be increased and those of the secondary and tertiary arms to be decreased. Also, when the overcurrent reached twice the fusing current, it was found that columnar composition, observed in the cross sectional structure of molten wire, appeared and formed regular directivity. As described above, we could present the burning pattern and change in characteristics of insulation and conductor quantitatively. And we could not only minimize the analysis error by combining the information but also present the scientific basis in the analysis of causes of electric accidents, mediation of disputes on product liability concerning the electric products.
Effect of wire shape on wire array discharge
International Nuclear Information System (INIS)
Shimomura, N.; Tanaka, Y.; Yushita, Y.; Nagata, M.; Teramoto, Y.; Katsuki, S.; Akiyama, H.
2001-01-01
Although considerable investigations have been reported on z-pinches to achieve nuclear fusion, little attention has been given from the point of view of how a wire array consisting of many parallel wires explodes. Instability existing in the wire array discharge has been shown. In this paper, the effect of wire shape in the wire array on unstable behavior of the wire array discharge is represented by numerical analysis. The claws on the wire formed in installation of wire may cause uniform current distribution on wire array. The effect of error of wire diameter in production is computed by Monte Carlo Method. (author)
Effect of wire shape on wire array discharge
Energy Technology Data Exchange (ETDEWEB)
Shimomura, N.; Tanaka, Y.; Yushita, Y.; Nagata, M. [University of Tokushima, Department of Electrical and Electronic Engineering, Tokushima (Japan); Teramoto, Y.; Katsuki, S.; Akiyama, H. [Kumamoto University, Department of Electrical and Computer Engineering, Kumamoto (Japan)
2001-09-01
Although considerable investigations have been reported on z-pinches to achieve nuclear fusion, little attention has been given from the point of view of how a wire array consisting of many parallel wires explodes. Instability existing in the wire array discharge has been shown. In this paper, the effect of wire shape in the wire array on unstable behavior of the wire array discharge is represented by numerical analysis. The claws on the wire formed in installation of wire may cause uniform current distribution on wire array. The effect of error of wire diameter in production is computed by Monte Carlo Method. (author)
14 CFR 125.211 - Seat and safety belts.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Seat and safety belts. 125.211 Section 125... Requirements § 125.211 Seat and safety belts. (a) No person may operate an airplane unless there are available... the airplane who is at least 2 years old; and (2) An approved safety belt for separate use by each...
Hierarchical structures in cold-drawn pearlitic steel wire
DEFF Research Database (Denmark)
Zhang, Xiaodan; Godfrey, Andrew; Hansen, Niels
2013-01-01
The microstructure and crystallography of drawn pearlitic steel wires have been quantified by a number of electron microscopy techniques including scanning electron microscopy, transmission electron microscopy, electron backscatter diffraction and nanobeam diffraction, with focus on the change...... in the structure and crystallography when a randomly oriented cementite structure in a patented wire during wire drawing is transformed into a lamellar structure parallel to the drawing axis. Changes in the interlamellar spacing and in the misorientation angle along and across the ferrite lamellae show significant...... through-diameter variations in wires drawn to large strains P 1.5. The structural evolution is hierarchical as the structural variations have their cause in a different macroscopic orientation of the cementite in the initial (patented) structure with respect to the wire axis. The through...
Hierarchical structures in cold-drawn pearlitic steel wire
DEFF Research Database (Denmark)
Zhang, Xiaodan; Godfrey, Andrew; Hansen, Niels
2013-01-01
The microstructure and crystallography of drawn pearlitic steel wires have been quantified by a number of electron microscopy techniques including scanning electron microscopy, transmission electron microscopy, electron backscatter diffraction and nanobeam diffraction, with focus on the change...... in the structure and crystallography when a randomly oriented cementite structure in a patented wire during wire drawing is transformed into a lamellar structure parallel to the drawing axis. Changes in the interlamellar spacing and in the misorientation angle along and across the ferrite lamellae show significant...... through-diameter variations in wires drawn to large strains ⩾ 1.5. The structural evolution is hierarchical as the structural variations have their cause in a different macroscopic orientation of the cementite in the initial (patented) structure with respect to the wire axis. The through...
Structural, magnetic and electrical transport properties in cold-drawn thin Fe-rich wires
International Nuclear Information System (INIS)
Garcia, C.; Chizhik, A.; Val, J.J. del; Zhukov, A.; Blanco, J.M.; Gonzalez, J.
2005-01-01
Microstructural (X-ray diffraction), magnetic properties (hysteresis loop), electrical resistivity, magneto-impedance and stress impedance effects have been investigated in cold-drawn Fe 77.5 B 15 Si 7.5 amorphous wire. Initial amorphous wire (obtained by the in-rotating-water technique) with diameter of 125 μm was submitted to cold-drawn process decreasing the diameter to 50 μm. Such cold-drawn wire was treated by current annealing (currents of 190, 210, 220 and 230 mA during times between 1 and 45 min) for tailoring the magnetic and electrical transport properties. A qualitative analysis of the magnetoimpedance and stress impedance effects is given by considering the influence of the magnetoelastic anisotropy and frequency of the AC driving electrical current on the circular permeability
Leakage test evaluation used for qualification of iodine-125 seeds sealing
International Nuclear Information System (INIS)
Feher, Anselmo; Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Calvo, Wilson A.P.; Somessari, Samir L.; Moura, Joao A.; Moura, Eduardo S.; Souza, Carla D.; Rela, Paulo R.
2009-01-01
The prostate cancer is a problem of public health in Brazil, and the second cause of cancer deaths in men, exceeded only by lung cancer. Among the possible treatments available for prostate cancer is brachytherapy, in which small seeds containing Iodine-125 radioisotope are implanted in the prostate. The seed consists of a sealed titanium tube measuring 0.8 mm external diameter and 4.5 mm in length, containing a central silver wire with adsorbed Iodine-125. The tube sealing is made with titanium at the ends, using electric arc welding or laser process. This sealing must be leakage-resistant and free of cracks, therefore avoiding the Iodine-125 to deposit in the silver wire to escape and spread into the human body. To ensure this problem does not occur, rigorous leakage tests, in accordance with the standard Radiation protection - Sealed Radioactive Sources - leakage Test Methods - ISO 9978, should be applied. The aim of this study is to determine, implement and evaluate the leakage test to be used in the Iodine-125 seeds production, in order to qualify the sealing procedure. The standard ISO 9978 presents a list of tests to be carried out according to the type of source. The preferential methods for brachytherapy sources are soaking and helium. To assess the seeds leakage, the method of immersion test at room temperature was applied. The seeds are considered leakage-free if the detected activity does not exceed the 185 Bq (5 nCi). An Iodine standard was prepared and its value determined in a sodium iodide detector. A liquid scintillation counter was calibrated with the standard for seeds leakage tests. Forty-eight seeds were welded for these tests. (author)
The wide perspective on Mars-500 as an analog of deep space exploration: the Czech monograh
Czech Academy of Sciences Publication Activity Database
Stuchlíková, I.; Šolcová, Iva; Poláčková Šolcová, Iva; Mazehóová, Y.; Vinokhodova, A.; Gushin, V.
2013-01-01
Roč. 47, č. 4 (2013), s. 175-175 ISSN 0233-528X. [XIV. Conference on Space Biology and Aerospace Medicine. 28.10.2013-30.10.2013, Moskva] R&D Projects: GA ČR(CZ) GAP407/11/2226 Institutional support: RVO:68081740 Keywords : Mars-500 * group communication * resilience * motivation Subject RIV: AN - Psychology
Secondary emission detectors for fixed target experiments at Fermilab
International Nuclear Information System (INIS)
Drucker, R.; Ford, R.; Tassotto, G.
1998-02-01
A description of a Secondary Emission Electron Detector (SEED) is given. The SEEDs provide accurate profiles and positions at small wire spacing (125-500 mm) in a high energy, high rate environment that exceeds the capabilities of traditional segmented wire ion chambers (SWICs). This device has been designed and constructed to monitor beam position and profile of two fixed target beamlines, namely, KTeV (FNAL E-799, E-832) with an average beam sigma at target of 0.22 mm and NuTeV (FNAL E-815) with a sigma = 0.6 mm. KTeV took beam at an intensity of up to 5E12 800 GeV protons over a 20 sec spill and NuTeV received 1E13 800 GeV protons in five pings/spill
14 CFR 125.265 - Flight engineer requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight engineer requirements. 125.265... Requirements § 125.265 Flight engineer requirements. (a) No person may operate an airplane for which a flight engineer is required by the type certification requirements without a flight crewmember holding a current...
Design and development of equipment for laser wire stripping
Iceland, W. F.
1977-01-01
Three laser wire strippers have been built for the stripping of Kapton-insulated wire, the baseline wire of the space shuttle orbiter. The strippers are: (1) a bench-model stripper powered with a cw CO2 10.6-micron laser, (2) a hand-held stripper powered with a cw 1.06-micron Nd-YAG laser with an output of 5-7 watts, and (3) a hand-held stripper with a five-inch-long CO2 laser inside the stripping head.
14 CFR 125.75 - Airplane flight manual.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 125.75 Section 125... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Airplane flight manual. (a) Each certificate holder shall keep a current approved Airplane Flight Manual or...
Measure of thermal neutron flux in the IPEN/MB-01 reactor using 197 Au wire activation detectors
International Nuclear Information System (INIS)
Marques, Andre Luis Ferreira
1995-01-01
This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 10 9 neutrons/cm 2 .s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core
Linac beam core modeling from wire-scanner data
International Nuclear Information System (INIS)
Law, A.G.
1977-08-01
This study introduces mathematical modeling of accelerator beams from data collected by wire scanners. Details about a beam core D(x,x',y,y') are examined in several situations: (a) for a discretization of the projection into xy-space, a maximum-entropy solution and a minimum-norm solution are developed and discussed, (b) for undiscretized xy-subspace, a two-dimensional Gaussian approximation D(x,.,y,.) = a exp [α(x-x 0 ) 2 + β(x-x 0 )(y-y 0 ) + γ(y-y 0 ) 2 ] is obtained by least squares, and (c) for four-dimensional space, the fit of a single Gaussian to data from a succession of wire scanners is investigated
The effect of ligation on the load deflection characteristics of nickel titanium orthodontic wire.
Kasuya, Shugo; Nagasaka, Satoshi; Hanyuda, Ai; Ishimura, Sadao; Hirashita, Ayao
2007-12-01
This study examined the effect of ligation on the load-deflection characteristics of nickel-titanium (NiTi) orthodontic wire. A modified three-point bending system was used for bending the NiTi round wire, which was inserted and ligated in the slots of three brackets, one of which was bonded to each of the three bender rods. Three different ligation methods, stainless steel ligature (SSL), slot lid (SL), and elastomeric ligature (EL), were employed, as well as a control with neither bracket nor ligation (NBL). The tests were repeated five times under each condition. Comparisons were made of load-deflection curve, load at maximum deflection of 2,000 microm, and load at a deflection of 1,500 microm during unloading. Analysis of Variance (ANOVA) and Dunnett's test were conducted to determine method difference (alpha = 0.05). The interaction between deflection and ligation was tested, using repeated-measures ANOVA (alpha = 0.05). The load values of the ligation groups were two to three times greater than the NBL group at a deflection of 1,500 microm during unloading: 4.37 N for EL, 3.90 N for SSL, 3.02 N for SL, and 1.49 N for NBL (P wire may make NiTi wire exhibit a significantly heavier load than that traditionally expected. NiTi wire exhibited the majority of its true superelasticity with SL, whereas EL may act as a restraint on its superelasticity.
14 CFR 125.203 - Communication and navigation equipment.
2010-01-01
... within the degree of accuracy required for ATC; (ii) One marker beacon receiver providing visual and... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Communication and navigation equipment. 125... Equipment Requirements § 125.203 Communication and navigation equipment. (a) Communication equipment—general...
POwer WithOut Wire (POWOW): A SEP Concept for Space Exploration
Brandhorst, Henry W., Jr.; ONeill, Mark
2000-01-01
Electric propulsion has emerged as a cost-effective solution to a wide range of satellite applications. Deep Space 1 demonstrated electric propulsion as a primary propulsion source for a spacecraft. The POwer WithOut Wires (POWOW) concept has been developed as a solar electric propelled spacecraft that would travel to Mars, for example, enter selenosynchronous orbit and then use lasers to beam power to surface installations. This concept has been developed with industrial expertise in high efficiency solar cells, advanced concentrator modules, innovative arrays, and high power electric propulsion systems. The paper will present the latest version of the spacecraft, the technologies involved, possible missions and trip times to Mars and laser beaming options. The POWOW spacecraft is a general purpose solar electric propulsion system that includes technologies that are directly applicable to commercial and government spacecraft with power levels ranging from 4 kW in Low Earth Orbits (LEO) to about 1 MW. The system is modular and expandable. Learning curve costing methodologies are used to demonstrate cost effectiveness of a modular system.
Daniel, R. L.; Sanders, H. L.; Zimmerman, F. R.
1995-01-01
With the advent of new environmental laws restricting volatile organic compounds and hexavalent chrome emissions, 'environmentally safe' thermal spray coatings are being developed to replace the traditional corrosion protection chromate primers. A wire arc sprayed aluminum coating is being developed for corrosion protection of low pressure liquid hydrogen carrying ducts on the Space Shuttle Main Engine. Currently, this hardware utilizes a chromate primer to provide protection against corrosion pitting and stress corrosion cracking induced by the cryogenic operating environment. The wire are sprayed aluminum coating has been found to have good potential to provide corrosion protection for flight hardware in cryogenic applications. The coating development, adhesion test, corrosion test and cryogenic flexibility test results will be presented.
14 CFR 125.206 - Pitot heat indication systems.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pitot heat indication systems. 125.206... Equipment Requirements § 125.206 Pitot heat indication systems. (a) Except as provided in paragraph (b) of... flight instrument pitot heating system unless the airplane is equipped with an operable pitot heat...
14 CFR 125.311 - Flight crewmembers at controls.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Flight crewmembers at controls. 125.311... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight Operations § 125.311 Flight crewmembers at controls. (a) Except as provided in paragraph (b) of this section, each...
14 CFR 125.177 - Control of engine rotation.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Control of engine rotation. 125.177 Section... Requirements § 125.177 Control of engine rotation. (a) Except as provided in paragraph (b) of this section, each airplane must have a means of individually stopping and restarting the rotation of any engine in...
Proportional multi-wire chamber. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle. Proportional wire chambers allow a much quicker reading than the optical or magnetoscriptive readout wire chambers.
Material and biofilm load of K wires in toe surgery: titanium versus stainless steel.
Clauss, Martin; Graf, Susanne; Gersbach, Silke; Hintermann, Beat; Ilchmann, Thomas; Knupp, Markus
2013-07-01
Recurrence rates for toe deformity correction are high and primarily are attributable to scar contractures. These contractures may result from subclinical infection. We hypothesized that (1) recurrence of toe deformities and residual pain are related to low-grade infections from biofilm formation on percutaneous K wires, (2) biofilm formation is lower on titanium (Ti) K wires compared with stainless steel (SS) K wires, and (3) clinical outcome is superior with the use of Ti K wires compared with SS K wires. In this prospective nonrandomized, comparative study, we investigated 135 lesser toe deformities (61 patients; 49 women; mean ± SD age, 60 ± 15 years) temporarily fixed with K wires between August 2010 and March 2011 (81 SS, 54 Ti). K wires were removed after 6 weeks. The presence of biofilm-related infections was analyzed by sonication. High bacterial loads (> 500 colony-forming units [CFU]/mL) were detected on all six toes requiring revision before 6 months. Increased bacterial load was associated with pain and swelling but not recurrence of the deformity. More SS K wires had greater than 100 CFU/mL bacteria than Ti K wires. For K wires with a bacterial count greater than 100 CFU/mL, toes with Ti K wires had a lower recurrence rate, less pain, and less swelling than toes with SS K wires. Ti K wires showed superior clinical outcomes to SS K wires. This appears to be attributable to reduced infection rates. Although additional study is needed, we currently recommend the use of Ti K wires for the transfixation of toe deformities. Level II, therapeutic study. See Guidelines for Authors for a complete description of levels of evidence.
Study on agroecology contamination from 125I gas and control measures in a simulated ecosystem
International Nuclear Information System (INIS)
Zhao Wenhu; Li Chuanzhao; Xu Shiming; Hou Lanxin; Shang Zhaorong; Li Xia
1995-09-01
The study was made in an air-tight space in which a simulated agricultural ecosystem was contaminated from 125 I gas. The contents of the study were summarized as follows: The space and time distribution of 125 I gas, contamination of foliage of the plants, accumulation and transfer of 125 I fallen on the soil and entered into the plants from the roots of crops and vegetables, the time distribution of 125 I in crops in water contaminated from 125 I fallout, distribution, accumulation and transfer of 125 I in chickens and rabbits which inhaled 125 I gas or fed the fodder contaminated from 125 I. The control measures of contamination in agroenvironment from 125 I were discussed. (7 refs., 20 figs., 29 tabs.)
Wire breakage in SLC wire profile monitors
International Nuclear Information System (INIS)
Field, C.; McCormick, D.; Raimondi, P.; Ross, M.
1998-05-01
Wire scanning beam profile monitors are used at the Stanford Linear Collider (SLC) for emittance preservation control and beam optics optimization. Twenty such scanners have proven most useful for this purpose and have performed a total of 1.5 million scans in the 4 to 6 years since their installation. Most of the essential scanners are equipped with 20 to 40 microm tungsten wires. SLC bunch intensities and sizes often exceed 2 x 10 7 particles/microm 2 (3C/m 2 ). The authors believe that this has caused a number of tungsten wire failures that appear at the ends of the wire, near the wire support points, after a few hundred scans are accumulated. Carbon fibers, also widely used at SLAC, have been substituted in several scanners and have performed well. In this paper, the authors present theories for the wire failure mechanism and techniques learned in reducing the failures
Reduction of Gas Bubbles and Improved Critical Current Density in Bi-2212 Round Wire by Swaging
Jiang, J; Huang, Y; Hong, S; Parrell, J; Scheuerlein, C; Di Michiel, M; Ghosh, A; Trociewitz, U; Hellstrom, E; Larbalestier, D
2013-01-01
Bi-2212 round wire is made by the powder-in-tube technique. An unavoidable property of powder-in-tube conductors is that there is about 30% void space in the as-drawn wire. We have recently shown that the gas present in the as-drawn Bi-2212 wire agglomerates into large bubbles and that they are presently the most deleterious current limiting mechanism. By densifying short 2212 wires before reaction through cold isostatic pressing (CIPping), the void space was almost removed and the gas bubble density was reduced significantly, resulting in a doubled engineering critical current density (JE) of 810 A/mm2 at 5 T, 4.2 K. Here we report on densifying Bi-2212 wire by swaging, which increased JE (4.2 K, 5 T) from 486 A/mm2 for as-drawn wire to 808 A/mm2 for swaged wire. This result further confirms that enhancing the filament packing density is of great importance for making major JE improvement in this round-wire magnet conductor.
Inorganic Nanostructured High-Temperature Magnet Wires, Phase I
National Aeronautics and Space Administration — This project will develop a high-temperature tolerant electrically-insulating coating for magnet wires. The Phase I program will result in a flexible, inorganic...
Pull-pull position control of dual motor wire rope transmission.
Guo, Quan; Jiao, Zongxia; Yan, Liang; Yu, Qian; Shang, Yaoxing
2016-08-01
Wire rope transmission is very efficient because of the small total moving object mass. The wire rope could only transmit pulling force. Therefore it has to be kept in a tightened state during transmission; in high speed applications the dynamic performance depends on the rope's stiffness, which can be adjusted by the wire rope tension. To improve the system dynamic performance output, this paper proposes a novel pull-pull method based on dual motors connected by wire ropes, for precise, high speed position control applications. The method can regulate target position and wire rope tension simultaneously. Wire ropes remain in a pre-tightening state at all times, which prevents the influence of elasticity and reduces the position tracking error in the changing direction process. Simulations and experiments were conducted; the results indicate that both position precision and superior dynamic performance can be synchronously achieved. The research is relevant to space craft precision pointing instruments.
Wire-wrapped rod-bundle heat-transfer analysis for LMFBR
International Nuclear Information System (INIS)
Wong, C.N.C.; Todreas, N.E.
1982-07-01
Helical wire wraps are widely used in the LMFBR fuel and blanket assemblies to provide coolant mixing and maintain proper spacing between fuel pins. The presence of the helical wire, however, may possibly induce heat transfer problems, such as the uncertainty of the maximum clad temperature as a result of the contact between the wires and the pins. In this study, the detailed transient three dimensional velocity and temperature distributions for the coolant around the pin will be determined by solving the governing momentum and energy equation numerically. A computer code HEATRAN has been developed to perform this calculation. Before the computer code HEATRAN is applied to the wire wrapped rod bundle problem, it is used to analyze a wide range of fluid and heat transfer problem to verify its capabilities
Structural Investigations of GaAs/AIAs quantum wires and quantum dots
Darhuber, A.A.; Bauer, G.; Wang, P.D.; Song, Y.P.; Sotomayor Torres, C.M.; Holland, M.C.
1995-01-01
We have investigated periodic arrays of dry etched 150 nm and 175 nm wide, (110) oriented GaAs/AlAs quantum wires and quantum dots by means of reciprocal-space mapping using triple-axis X-ray diffractometry. From the X-ray data the lateral periodicity of wires and dots, the etch depth and the angle
Delamination of Pearlitic Steel Wires: The Defining Role of Prior-Drawing Microstructure
Durgaprasad, A.; Giri, S.; Lenka, S.; Sarkar, Sudip Kumar; Biswas, Aniruddha; Kundu, S.; Mishra, S.; Chandra, S.; Doherty, R. D.; Samajdar, I.
2018-03-01
This article reports the occasional (alignment of the pearlite: 22 ± 5 pct vs 34 ± 4 pct in the nondelaminated wires. Although all wires had similar through-thickness texture and stress gradients, delaminated wires had stronger gradients in composition and higher hardness across the ferrite-cementite interface. Carbide dissolution and formation of supersaturated ferrite were clearly correlated with delamination, which could be effectively mitigated by controlled laboratory annealing at 673 K. Direct observations on samples subjected to simple shear revealed significant differences in shear localizations. These were controlled by pearlite morphology and interlamellar spacing. Prior-drawing microstructure of coarse misaligned pearlite thus emerged as a critical factor in the wire drawing-induced delamination of the pearlitic wires.
Thermosonic wire bonding of IC devices using palladium wire
International Nuclear Information System (INIS)
Shze, J.H.; Poh, M.T.; Tan, R.M.
1996-01-01
The feasibility of replacing gold wire by palladium wire in thermosonic wire bonding of CMOS and bipolar devices are studied in terms of the manufacturability, physical, electrical and assembly performance. The results that palladium wire is a viable option for bonding the bipolar devices but not the CMOS devices
Nanostructure and mechanical properties of heavily cold-drawn steel wires
International Nuclear Information System (INIS)
Yang, Y.S.; Bae, J.G.; Park, C.G.
2009-01-01
The effects of microstructure on the mechanical properties of the high-carbon steel wires were investigated. The wires were fabricated with carbon content of 0.82 and 1.02 wt.% and drawing strain from 4.12 to 4.32. The bending fatigue resistance and torsion ductility were measured by a Hunter fatigue tester and a torsion tester specially designed for fine wires. As the carbon content and drawing strain increased, the fatigue resistance and the torsional ductility of the steel wires decreased, and the tensile strength increased. To elucidate the causes of these behaviors, the microstructure in terms of lamellar spacing (λ P ), cementite thickness (t C ) and morphology of cementite was observed using transmission electron microscopy (TEM) and 3-dimensional atom probe (3-DAP).
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Carriage of narcotic drugs, marihuana, and depressant or stimulant drugs or substances. 125.39 Section 125.39 Aeronautics and Space FEDERAL AVIATION... AIRCRAFT Certification Rules and Miscellaneous Requirements § 125.39 Carriage of narcotic drugs, marihuana...
A Wire Grid Paraboloid for Large Low Frequency Telescopes
Kuiper, Tom
2017-05-01
Planetary magnetic fields are usually studied remotely through their electron cyclotron maser (ECM) emission from electrons trapped in their magnetic fields. Jupiter has been well studied since the 1960's because its strong magnetic field allows emissions up to about 40 MHz to be observed. The emission from Earth and other outer planets is mostly below 1 MHz and can only be observed from space. It is reasonable to assume that most exoplanets with ECM must be observed at low frequencies from space. Even optimistic assumptions about the strength of such emission leads one to conclude that very large filled aperture telescopes, with a diameters of a kilometer or more, will be needed.This paper reports on a study of a copper wire reflector with a diameter of 1 km operating between 100 kHz and 3.75 MHz. It would require 200 kg of 0.5 mm diameter copper wire (AWG 24)) to be lifted to and deployed in space. For aluminum, the mass would be about 100 kg. By optimizing the wire spacing the mass can be reduced to 80% of a simple radial-azimuthal arrangement. A relatively flat reflector (0.6 ≤ f/D ≤ 1.0) needs to be anchored at about 5 points from center to ring along 24 radii. Station-keeping CubeSats could serve as anchors. A total of about 100-120 anchors would be needed for an f/D = 1 reflector, adding 200-300 kg. to the mass of the reflector. It would be possible to carry several such reflectors into space in a single payload.The Deep Space Network is operated by the Jet Propulsion Laboratory, California Institute of Technology, under contract to the National Aeronautics and Space Administration.
14 CFR 125.507 - Fuel tank system inspection program.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fuel tank system inspection program. 125... Airworthiness and Safety Improvements § 125.507 Fuel tank system inspection program. (a) Except as provided in... fuel tank is installed under a field approval, before June 16, 2008, the certificate holder must submit...
A Flying Wire System in the AGS
International Nuclear Information System (INIS)
Huang, H.; Buxton, W.; Mahler, G.; Marusic, A.; Roser, T.; Smith, G.; Syphers, M.; Williams, N.; Witkover, R.
1999-01-01
As the AGS prepares to serve as the injector for RHIC, monitoring and control of the beam transverse emittance become a major and important topic. Before the installation of the flying wire system, the emittance was measured with ionization profile monitors in the AGS, which require correction for space charge effects. It is desirable to have a second means of measuring profile that is less dependent on intensity. A flying wire system has been installed in the AGS recently to perform this task. This paper discusses the hardware and software setup and the capabilities of the system
Vibration of signal wires in wire detectors under irradiation
International Nuclear Information System (INIS)
Bojko, I.R.; Shelkov, G.A.; Dodonov, V.I.; Ignatenko, M.A.; Nikolenko, M.Yu.
1995-01-01
Radiation-induced vibration of signal wires in wire detectors is found and explained. The phenomenon is based on repulsion of a signal wire with a positive potential and a cloud of positive ions that remains after neutralization of the electron part of the avalanche formed in the course of gas amplification. Vibration with a noticeable amplitude may arise from fluctuations of repulsive forces, which act on the wire and whose sources are numerous ion clusters. A formula is obtained which allows wire oscillations to be estimated for all types of wire detectors. Calculation shows that oscillations of signal wires can be substantial for the coordinate accuracy of a detector working in the limited streamer mode at fluxes over 10 5 particles per second per wire. In the proportional mode an average oscillation amplitude can be as large as 20-30 μm at some detector parameters and external radiation fluxes over 10 5 . The experimental investigations show that the proposed model well describes the main features of the phenomenon. 6 refs., 8 figs
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M. [and others
1997-12-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately} 1.4 mm. In this plasma-shell regime, many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models.
International Nuclear Information System (INIS)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼ 1.4 mm. In this plasma-shell regime, many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models
Sanford, T. W. L.; Mock, R. C.; Marder, B. M.; Nash, T. J.; Spielman, R. B.; Peterson, D. L.; Roderick, N. F.; Hammer, J. H.; De Groot, J. S.; Mosher, D.; Whitney, K. G.; Apruzese, J. P.
1997-05-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ˜1.4 mm. In this "plasma-shell regime," many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models.
International Nuclear Information System (INIS)
Sanford, T. W. L.; Mock, R. C.; Marder, B. M.; Nash, T. J.; Spielman, R. B.; Peterson, D. L.; Roderick, N. F.; Hammer, J. H.; De Groot, J. S.; Mosher, D.; Whitney, K. G.; Apruzese, J. P.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼1.4 mm. In this ''plasma-shell regime,'' many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models
An extended parametrization of gas amplification in proportional wire chambers
International Nuclear Information System (INIS)
Beingessner, S.P.; Carnegie, R.K.; Hargrove, C.K.
1987-01-01
It is normally assumed that the gas amplification in proportional chambers is a function of Townsend's first ionization coefficient, α, and that α is a function of the anode surface electric field only. Experimental measurements are presented demonstrating the breakdown of the latter assumption for electric fields, X, greater than about 150 V/cm/Torr on the anode wire surface for a gas mixture of 80/20 argon/methane. For larger values of X, the parametrization of the proportional gas gain data requires an additional term related to the gradient of the electric field near the wire. This extended gain parametrization remains valid until the onset of nonproportional contributions such as positive ion space charge saturation effects. Furthermore, deviations of the data from this parametrization are used to measure the onset of these space charge effects. A simple scaling dependence of the gain data on the product of pressure and wire radius over the whole proportional range is also demonstrated. (orig.)
International Nuclear Information System (INIS)
Sung, Janice S.; King, Valencia; Thornton, Cynthia M.; Brooks, Jennifer D.; Fry, Charles W.; El-Tamer, Mahmoud; Dauer, Lawrence T.; Brogi, Edi; St Germain, Jean M.; Morris, Elizabeth A.
2013-01-01
Purpose: To evaluate the safety and efficacy of pre-operative I-125 radioactive seed localization (RSL) as an alternative to wire localization (WL). Methods: A waiver was granted by the institutional review board for this HIPAA compliant study. Review of 356 consecutive single site nonpalpable mammographic and ultrasound guided I-125 RSLs done between November 2011 and April 2012 was conducted. Preoperative mammograms and specimen radiographs were reviewed for seed-target distance, lesion location, and target/seed removal. During a brief surgical training period, 35 of 356 women had both RSL and wire localization (WL) of the same lesion. Chi-square and single sample t-tests were used to compare margin status and duration of procedures. Results: Of the 356 RSLs, 303 (85.1%) were performed ≥1 day before surgery. Mammographic guidance was used in 330 (93%) and ultrasound in 26 (7%). Mean seed to target distance was 1 mm (range 0–20 mm); all targeted lesions were retrieved. In 31 women in whom mammographic guidance was used for both RSL and WL, median procedure time was not significantly different (RSL 9.0 min; WL 7.0 min; p = 0.91), and median seed migration distance was <1 mm (range 0–15 mm). No difference was detected between margin status with RSL alone versus WL (p = 0.40 and p = 0.65 for positive and <1 mm margins, respectively). Two adverse events occurred requiring an additional wire/surgery. Conclusion: RSL ≥ 1 day before surgery is a safe effective procedure for pre-operative localization, with few adverse events and surgical outcomes comparable to those achieved with wire localization
Magnetoscriptive readout wire chamber. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
1967-01-01
Magnetoscriptive readout wire chamber.Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
Temperature-modulated DSC provides new insight about nickel-titanium wire transformations.
Brantley, William A; Iijima, Masahiro; Grentzer, Thomas H
2003-10-01
Differential scanning calorimetry (DSC) is a well-known method for investigating phase transformations in nickel-titanium orthodontic wires; the microstructural phases and phase transformations in these wires have central importance for their clinical performance. The purpose of this study was to use the more recently developed technique of temperature-modulated DSC (TMDSC) to gain insight into transformations in 3 nickel-titanium orthodontic wires: Neo Sentalloy (GAC International, Islandia, NY), 35 degrees C Copper Ni-Ti (Ormco, Glendora, Calif) and Nitinol SE (3M Unitek, Monrovia, Calif). In the oral environment, the first 2 superelastic wires have shape memory, and the third wire has superelastic behavior but not shape memory. All wires had cross-section dimensions of 0.016 x 0.022 in. Archwires in the as-received condition and after bending 135 degrees were cut into 5 or 6 segments for test specimens. TMDSC analyses (Model 2910 DSC, TA Instruments, Wilmington, Del) were conducted between -125 degrees C and 100 degrees C, using a linear heating and cooling rate of 2 degrees C per min, an oscillation amplitude of 0.318 degrees C with a period of 60 seconds, and helium as the purge gas. For all 3 wire alloys, strong low-temperature martensitic transformations, resolved on the nonreversing heat-flow curves, were not present on the reversing heat-flow curves, and bending appeared to increase the enthalpy change for these peaks in some cases. For Neo Sentalloy, TMDSC showed that transformation between martensitic and austenitic nickel-titanium, suggested as occurring directly in the forward and reverse directions by conventional DSC, was instead a 2-step process involving the R-phase. Two-step transformations in the forward and reverse directions were also found for 35 degrees C Copper Ni-Ti and Nitinol SE. The TMDSC results show that structural transformations in these wires are complex. Some possible clinical implications of these observations are discussed.
Thermoelectron corporation: From space power to Fortune 500
Scoville, A. Nancy; Masters, Richard
1995-01-01
ThermoElectron Corporation was founded in 1957 to commercialize thermionic energy conversion technologies. Today the company is a Fortune 500 company with 1993 revenues of 1.2 billion. In this paper the methods ThermoElectron used to achieve this result will be discussed with emphasis on the corporate philosophy.
Modifications in straight wire treatment.
Cardona, Alvin
2010-01-01
Orthodontic treatments have been modified with each new generation of clinicians. Today the emphasis is on facial esthetics and healthy temporomandibular joints. With orthopedic treatment, we can develop dental arches to get the necessary space to align the teeth and we can reach adequate function and esthetics, all within relatively good stability. By combining two-phase treatment with low friction fixed orthodontics and super elastic wires we produce light but continuous forces and we can provide better treatment than before. These types of forces cause physiological and functional orthopedic orthodontic reactions. The purpose of this article is to demonstrate our fixed orthopedic and orthodontic approach called "Modified Straight Wire" or "Physiologic Arch Technique." This technique is very successful with our patients because it can exert slow and continuous forces with minimal patient cooperation.
Wire Insulation Incorporating Self-Healing Polymers (WIISP), Phase II
National Aeronautics and Space Administration — NextGen and Virginia Tech are developing a self-healing material for wire insulation using a class of ionomeric polymers. These ionomers exhibit self-healing...
Two-step tunneling technique of deep brain stimulation extension wires-a description.
Fontaine, Denys; Vandersteen, Clair; Saleh, Christian; von Langsdorff, Daniel; Poissonnet, Gilles
2013-12-01
While a significant body of literature exists on the intracranial part of deep brain stimulation surgery, the equally important second part of the intervention related to the subcutaneous tunneling of deep brain stimulation extension wires is rarely described. The tunneling strategy can consist of a single passage of the extension wires from the frontal incision site to the subclavicular area, or of a two-step approach that adds a retro-auricular counter-incision. Each technique harbors the risk of intraoperative and postoperative complications. At our center, we perform a two-step tunneling procedure that we developed based on a cadaveric study. In 125 consecutive patients operated since 2002, we did not encounter any complication related to our tunneling method. Insufficient data exist to fully evaluate the advantages and disadvantages of each tunneling technique. It is of critical importance that authors detail their tunneling modus operandi and report the presence or absence of complications. This gathered data pool may help to formulate a definitive conclusions on the safest method for subcutaneous tunneling of extension wires in deep brain stimulation.
Liquid nitrogen-cooled diamond-wire concrete cutting. Innovative technology summary report
International Nuclear Information System (INIS)
1998-12-01
Liquid nitrogen-cooled diamond-wire concrete cutting can be used to cut through thick concrete walls, floors, and structures without using water to cool the cutting wire. The diamond wire is cooled with liquid nitrogen in a 0.9-m (3-ft) long by 7.6-cm (3-in.) diameter pipe housing. The nitrogen evaporates, so no contaminated liquid waste is generated. Other than the use of liquid nitrogen, the system is a conventional diamond-wire saw assembly with remote hydraulic controls. Setup of the hydraulic-powered drive wheel and the diamond wire for cutting requires a relatively short period of time using people with minimal training. Concrete dust generated during the cutting is considerable and requires control. The production rate of this improved technology is 0.78 m 2 /hr (8.4 ft 2 /hr). The production rates of traditional (baseline) water-cooled diamond-wire cutting and circular saw cutting technologies are 1.11 m 2 /hr (12 ft 2 /hr), and 0.45 m 2 /hr (4.8 ft 2 /hr), respectively. The liquid nitrogen-cooled system costs 189% more than conventional diamond-wire cutting if contaminated liquid wastes collection, treatment, and disposal are not accounted for with the baseline. The new technology was 310% more costly than a conventional diamond circular saw, under the conditions of this demonstration (no wastewater control). For cutting a 0.9-m x 3.7-m (3-ft x 12-ft) wall, the improved technology costs $17,000, while baseline diamond-wire cutting would cost $9,000 and baseline circular-saw cutting would cost $5,500. The improved system may cost less than the baseline technologies or may be comparable in cost if wastewater control is included
Liquid nitrogen-cooled diamond-wire concrete cutting. Innovative technology summary report
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-12-01
Liquid nitrogen-cooled diamond-wire concrete cutting can be used to cut through thick concrete walls, floors, and structures without using water to cool the cutting wire. The diamond wire is cooled with liquid nitrogen in a 0.9-m (3-ft) long by 7.6-cm (3-in.) diameter pipe housing. The nitrogen evaporates, so no contaminated liquid waste is generated. Other than the use of liquid nitrogen, the system is a conventional diamond-wire saw assembly with remote hydraulic controls. Setup of the hydraulic-powered drive wheel and the diamond wire for cutting requires a relatively short period of time using people with minimal training. Concrete dust generated during the cutting is considerable and requires control. The production rate of this improved technology is 0.78 m{sup 2}/hr (8.4 ft{sup 2}/hr). The production rates of traditional (baseline) water-cooled diamond-wire cutting and circular saw cutting technologies are 1.11 m{sup 2}/hr (12 ft{sup 2}/hr), and 0.45 m{sup 2}/hr (4.8 ft{sup 2}/hr), respectively. The liquid nitrogen-cooled system costs 189% more than conventional diamond-wire cutting if contaminated liquid wastes collection, treatment, and disposal are not accounted for with the baseline. The new technology was 310% more costly than a conventional diamond circular saw, under the conditions of this demonstration (no wastewater control). For cutting a 0.9-m x 3.7-m (3-ft x 12-ft) wall, the improved technology costs $17,000, while baseline diamond-wire cutting would cost $9,000 and baseline circular-saw cutting would cost $5,500. The improved system may cost less than the baseline technologies or may be comparable in cost if wastewater control is included.
System Security Authorization Agreement (SSAA) for the WIRE Archive and Research Facility
2002-01-01
The Wide-Field Infrared Explorer (WIRE) Archive and Research Facility (WARF) is operated and maintained by the Department of Physics, USAF Academy. The lab is located in Fairchild Hall, 2354 Fairchild Dr., Suite 2A103, USAF Academy, CO 80840. The WARF will be used for research and education in support of the NASA Wide Field Infrared Explorer (WIRE) satellite, and for related high-precision photometry missions and activities. The WARF will also contain the WIRE preliminary and final archives prior to their delivery to the National Space Science Data Center (NSSDC). The WARF consists of a suite of equipment purchased under several NASA grants in support of WIRE research. The core system consists of a Red Hat Linux workstation with twin 933 MHz PIII processors, 1 GB of RAM, 133 GB of hard disk space, and DAT and DLT tape drives. The WARF is also supported by several additional networked Linux workstations. Only one of these (an older 450 Mhz PIII computer running Red Hat Linux) is currently running, but the addition of several more is expected over the next year. In addition, a printer will soon be added. The WARF will serve as the primary research facility for the analysis and archiving of data from the WIRE satellite, together with limited quantities of other high-precision astronomical photometry data from both ground- and space-based facilities. However, the archive to be created here will not be the final archive; rather, the archive will be duplicated at the NSSDC and public access to the data will generally take place through that site.
International Nuclear Information System (INIS)
Taylor, Donna B.; Bourke, Anita G.; Westcott, Eliza
2015-01-01
Approximately one-third of breast cancers are impalpable and require pre-operative image-guided localisation. Hook-wire localisation (HWL) is commonly used but has several disadvantages. Use of a low-activity radioactive iodine-125 seed is a promising alternative technique used in the USA and the Netherlands. This pilot study describes the first use of this in Australia. In this prospective pilot study, 21 participants with biopsy-proven breast cancer underwent radio guided occult lesion localisation using iodine-125 seed(s) (ROLLIS) with insertion of a hook-wire for back up. Sentinel node biopsy was performed where indicated. Ease of hook-wire and seed insertion, duration of the procedure, dependence on the seed versus hook-wire during surgery, lesion location within the specimen, histopathology including size of radial margins, the ease of seed retrieval in pathology, and safe return of seeds for disposal were documented. Radiation dosimetry of staff was performed. All seeds were placed within 3.5 mm of the lesion. All lesions and seeds were removed. One participant needed re-excision for involved margins. Radiologists and surgeons both preferred ROLLIS. Surgeons were able to depend on the seed for localisation in all but one case. Sentinel node biopsy was successfully performed when required. Pathologists found seed retrieval quick and easy, with no detrimental effect on tissue processing. No radiation doses measurably above background were received by staff. ROLLIS is an easily learnt, safe and effective alternative technique to standard HWL.
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.; Mock, R.C.; Marder, B.M.; Nash, T.J.; Spielman, R.B. [Sandia National Laboratories, Albuquerque, New Mexico87185 (United States); Peterson, D.L.; Roderick, N.F. [Los Alamos National Laboratory, Los Alamos, New Mexico87545 (United States); Hammer, J.H.; De Groot, J.S. [Lawrence Livermore National Laboratory, Livermore, California94550 (United States); Mosher, D. [Naval Research Laboratory, Pulsed Power Physics Branch, Washington, District of Columbia20375 (United States); Whitney, K.G.; Apruzese, J.P. [Naval Research Laboratory, Radiation Hydrodynamics Branch, Washington, District of Columbia20375 (United States)
1997-05-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately}1.4mm. In this {open_quotes}plasma-shell regime,{close_quotes} many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models. {copyright} {ital 1997 American Institute of Physics.}
International Nuclear Information System (INIS)
Sanford, T.W.; Mock, R.C.; Marder, B.M.; Nash, T.J.; Spielman, R.B.; Peterson, D.L.; Roderick, N.F.; Hammer, J.H.; De Groot, J.S.; Mosher, D.; Whitney, K.G.; Apruzese, J.P.
1997-01-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, (as measured by the radial convergence, the radiated energy, pulse width, and power), increases with wire number. Radiation magnetohydrodynamic (RMHC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below ∼1.4mm. In this open-quotes plasma-shell regime,close quotes many of the global radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. In this regime, measured changes in the radiation pulse width with variations in load mass and array radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple radiation-scaling models. copyright 1997 American Institute of Physics
Wire Array Solar Cells: Fabrication and Photoelectrochemical Studies
Spurgeon, Joshua Michael
Despite demand for clean energy to reduce our addiction to fossil fuels, the price of these technologies relative to oil and coal has prevented their widespread implementation. Solar energy has enormous potential as a carbon-free resource but is several times the cost of coal-produced electricity, largely because photovoltaics of practical efficiency require high-quality, pure semiconductor materials. To produce current in a planar junction solar cell, an electron or hole generated deep within the material must travel all the way to the junction without recombining. Radial junction, wire array solar cells, however, have the potential to decouple the directions of light absorption and charge-carrier collection so that a semiconductor with a minority-carrier diffusion length shorter than its absorption depth (i.e., a lower quality, potentially cheaper material) can effectively produce current. The axial dimension of the wires is long enough for sufficient optical absorption while the charge-carriers are collected along the shorter radial dimension in a massively parallel array. This thesis explores the wire array solar cell design by developing potentially low-cost fabrication methods and investigating the energy-conversion properties of the arrays in photoelectrochemical cells. The concept was initially investigated with Cd(Se, Te) rod arrays; however, Si was the primary focus of wire array research because its semiconductor properties make low-quality Si an ideal candidate for improvement in a radial geometry. Fabrication routes for Si wire arrays were explored, including the vapor-liquid-solid growth of wires using SiCl4. Uniform, vertically aligned Si wires were demonstrated in a process that permits control of the wire radius, length, and spacing. A technique was developed to transfer these wire arrays into a low-cost, flexible polymer film, and grow multiple subsequent arrays using a single Si(111) substrate. Photoelectrochemical measurements on Si wire array
Plated nickel wire mesh makes superior catalyst bed
Sill, M.
1965-01-01
Porous nickel mesh screen catalyst bed produces gas evolution in hydrogen peroxide thrust chambers used for attitude control of space vehicles. The nickel wire mesh disks in the catalyst bed are plated in rugose form with a silver-gold coating.
Energy Technology Data Exchange (ETDEWEB)
Rupich, Martin W; Li Xiaoping; Thieme, Cees; Sathyamurthy, Srivatsan; Fleshler, Steven; Tucker, David; Thompson, Elliot; Schreiber, Jeff; Lynch, Joseph; Buczek, David; DeMoranville, Ken; Inch, James; Cedrone, Paul; Slack, James, E-mail: mrupich@amsc.co [American Superconductor Corporation, 64 Jackson Road, Devens, MA 01434-4020 (United States)
2010-01-15
The RABiTS(TM)/MOD-YBCO (rolling assisted biaxially textured substrate/metal-organic deposition of YBa{sub 2}Cu{sub 3}O{sub 7-{delta}}) route has been established as a low-cost manufacturing process for producing high performance second generation (2G) wire. American Superconductor Corporation (AMSC) has used this approach to establish a production scale manufacturing line based on a wide-web manufacturing process. This initial production line is currently capable of producing 2G wire in lengths to 500 m with critical currents exceeding 250 A cm{sub width}{sup -1} at 77 K, in the self-field. The wide-web process, combined with slitting and lamination processes, allows customization of the 2G wire width and stabilizer composition to meet application specific wire requirements. The production line is currently supplying 2G wire for multiple cable, fault current limiter and coil applications. Ongoing R and D is focused on the development of thicker YBCO layers and improved flux pinning centers. This paper reviews the history of 2G wire development at AMSC, summarizes the current capability of the 2G wire manufacturing at AMSC, and describes future R and D improvements.
Kamhawi, Hani; Huang, Wensheng; Haag, Thomas; Shastry, Rohit; Thomas, Robert; Yim, John; Herman, Daniel; Williams, George; Myers, James; Hofer, Richard;
2015-01-01
NASA's Space Technology Mission Directorate (STMD) Solar Electric Propulsion Technology Demonstration Mission (SEP/TDM) project is funding the development of a 12.5-kW Hall thruster system to support future NASA missions. The thruster designated Hall Effect Rocket with Magnetic Shielding (HERMeS) is a 12.5-kW Hall thruster with magnetic shielding incorporating a centrally mounted cathode. HERMeS was designed and modeled by a NASA GRC and JPL team and was fabricated and tested in vacuum facility 5 (VF5) at NASA GRC. Tests at NASA GRC were performed with the Technology Development Unit 1 (TDU1) thruster. TDU1's magnetic shielding topology was confirmed by measurement of anode potential and low electron temperature along the discharge chamber walls. Thermal characterization tests indicated that during full power thruster operation at peak magnetic field strength, the various thruster component temperatures were below prescribed maximum allowable limits. Performance characterization tests demonstrated the thruster's wide throttling range and found that the thruster can achieve a peak thruster efficiency of 63% at 12.5 kW 500 V and can attain a specific impulse of 3,000 s at 12.5 kW and a discharge voltage of 800 V. Facility background pressure variation tests revealed that the performance, operational characteristics, and magnetic shielding effectiveness of the TDU1 design were mostly insensitive to increases in background pressure.
Directory of Open Access Journals (Sweden)
Egamnazarov Georgiy
2016-12-01
Full Text Available Given the fact that the installing costs of an optical ground wire on overhead lines directly depend on its cross-section, which in turn depends on the level of fault current it should withstand, in order to reduce these current values in the optical ground wire, I suggested performing its isolated descents from the end towers of the line with its transition to an optical cable. The research was carried out on the example of a 500 kV overhead line in the National Electric Power Grid. The Method of Symmetrical Components for calculating asymmetrical fault currents was not used; therefore, calculations were carried out on the base of presenting the line as a multi-wire system for the considered case as a five-wire system (optical ground wire, steel ground wire, and three phase wires. Such approach allows taking into account the initial asymmetry of the line parameters and modeling any kind of asymmetrical faults. The analyses of calculated results were performed. The conclusive evidence that the optical ground wire isolated descents from the end towers of the line give the possibility of reducing the level of maximal fault current distribution values in it and therefore its cross section, is presented.
14 CFR 125.375 - Fuel supply: Nonturbine and turbopropeller-powered airplanes.
2010-01-01
...) Thereafter, to fly for 45 minutes at normal crusing fuel consumption. (b) If the airplane is released for any...-powered airplanes. 125.375 Section 125.375 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION... AND OPERATIONS CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE...
Development of austenitic stainless steel PC wire and strand
International Nuclear Information System (INIS)
Tsubono, Hideyoshi; Kawabata, Yoshinori; Yamaoka, Yukio
1986-01-01
The effects of aging and stress-aging (called hot stretching) at the temperatures from 120 deg C to 700 deg C on the mechanical properties, relaxation values, Charpy impact values and SCC behavior of hard drawn SUS 304, SUS 316 stainless steel wires have been studied. The main results obtained are as follows: (1) Yield and tensile strength of the wires increased by aging at 230 deg C and 530 deg C as well as by hot stretching. The strengthening after 230 deg C treatment may be due to the strain aging by C and the increase of strength after 530 deg C treatment results from precipitation of Cr 23 C 6 on dislocations. (2) Stress relaxation values up to 250 deg C are low due to precipitation of Cr 23 C 6 . Almost no difference can be observed between aging and hot stretching. (3) Impact value at -196 deg C of SUS 304 stainless steel wire which was measured with 1 mm V-notched specimen was found to be about the same as that of 9 % Ni steel. (4) It is considered that in comparison with high carbon PC wire SUS 304 stainless steel showing high tensile strength is insensitive to SCC in NH 4 SCN and NH 4 NO 3 solutions. (5) In practice, tension member of the austenitic stainless steel wire and strand which were produced by aging at 500 deg C may be useful in special industrial field, for example, (a) SUS 304, in cryogenic field use (b) SUS 316, in intensive magnetic field use as a nonmagnetic material. (author)
Hierarchical Structure and Strengthening Mechanisms in Pearlitic Steel Wire
DEFF Research Database (Denmark)
Zhang, Xiaodan; Hansen, Niels; Huang, Xiaoxu
Microstructure evolution and strengthening mechanisms have been analyzed in a cold-drawn pearlitic steel wire (the strongest engineering materials in the world) with a nanostructure down to 10 nm and a flow stress up to 5.4 GPa. The interlamellar spacing and the cementite lamellae thickness...... are reduced during drawing in accordance with the change in wire diameter up to a strain of 2.5. At a higher strain enhanced thinning of cementite lamellae points to decomposition and carbon enrichment of the ferrite lamellae. Dislocations are stored as individual dislocations and in low angle boundaries...
Enhancing GMI properties of melt-extracted Co-based amorphous wires by twin-zone Joule annealing
Energy Technology Data Exchange (ETDEWEB)
Liu, J.S.; Cao, F.Y.; Xing, D.W.; Zhang, L.Y. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Qin, F.X. [Advanced Composite Center for Innovation and Science (ACCIS), Department of Aerospace Engineering, University of Bristol, University Walk, Bristol BS8 1TR (United Kingdom); Peng, H.X. [Advanced Composite Center for Innovation and Science (ACCIS), Department of Aerospace Engineering, University of Bristol, University Walk, Bristol BS8 1TR (United Kingdom); Centre for Nanoscience and Quantum Information, University of Bristol, Tyndall Avenue, Bristol BS8 1FD (United Kingdom); Xue, X. [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Sun, J.F., E-mail: jfsun_hit@263.net [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)
2012-11-15
Highlights: Black-Right-Pointing-Pointer GMI effect is closely related to annealed microstructures observed by HRTEM. Black-Right-Pointing-Pointer Twin-zone Joule-heated annealing (TJHA) as a novel effective annealing treatment. Black-Right-Pointing-Pointer TJHA wires have relatively larger GMI ratio and field sensitivity. Black-Right-Pointing-Pointer From HRTEM perspective to explain the GMI peaks feature of different states wires. Black-Right-Pointing-Pointer TJHA wires are useful for high-resolution magnetic sensor applications. - Abstract: The influence of twin-zone Joule annealing (TJA) on the microstructure and magnetic properties of melt-extracted Co{sub 68.2}Fe{sub 4.3}B{sub 15}Si{sub 12.5} amorphous microwires has been investigated. Experimental results indicated that twin-zone Joule annealing treatment improved the GMI property of as-cast wires to a greater extent comparing with Joule annealing (JA) and conventional vacuum annealing (CVA) techniques. At 15 MHz, e.g., the maximum GMI ratio [{Delta}Z/Z{sub 0}]{sub max} of a TJA wire increases to 104.29%, which is more than 5 times of 20.49% for the as-cast wire, nearly two times of 56.47% for the JA wire, while the CVA wire has a decreased GMI ratio; the field response sensitivity of the TJA wire increased to 171.62%/Oe from 80.32%/Oe for the as-cast wire, exceeding the values of 140.76%/Oe for the JA wire and of 39.17%/Oe for the CVA wire. The stress or structural relaxation in TJA wire increases circumferential permeability, and magnetic moment achieves a critical state of excitation for overcoming eddy-current damping or 'nail-sticked' action in rotational magnetization process at relatively high frequency. From the microstructural point of view, the role of regularly arranged atomic micro-regions (RAAM) and of medium range order region (MROR) determines the efficiency of various annealing techniques. Conclusively, TJA is established as an efficient annealing technique to enhance the GMI effect
1985-01-01
Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
Turner-Evans, Dan
Over the past five years, the cost of solar panels has dropped drastically and, in concert, the number of installed modules has risen exponentially. However, solar electricity is still more than twice as expensive as electricity from a natural gas plant. Fortunately, wire array solar cells have emerged as a promising technology for further lowering the cost of solar. Si wire array solar cells are formed with a unique, low cost growth method and use 100 times less material than conventional Si cells. The wires can be embedded in a transparent, flexible polymer to create a free-standing array that can be rolled up for easy installation in a variety of form factors. Furthermore, by incorporating multijunctions into the wire morphology, higher efficiencies can be achieved while taking advantage of the unique defect relaxation pathways afforded by the 3D wire geometry. The work in this thesis shepherded Si wires from undoped arrays to flexible, functional large area devices and laid the groundwork for multijunction wire array cells. Fabrication techniques were developed to turn intrinsic Si wires into full p-n junctions and the wires were passivated with a-Si:H and a-SiNx:H. Single wire devices yielded open circuit voltages of 600 mV and efficiencies of 9%. The arrays were then embedded in a polymer and contacted with a transparent, flexible, Ni nanoparticle and Ag nanowire top contact. The contact connected >99% of the wires in parallel and yielded flexible, substrate free solar cells featuring hundreds of thousands of wires. Building on the success of the Si wire arrays, GaP was epitaxially grown on the material to create heterostructures for photoelectrochemistry. These cells were limited by low absorption in the GaP due to its indirect bandgap, and poor current collection due to a diffusion length of only 80 nm. However, GaAsP on SiGe offers a superior combination of materials, and wire architectures based on these semiconductors were investigated for multijunction
Improved Symmetry Greatly Increases X-Ray Power from Wire-Array Z-Pinches
International Nuclear Information System (INIS)
Sanford, T.W.; Allshouse, G.O.; Marder, B.M.; Nash, T.J.; Mock, R.C.; Spielman, R.B.; Seamen, J.F.; McGurn, J.S.; Jobe, D.; Gilliland, T.L.; Vargas, M.; Struve, K.W.; Stygar, W.A.; Douglas, M.R.; Matzen, M.K.; Hammer, J.H.; De Groot, J.S.; Eddleman, J.L.; Peterson, D.L.; Mosher, D.; Whitney, K.G.; Thornhill, J.W.; Pulsifer, P.E.; Apruzese, J.P.; Maron, Y.
1996-01-01
A systematic experimental study of annular aluminum-wire Z-pinches on a 20-TW electrical generator shows that the measured spatial characteristics and emitted x-ray power agree more closely with rad-hydro simulations when large numbers of wires are used. The measured x-ray power increases first slowly and then rapidly with decreasing interwire gap spacing. Simulations suggested that this increase reflects the transition from implosion of individual wire plasmas to one of an azimuthally symmetric plasma shell. In the plasma-shell regime, x-ray powers of 40TW are achieved. copyright 1996 The American Physical Society
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Mock, R.C.; Marder, B.M. [and others
1997-06-01
A systematic study of annular aluminum-wire z-pinches on the Saturn accelerator shows that the quality of the implosion, including the radiated power, increases with wire number. Radiation magnetohydrodynamic (RMEC) xy simulations suggest that the implosion transitions from that of individual wire plasmas to that of a continuous plasma shell when the interwire spacing is reduced below {approximately} 1.4 mm. In the plasma-shell regime, the experimental implosions exhibit 1D- and 2D-code characteristics as evidenced by the presence of a strong first and a weak second radiation pulse that correlates with a strong and weak radial convergence. In this regime, many of the radiation and plasma characteristics are in agreement with those simulated by 2D-RMHC rz simulations. Moreover, measured changes in the radiation pulse width with variations in array mass and radius are consistent with the simulations and are explained by the development of 2D fluid motion in the rz plane. Associated variations in the K-shell yield are qualitatively explained by simple K-shell radiation scaling models.
International Nuclear Information System (INIS)
Chen, A P; Zhukova, V; Zhukov, A; Dominguez, L; Chizhik, A; Blanco, J M; Gonzalez, J
2004-01-01
The influence of an ac magnetic field and the induced magnetic anisotropy (by field annealing and torsion annealing) on the magnetoimpedance (MI) tensor in an amorphous wire has been analysed. The experimental measurements were carried out in an amorphous wire of composition (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 , with a negative, nearly zero magnetostriction constant, excited either by an ac circular, h φ , or an axial, h z , magnetic field created by an ac electric current passing along the wire or through an exciting coil mounted on the wire, respectively. The ac current amplitude was changed from 7.5 to 40 mA and the current frequency f was varied from 1.5 to 20 MHz. The induced magnetic anisotropies modify the MI response drastically. The field annealed sample shows a unique peak of the MI effect, while the torsion annealed sample presents an asymmetric giant magnetoimpedance ratio associated with the induced magnetic anisotropy which provokes such thermal treatments
49 CFR 236.74 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 236.74 Section 236.74 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RULES, STANDARDS, AND INSTRUCTIONS GOVERNING... wire; splice in underground wire. Insulated wire shall be protected from mechanical injury. The...
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
Was used in ISR (Intersecting Storage Ring) split field magnet experiment. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
International Nuclear Information System (INIS)
Roa, Wilson H.Y.; Miller, Gerald G.; McEwan, Alexander J.B.; McQuarrie, Steve A.; Tse, Jeanie; Wu, Jonn; Wiebe, Leonard I.
1998-01-01
Purpose: Iodine-125 induces cell death by a mechanism similar to that of high linear energy transfer (high-LET) radiation. This study investigates the cytotoxicity of high-specific-activity [ 125 I]meta-iodobenzylguanidine ( 125 I-mIBG) in human SK-N-MC neuroblastoma cells grown as three-dimensional multicellular spheroids. Materials and Methods: Spheroids were incubated with high-specific-activity 125 I-mIBG (6 mCi/μg, 1000 times that of the conventional specific activity used for autoradiography). Cytotoxicity was assessed by fluorescence viability markers and confocal microscopy for intact spheroids, fluorescence-activated cell sorting and clonogenic assay, and clonogenic assays for dispersed whole spheroids. Distribution of radioactive mIBG was determined by quantitative light-microscope autoradiography of spheroid cryostat sections. Dose estimation was based on temporal knowledge of the retained radioactivity inside spheroids, and of the radiolabel's emission characteristics. Findings were compared with those of spheroids treated under the same conditions with 131 I-mIBG, cold mIBG, and free iodine-125. Results: 125 I-mIBG exerted significant cell killing. Complete spheroids were eradicated when they were treated with 500 μCi of 125 I-mIBG, while those treated with 500 μCi or 1000 μCi of 131 I-mIBG were not. The observed difference in cytotoxicity between treatments with 125 I- and 131 I-mIBG could not be accounted for by the absorbed dose of spheroid alone. The peripheral, proliferating cell layer of the spheroids remained viable at the moderate radioactivity of 100 μCi for both isotopes. Cytotoxicity induced by 125 I-mIBG was quantitatively comparable by the peripheral rim thickness to that of 131 I-mIBG at the dose of 100 μCi. The peripheral rim thickness decreased most significantly in the first 17 hours after initial treatment. There was no statistical decrease in the rim thickness identified afterwards for the second, third, and fourth days of
Primary experimental results of wire-array Z-pinches on PTS
Energy Technology Data Exchange (ETDEWEB)
Huang, X. B., E-mail: caephxb2003@aliyun.com; Zhou, S. T., E-mail: caephxb2003@aliyun.com; Ren, X. D., E-mail: caephxb2003@aliyun.com; Dan, J. K., E-mail: caephxb2003@aliyun.com; Wang, K. L., E-mail: caephxb2003@aliyun.com; Zhang, S. Q., E-mail: caephxb2003@aliyun.com; Li, J., E-mail: caephxb2003@aliyun.com; Xu, Q., E-mail: caephxb2003@aliyun.com; Cai, H. C., E-mail: caephxb2003@aliyun.com; Duan, S. C., E-mail: caephxb2003@aliyun.com; Ouyang, K., E-mail: caephxb2003@aliyun.com; Chen, G. H., E-mail: caephxb2003@aliyun.com; Ji, C., E-mail: caephxb2003@aliyun.com; Wang, M., E-mail: caephxb2003@aliyun.com; Feng, S. P., E-mail: caephxb2003@aliyun.com; Yang, L. B., E-mail: caephxb2003@aliyun.com; Xie, W. P., E-mail: caephxb2003@aliyun.com; Deng, J. J., E-mail: caephxb2003@aliyun.com [Key Lab of Pulsed Power, Institute of Fluid Physics, CAEP, P.O. Box 919-108, Mianyang, Sichuan 621999 (China)
2014-12-15
The Primary Test Stand (PTS) developed at the China Academy of Engineering Physics is a multiterawatt pulsed power driver, which can deliver a ∼10 MA, 70 ns rise-time (10%-90%) current to a short circuit load and has important applications in Z-pinch driven inertial confinement fusion and high energy density physics. In this paper, primary results of tungsten wire-array Z-pinch experiments on PTS are presented. The load geometries investigated include 15-mm-tall cylindrical single and nested arrays with diameter ranging from 14.4-26.4 mm, and consisting of 132∼276 tungsten wires with 5∼10 μm in diameter. Multiple diagnostics were fielded to determine the characteristics of x-ray radiations and to obtain self-emitting images of imploding plasmas. X-ray power up to 80 TW with ∼3 ns FWMH is achieved by using nested wire arrays. The total x-ray energy exceeds 500 kJ and the peak radiation temperature is about 150 eV. Typical velocity of imploding plasmas goes around 3∼5×10{sup 7} cm/s and the radial convergence ratio is between 10 and 20.
Studies of the distribution of intrathecally injected 125I-tetanus antitoxin-F(ab')2
International Nuclear Information System (INIS)
Hanauske, A.R.
1981-01-01
Overall F(ab') 2 and antitetanus-f(ab') 2 - fragments were labelled with 125 I and injected i.th. into normal juvenile cats and adult rats. One group of rats was normal; in the other, unilateral local tetanus had been induced by injection of tetanus toxin into a M. gastrocnemius. The animals were sacrificed 24 h after the i.th. injection, and tissue samples were taken for histoautoradiography. 125 I-antitetanus-F(ab') 2 permeated into the extracellular space of the spinal cord, roots, and ganglia but not into the neuronal intracellular space. 125 I-overall-F(ab') showed identical permeation behaviour. 125 I-antitetanus-F(ab') 2 reacted with tetanus toxin issuing from the motoneurons after i.th. injection, forming an immunocomplex around the motorneurons. The immunocomplex was not formed around pseudo-unipolar ganglian cells in the spinal ganglia even though some of the ganglian cells contained tetanus toxin, and 125 I-antitetanus-F(ab') 2 was present in the extracellular space. As an explanation, it was suggested that tetanus toxin does not permeate into the extracellular space through the membrane of the pseudo-unipolar ganglian cells so that immune reactions will not occur. These findings help to explain the widely divergent results of tetanus therapy by means of i.th. injection of tetanus antitoxin. Recommendations for future therapy measures are derived from the findings. (orig./MG) [de
Directory of Open Access Journals (Sweden)
Rashidi Amirah
2017-01-01
Full Text Available Ammonia has a very significant value in the fertilizer industry where it was being synthesized via Haber-Bosch process in the early 19th century. As the process utilize high operating conditions, it imposes high capital cost and is an energy-consuming process. Due to this unsustainable process, researchers have initiated an alternative to overcome this drawback by performing a simulation in microfluidic environment using ambient temperature and pressure (25°C and 1 atm. Wires element configured in a 50 mm x 10 mm, (L x D dimension monolithic channel with different spacing and number of wires, arranged axially in 60o pitch have been introduced to investigate the dynamic mixing of nitrogen and hydrogen for ammonia synthesis. As the wires are configured in a different manner, the results show dissimilar volume fraction profile, contours and mixing index. Creating suitable obstruction with larger obstruction space enhanced the mixing. Reducing spacing from 2 mm to 1.5 mm illustrates fluctuating velocity at the centre of the channel causing the flow velocity become less than the set velocity 0.05ms-1. By substituting from 19 wires to 13 wires to the flow, chaotic advection occurs lead to the increased of mixing index up to 94%.
Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles as a janus electrode material for Li-ion batteries
Karegeya, Claude; Mahmoud, Abdelfattah; Hatert, Frédéric; Vertruyen, Bénédicte; Cloots, Rudi; Lippens, Pierre-Emmanuel; Boschini, Frédéric
2018-06-01
A solvothermal method was used to prepare Na1.25Ni1.25Fe1.75(PO4)3 nanoparticles, a new promising electrode material for lithium-ion batteries. The composition and the crystal structure were determined by 57Fe Mössbauer spectroscopy and powder X-ray diffraction Rietveld refinements and confirmed by magnetic measurements. The structural formula □0.75Na1.25Ni1.25Fe1.75(PO4)3 was obtained showing a significant amount of Na vacancies, which enhances Li diffusion. Na1.25Ni1.25Fe1.75(PO4)3 was used as negative and positive electrode material and shows excellent electrochemical performances. As negative electrode in the voltage range 0.03-3.5 V vs. Li+/Li, the first discharge at current density of 40 mA g-1 delivers a specific capacity of 1186 mAh g-1, which is almost three times its theoretical capacity (428 mAh g-1). Then, reversible capacity of 550 mAh g-1 was obtained at 50 mA g-1 with high rate capability (150 mAh g-1 at 500 mA g-1) and capacity retention of 350 cycles. As positive electrode material, specific capacities of about 145 and 99 mAh g-1 were delivered at current densities of 5 and 50 mA g-1, respectively, in the voltage range of 1.5-4.5 V vs. Li+/Li. In addition, we show that the use of solvothermal synthesis contributes to the synthesis of small sized particles leading to good electrochemical performances.
Directory of Open Access Journals (Sweden)
Yanfeng Li
2016-12-01
Full Text Available Background: Osteotome sinus floor elevation is a less invasive approach to augment an insufficient alveolar bone at the posterior maxilla for dental implantation. However, this approach has some limitations due to the lack of sinus lift tools available for clinical use and the small transcrestal access to the maxillary sinus floor. We recently invented shape-memory Ni/Ti alloy wire containing tube elevators for transcrestal detaching maxillary sinus mucosa, and developed goat ex vivo models for direct visualizing the effectiveness of detaching sinus mucosa in real time during transcrestal maxillary sinus floor elevation. Methods: We evaluated our invented elevators, namely elevator 012 and elevator 014, for their effectiveness for transcrestal detaching maxillary sinus mucosa using the goat ex vivo models. We measured the length of sinus mucosa detached in mesial and distal directions or buccal and palatal directions, and the space volume created by detaching maxillary sinus mucosa in mesial, distal, buccal and palatal directions using the invented elevators. Results: Elevator 012 had a shape-memory Ni/Ti alloy wire with a diameter of 0.012 inch, while elevator 014 had its shape-memory Ni/Ti alloy wire with a diameter of 0.014 inch. Elevator 012 could detach the goat maxillary sinus mucosa in the mesial or distal direction for 12.1±4.3 mm, while in the buccal or palatal direction for 12.5±6.7 mm. The elevator 014 could detach the goat maxillary sinus mucosa for 23.0±4.9 mm in the mesial or distal direction, and for 19.0±8.1 mm in the buccal or palatal direction. An average space volume of 1.7936±0.2079 ml was created after detaching the goat maxillay sinus mucosa in both mesial/distal direction and buccal/palatal direction using elevator 012; while the average space volume created using elevator 014 was 1.8764±0.2366 ml. Conclusion: Both two newly invented tube elevators could effectively detach the maxillary sinus mucosa on the goat ex
Li, Yanfeng; Wang, Fuli; Hu, Pin; Fan, Jiadong; Han, Yishi; Liu, Bin; Liu, Tao; Yang, Chunhao; Gu, Xiangmin
2016-01-01
Osteotome sinus floor elevation is a less invasive approach to augment an insufficient alveolar bone at the posterior maxilla for dental implantation. However, this approach has some limitations due to the lack of sinus lift tools available for clinical use and the small transcrestal access to the maxillary sinus floor. We recently invented shape-memory Ni/Ti alloy wire containing tube elevators for transcrestal detaching maxillary sinus mucosa, and developed goat ex vivo models for direct visualizing the effectiveness of detaching sinus mucosa in real time during transcrestal maxillary sinus floor elevation. We evaluated our invented elevators, namely elevator 012 and elevator 014, for their effectiveness for transcrestal detaching maxillary sinus mucosa using the goat ex vivo models. We measured the length of sinus mucosa detached in mesial and distal directions or buccal and palatal directions, and the space volume created by detaching maxillary sinus mucosa in mesial, distal, buccal and palatal directions using the invented elevators. Elevator 012 had a shape-memory Ni/Ti alloy wire with a diameter of 0.012 inch, while elevator 014 had its shape-memory Ni/Ti alloy wire with a diameter of 0.014 inch. Elevator 012 could detach the goat maxillary sinus mucosa in the mesial or distal direction for 12.1±4.3 mm, while in the buccal or palatal direction for 12.5±6.7 mm. The elevator 014 could detach the goat maxillary sinus mucosa for 23.0±4.9 mm in the mesial or distal direction, and for 19.0±8.1 mm in the buccal or palatal direction. An average space volume of 1.7936±0.2079 ml was created after detaching the goat maxillay sinus mucosa in both mesial/distal direction and buccal/palatal direction using elevator 012; while the average space volume created using elevator 014 was 1.8764±0.2366 ml. Both two newly invented tube elevators could effectively detach the maxillary sinus mucosa on the goat ex vivo sinus models. Moreover, elevator 014 has advantages over
Tan, Jun; Zhao, Zeping; Wang, Yuehui; Zhang, Zhike; Liu, Jianguo; Zhu, Ninghua
2018-01-22
A wide-spectrum, ultra-stable optical frequency comb (OFC) module with 100 GHz frequency intervals based on a quantum dot mode locked (QDML) laser is fabricated by our lab, and a scheme with 12.5 Gb/s multi-channel broadcasting transmission for free-space optical (FSO) communication is proposed based on the OFC module. The output power of the OFC is very stable, with the specially designed circuit and the flatness of the frequency comb over the span of 6 nm, which can be limited to 1.5 dB. Four channel wavelengths are chosen to demonstrate one-to-many channels for FSO communication, like optical wireless broadcast. The outdoor experiment is established to test the bit error rate (BER) and eye diagrams with 12.5 Gb/s on-off keying (OOK). The indoor experiment is used to test the highest traffic rate, which is up to 21 Gb/s for one-hop FSO communication. To the best of our knowledge, this scheme is the first to propose the realization of one-to-many broadcasting transmission for FSO communication based on the OFC module. The advantages of integration, miniaturization, channelization, low power consumption, and unlimited bandwidth of one-to-many broadcasting communication scheme, shows promising results on constructing the future space-air-ground-ocean (SAGO) FSO communication networks.
1970-01-01
A wire chamber used at CERN's Proton Synchrotron accelerator in the 1970s. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
BioWires: DNA-Based Nanowires for Conductivity-Enhanced, Self-Assembling Nanoelectronics
National Aeronautics and Space Administration — The BioWires project seeks to overcome two central issues identified in TA10-Nanotechnology: first, the miniaturization of nanoelectronics systems with features less...
Electroplated superconducting wire
International Nuclear Information System (INIS)
Peger, C.H.
1991-01-01
A hard chromium solution has been considered the least efficient of all plating solutions. This is not exactly true if the correct plating conditions are used. The accepted efficiency is only 12% but that is only true for the parameters that were used long ago to make the determination. At 12% efficiency it would be impossible to plate Superconductor wire. The world's chromium plating shops have been plating at a .001 (.025u) per hour rate since the turn of the century. Shops in the Cleveland, Ohio area have been limiting their plating rate to .006 (152u) since 1935. A few have used .012 (304u) to .030 (762u) per hour for specialized jobs. These figures would indicate the apparent efficiency of the old 100 to 1 chromium, sulfate solution can be higher than 60%. The industry uses a 3 bus bar tank with wide spacing between anode and cathode. This results in high solution resistance and high heat generation and consequently slow plating rates. The Reversible Rack 2 Bus Bar System uses very close anode to cathode spacings. This results in the high plating rates with improved quality deposits. When first asked to chromium plate pure nickel wire reel to reel in long lengths, companies making reel to reel machines were asked if chromium plating was practical. In every case, the answer was it couldn't be done. Gold, tin and zinc plating was being done reel to reel. Using the same parameters that were used to determine a chromium solution efficiency was only 12%, these other metal solutions check out close to 100%
Wire bonding in microelectronics
Harman, George G
2010-01-01
Wire Bonding in Microelectronics, Third Edition, has been thoroughly revised to help you meet the challenges of today's small-scale and fine-pitch microelectronics. This authoritative guide covers every aspect of designing, manufacturing, and evaluating wire bonds engineered with cutting-edge techniques. In addition to gaining a full grasp of bonding technology, you'll learn how to create reliable bonds at exceedingly high yields, test wire bonds, solve common bonding problems, implement molecular cleaning methods, and much more. Coverage includes: Ultrasonic bonding systems and technologies, including high-frequency systems Bonding wire metallurgy and characteristics, including copper wire Wire bond testing Gold-aluminum intermetallic compounds and other interface reactions Gold and nickel-based bond pad plating materials and problems Cleaning to improve bondability and reliability Mechanical problems in wire bonding High-yield, fine-pitch, specialized-looping, soft-substrate, and extreme-temperature wire bo...
International Nuclear Information System (INIS)
Nishimura, Masahiro; Kamide, Hideki; Ohshima, Hiroyuki; Kobayashi, Jun; Sato, Hiroyuki
2011-01-01
A sodium cooled fast reactor is designed to attain a high burn-up of core fuel in commercialized fast reactor cycle systems. In high burn-up fuel subassemblies, deformation of fuel pin due to the swelling and thermal bowing may decrease local flow velocity via change of flow area in the subassembly and influence the heat removal capability. Therefore, it is important to obtain the detail of flow velocity distribution in a wire wrapped pin bundle. In this study, water experiments were carried out to investigate the detailed velocity distribution in a subchannel of nominal pin geometry as the first step. These basic data are not only useful for understanding of pin bundle thermal hydraulics but also a code validation. A wire-wrapped 3-pin bundle water model was applied to investigate the detailed velocity distribution in the subchannel which is surrounded by 3 pins with wrapping wire. The test section consists of an irregular hexagonal acrylic duct tube and three pins made of fluorinated resin pins which has nearly the same refractive index with that of water and a high light transmission rate. This enables to visualize the central subchannel through the pins. The velocity distribution in the central subchannel with the wrapping wire was measured by PIV (Particle Image Velocimetry) through a side wall of the duct tube. Typical flow velocity conditions in the pin bundle were 0.36m/s (Re=2,700) and 1.6m/s (Re=13,500). Influence of the wrapping wire on the velocity distributions in vertical and horizontal directions was confirmed. A clockwise swirl flow around the wire was found in subchannel. Significant differences were not recognized between the two cases of Re=2,700 and 13,500 concerning flow patterns. (author)
International Nuclear Information System (INIS)
Somessari, Samir L.; Feher, Anselmo; Sprenger, Francisco E.; Rostellato, Maria E.C.M.; Moura, Joao A.; Costa, Osvaldo L.; Calvo, Wilson A.P.
2011-01-01
The objective of this work is to develop an automation system for Quality Control in the production of Iodine-125 sealed sources, after undergoing the process of laser beam welding. These sources, also known as Iodine-125 seeds are used, successfully, in the treatment of cancer by brachytherapy, with low-dose rates. Each small seed is composed of a welded titanium capsule with 0.8 mm diameter and 4.5 mm in length, containing Iodine-125 adsorbed on an internal silver wire. The seeds are implanted in the human prostate to irradiate the tumor and treat the cancerous cells. The technology to automate the quality control system in the manufacture of Iodine-125 seeds consists in developing and associate mechanical parts, electronic components and pneumatic circuits to control machines and processes. The automation technology for Iodine-125 seed production developed in this work employs programmable logic controller, step motors, drivers of control, electrical-electronic interfaces, photoelectric sensors, interfaces of communication and software development. Industrial automation plays an important role in the production of Iodine-125 seeds, with higher productivity and high standard of quality, facilitating the implementation and operation of processes with good manufacturing practices. Nowadays, the Radiation Technology Center at IPEN-CNEN/SP imports and distributes 36,000 Iodine-125 seeds per year for clinics and hospitals in the whole country. However, the Brazilian potential market is of 8,000 Iodine-125 seeds per month. Therefore, the local production of these radioactive seeds has become a priority for the Institute, aiming to reduce the price and increase the supply to the population in Brazil. (author)
Energy Technology Data Exchange (ETDEWEB)
Somessari, Samir L.; Feher, Anselmo; Sprenger, Francisco E.; Rostellato, Maria E.C.M.; Moura, Joao A.; Costa, Osvaldo L.; Calvo, Wilson A.P., E-mail: somessar@ipen.b, E-mail: afeher@ipen.b, E-mail: sprenger@ipen.b, E-mail: elisaros@ipen.b, E-mail: olcosta@ipen.b, E-mail: wapcalvo@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
The objective of this work is to develop an automation system for Quality Control in the production of Iodine-125 sealed sources, after undergoing the process of laser beam welding. These sources, also known as Iodine-125 seeds are used, successfully, in the treatment of cancer by brachytherapy, with low-dose rates. Each small seed is composed of a welded titanium capsule with 0.8 mm diameter and 4.5 mm in length, containing Iodine-125 adsorbed on an internal silver wire. The seeds are implanted in the human prostate to irradiate the tumor and treat the cancerous cells. The technology to automate the quality control system in the manufacture of Iodine-125 seeds consists in developing and associate mechanical parts, electronic components and pneumatic circuits to control machines and processes. The automation technology for Iodine-125 seed production developed in this work employs programmable logic controller, step motors, drivers of control, electrical-electronic interfaces, photoelectric sensors, interfaces of communication and software development. Industrial automation plays an important role in the production of Iodine-125 seeds, with higher productivity and high standard of quality, facilitating the implementation and operation of processes with good manufacturing practices. Nowadays, the Radiation Technology Center at IPEN-CNEN/SP imports and distributes 36,000 Iodine-125 seeds per year for clinics and hospitals in the whole country. However, the Brazilian potential market is of 8,000 Iodine-125 seeds per month. Therefore, the local production of these radioactive seeds has become a priority for the Institute, aiming to reduce the price and increase the supply to the population in Brazil. (author)
Effect Of Low External Flow On Flame Spreading Over ETFE Insulated Wire Under Microgravity
Nishizawa, Katsuhiro; Fujita, Osamu; Ito, Kenichi; Kikuchi, Masao; Olson, Sandra L.; Kashiwagi, Takashi
2003-01-01
Fire safety is one of the most important issues for manned space missions. A likely cause of fires in spacecraft is wire insulation combustion in electrical system. Regarding the wire insulation combustion it important to know the effect of low external flow on the combustion because of the presence of ventilation flow in spacecraft. Although, there are many researches on flame spreading over solid material at low external flows under microgravity, research dealing with wire insulation is very limited. An example of wire insulation combustion in microgravity is the Space Shuttle experiments carried out by Greenberg et al. However, the number of experiments was very limited. Therefore, the effect of low flow velocity is still not clear. The authors have reported results on flame spreading over ETFE (ethylene - tetrafluoroetylene) insulated wire in a quiescent atmosphere in microgravity by 10 seconds drop tower. The authors also performed experiments of polyethylene insulated nichrom wire combustion in low flow velocity under microgravity. The results suggested that flame spread rate had maximum value in low flow velocity condition. Another interesting issue is the effect of dilution gas, especially CO2, which is used for fire extinguisher in ISS. There are some researches working on dilution gas effect on flame spreading over solid material in quiescent atmosphere in microgravity. However the research with low external flow is limited and, of course, the research discussing a relation of the appearance of maximum wire flammability in low flow velocity region with different dilution gas cannot be found yet. The present paper, therefore, investigates the effect of opposed flow with different dilution gas on flame spreading over ETFE insulated wire and change in the presence of the maximum flammability depending on the dilution gas type is discussed within the limit of microgravity time given by ground-based facility.
Dynamic mechanical properties of straight titanium alloy arch wires.
Kusy, R P; Wilson, T W
1990-10-01
Eight straight-wire materials were studied: an orthodontic titanium-molybdenum (Ti-Mo) product, TMA; three orthodontic nickel-titanium (Ni-Ti) products, Nitinol, Titanal, and Orthonol; three prototype alloys, a martensitic, an austenitic, and a biphasic alloy; and a hybrid shape-memory-effect product, Biometal. Each wire was prepared with a length-to-cross-sectional area of at least 3600 cm-1. With an Autovibron Model DDV-II-C used in the tensile mode, each sample was scanned from -120 to +200 degrees C at 2 degrees C/min. From the data base, plots of the log storage modulus, log tan delta, and percent change in length vs. temperature were generated. Results showed that the dynamic mechanical properties of the alloys within this TI system are quite different. The Ti-Mo alloy, TMA, was invariant with temperature, having a modulus of 7.30 x 10(11) dyne/cm2 (10.6 x 10(6) psi). The three cold-worked alloys--Nitinol, Titanal, and Orthonol--appeared to be similar, having a modulus of 5.74 x 10(11) dyne/cm2 (8.32 x 10(6) psi). The biphasic shape-memory alloy displayed a phase transformation near ambient temperature; whereas the hybrid shape-memory product, Biometal, underwent a 3-5% change in length during its transformation between 95 and 125 degrees C. Among the Ni-Ti wires tested, several different types of alloys were represented by this intermetallic material.
Influence of the ac magnetic field frequency on the magnetoimpedance of amorphous wire
International Nuclear Information System (INIS)
Chen, A P; Garcia, C; Zhukov, A; Dominguez, L; Blanco, J M; Gonzalez, J
2006-01-01
Experimental and theoretical studies on the influence of ac magnetic field frequency on the axial diagonal (ζ zz ) and off-diagonal (ζ Φz ) components of the magnetoimpedance (MI) tensor in (Co 0.94 Fe 0.06 ) 72.5 Si 12.5 B 15 amorphous wires have been performed. The frequency (f) of an ac current flowing along the wire was varied from 1 to 20 MHz with the current amplitude less than 15 mA. In order to enhance the ζ Φz component, the amorphous wire was submitted to torsion annealing for developing and preserving a helical magnetic anisotropy in the surface of the wire. The experimental measurements show that the value of the impedance is proportional to the square-root of the ac current frequency, √f, in the vicinity of H ex K and this increase is due to the contribution of the resistance (real part of the impedance). The measurements also indicate that the peaks of the MI curve shift slightly towards higher field values with increasing f. In a theoretical study the magnetoimpedance expressions ζ zz and ζ Φz have been deduced using the Faraday law in combination with the solutions of the Maxwell and Landau-Lifshitz-Gilbert (LLG) equations. By analysing quantitatively the spectra of ζ zz and ζ Φz , the phenomenon of the shift in the peaks of the MI curve with f has been considered as a characteristic of the helical anisotropy in the domain structure of the wire surface
Structural Parameters and Strengthening Mechanisms in Cold-Drawn Pearlitic Steel Wires
DEFF Research Database (Denmark)
Zhang, Xiaodan; Godfrey, Andy; Huang, Xiaoxu
2012-01-01
Pearlitic steel wires have a nanoscale structure and a strength which can reach 5 GPa. In order to investigate strengthening mechanisms, structural parameters including interlamellar spacing, dislocation density and cementite decomposition, have been analyzed by transmission electron microscopy...... and high resolution electron microscopy in wires cold drawn up to a strain of 3.7. Three strengthening mechanisms, namely boundary strengthening, dislocation strengthening and solid solution hardening have been analyzed and good agreement has been found between the measured flow stress and the value...
Base Information Transport Infrastructure Wired (BITI Wired)
2016-03-01
2016 Major Automated Information System Annual Report Base Information Transport Infrastructure Wired (BITI Wired) Defense Acquisition Management...Combat Information Transport System program was restructured into two pre-Major Automated Information System (pre-MAIS) components: Information...Major Automated Information System MAIS OE - MAIS Original Estimate MAR – MAIS Annual Report MDA - Milestone Decision Authority MDD - Materiel
Load-Deflection and Friction Properties of PEEK Wires as Alternative Orthodontic Wires.
Tada, Yoshifumi; Hayakawa, Tohru; Nakamura, Yoshiki
2017-08-09
Polyetheretherketone (PEEK) is now attracting attention as an alternative to metal alloys in the dental field. In the present study, we evaluated the load-deflection characteristics of PEEK wires in addition to their frictional properties. Three types of PEEK wires are used: two sizes of rectangular shape, 0.016 × 0.022 in² and 0.019 × 0.025 in² (19-25PEEK), and rounded shape, diameter 0.016 in (16PEEK). As a control, Ni-Ti orthodontic wire, diameter 0.016 in, was used. The three-point bending properties were evaluated in a modified three-point bending system for orthodontics. The static friction between the orthodontic wire and the bracket was also measured. The load-deflection curves were similar among Ni-Ti and PEEK wires, except for 16PEEK with slot-lid ligation. The bending force of 19-25PEEK wire was comparable with that of Ni-Ti wire. 19-25PEEK showed the highest load at the deflection of 1500 μm ( p 0.05). No significant difference was seen in static friction between all three PEEK wires and Ni-Ti wire ( p > 0.05). It is suggested that 19-25PEEK will be applicable for orthodontic treatment with the use of slot-lid ligation.
Chauhan, Preeti S; Zhong, ZhaoWei; Pecht, Michael G
2014-01-01
This critical volume provides an in-depth presentation of copper wire bonding technologies, processes and equipment, along with the economic benefits and risks. Due to the increasing cost of materials used to make electronic components, the electronics industry has been rapidly moving from high cost gold to significantly lower cost copper as a wire bonding material. However, copper wire bonding has several process and reliability concerns due to its material properties. Copper Wire Bonding book lays out the challenges involved in replacing gold with copper as a wire bond material, and includes the bonding process changes—bond force, electric flame off, current and ultrasonic energy optimization, and bonding tools and equipment changes for first and second bond formation. In addition, the bond–pad metallurgies and the use of bare and palladium-coated copper wires on aluminum are presented, and gold, nickel and palladium surface finishes are discussed. The book also discusses best practices and re...
Minimisation of the wire position uncertainties of the new CERN vacuum wire scanner
AUTHOR|(CDS)2069346; Barjau Condomines, A
In the next years the luminosity of the LHC will be significantly increased. This will require a much higher accuracy of beam profile measurement than actually achievable by the current wire scanner. The new fast wire scanner is foreseen to measure small emittance beams throughout the LHC injector chain, which demands a wire travelling speed up to 20 ms-1 and position measurement accuracy of the order of a few microns. The vibrations of the mechanical parts of the system, and particularly the vibrations of the thin carbon wire, were identified as the major error sources of wire position uncertainty. Therefore the understanding of the wire vibrations is a high priority for the design and operation of the new device. This document presents the work performed to understand the main causes of the wire vibrations observed in one of the existing wire scanner and the new proposed design.
Iijima, Masahiro; Yuasa, Toshihiro; Endo, Kazuhiko; Muguruma, Takeshi; Ohno, Hiroki; Mizoguchi, Itaru
2010-01-01
This study investigated the corrosion properties of ion implanted nickel-titanium wire (Neo Sentalloy Ionguard) in artificial saliva and fluoride mouth rinse solutions (Butler F Mouthrinse, Ora-Bliss). Non ion implanted nickel-titanium wire (Neo Sentalloy) was used as control. The anodic corrosion behavior was examined by potentiodynamic polarization measurement. The surfaces of the specimens were examined with SEM. The elemental depth profiles were characterized by XPS. Neo Sentalloy Ionguard in artificial saliva and Butler F Mouthrinse (500 ppm) had a lower current density than Neo Sentalloy. In addition, breakdown potential of Neo Sentalloy Ionguard in Ora-Bliss (900 ppm) was much higher than that of Neo Sentalloy although both wires had similar corrosion potential in Ora-Bliss (450 and 900 ppm). The XPS results for Neo Sentalloy Ionguard suggested that the layers consisted of TiO(2) and TiN were present on the surface and the layers may improve the corrosion properties.
14 CFR 125.91 - Airplane requirements: General.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane requirements: General. 125.91... AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Airplane Requirements...
Theory of wire number scaling in wire-array Z pinches
International Nuclear Information System (INIS)
Desjarlais, M.P.; Marder, B.M.
1999-01-01
Pulsed-power-driven Z pinches, produced by imploding cylindrical arrays of many wires, have generated very high x-ray radiation powers (>200 TW) and energies (2 MJ). Experiments have revealed a steady improvement in Z-pinch performance with increasing wire number at fixed total mass and array radius. The dominant mechanism acting to limit the performance of these devices is believed to be the Rayleigh-Taylor instability which broadens the radially imploding plasma sheath and consequently reduces the peak radiation power. A model is presented which describes an amplification over the two-dimensional Rayleigh-Taylor growth rate brought about by kink-like forces on the individual wires. This amplification factor goes to zero as the number of wires approaches infinity. This model gives results which are in good agreement with the experimental data and provides a scaling for wire-array Z pinches. copyright 1999 American Institute of Physics
Dual wire welding torch and method
Diez, Fernando Martinez; Stump, Kevin S.; Ludewig, Howard W.; Kilty, Alan L.; Robinson, Matthew M.; Egland, Keith M.
2009-04-28
A welding torch includes a nozzle with a first welding wire guide configured to orient a first welding wire in a first welding wire orientation, and a second welding wire guide configured to orient a second welding wire in a second welding wire orientation that is non-coplanar and divergent with respect to the first welding wire orientation. A method of welding includes moving a welding torch with respect to a workpiece joint to be welded. During moving the welding torch, a first welding wire is fed through a first welding wire guide defining a first welding wire orientation and a second welding wire is fed through a second welding wire guide defining a second welding wire orientation that is divergent and non-coplanar with respect to the first welding wire orientation.
THERMO-MECHANICALLY PROCESSED ROLLED WIRE FOR HIGH-STRENGTH ON-BOARD WIRE
Directory of Open Access Journals (Sweden)
V. A. Lutsenko
2011-01-01
Full Text Available It is shown that at twisting of wire of diameter 1,83 mm, produced by direct wire drawing of thermomechanically processed rolled wire of diameter 5,5 mm of steel 90, metal stratification is completely eliminated at decrease of carbon, manganese and an additional alloying of chrome.
One century of Kirschner wires and Kirschner wire insertion techniques : A historical review
Franssen, Bas B. G. M.; Schuurman, Arnold H.; Van der Molen, Aebele Mink; Kon, Moshe
A century ago, in 1909, Martin Kirschner (1879-942) introduced a smooth pin, presently known as the Kirschner wire (K-wire). The K-wire was initiallly used for skeletal traction and is now currently used for many different goals. The development of the K-wire and its insertion devices were mainly
14 CFR 125.407 - Maintenance log: Airplanes.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Maintenance log: Airplanes. 125.407 Section... OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD CAPACITY OF 6... Maintenance log: Airplanes. (a) Each person who takes corrective action or defers action concerning a reported...
Sleeve Push Technique: A Novel Method of Space Gaining.
Verma, Sanjeev; Bhupali, Nameksh Raj; Gupta, Deepak Kumar; Singh, Sombir; Singh, Satinder Pal
2018-01-01
Space gaining is frequently required in orthodontics. Multiple loops were initially used for space gaining and alignment. The most common used mechanics for space gaining is the use of nickel-titanium open coil springs. The disadvantage of nickel-titanium coil spring is that they cannot be used until the arches are well aligned to receive the stiffer stainless steel wires. Therefore, a new method of gaining space during initial alignment and leveling has been developed and named as sleeve push technique (SPT). The nickel-titanium wires, i.e. 0.012 inches and 0.014 inches along with archwire sleeve (protective tubing) can be used in a modified way to gain space along with alignment. This method helps in gaining space right from day 1 of treatment. The archwire sleeve and nickel-titanium wire in this new SPT act as a mutually synergistic combination and provide the orthodontist with a completely new technique for space opening.
Sleeve push technique: A novel method of space gaining
Directory of Open Access Journals (Sweden)
Sanjeev Verma
2018-01-01
Full Text Available Space gaining is frequently required in orthodontics. Multiple loops were initially used for space gaining and alignment. The most common used mechanics for space gaining is the use of nickel–titanium open coil springs. The disadvantage of nickel–titanium coil spring is that they cannot be used until the arches are well aligned to receive the stiffer stainless steel wires. Therefore, a new method of gaining space during initial alignment and leveling has been developed and named as sleeve push technique (SPT. The nickel–titanium wires, i.e. 0.012 inches and 0.014 inches along with archwire sleeve (protective tubing can be used in a modified way to gain space along with alignment. This method helps in gaining space right from day 1 of treatment. The archwire sleeve and nickel–titanium wire in this new SPT act as a mutually synergistic combination and provide the orthodontist with a completely new technique for space opening.
Polarimetry and Schlieren diagnostics of underwater exploding wires
Fedotov-Gefen, A. V.; Krasik, Ya. E.
2009-11-01
Nondisturbing laser-probing polarimetry (based on the Faraday and Kerr effects) and Schlieren diagnostics were used in the investigation of underwater electrical wire explosion. Measuring the polarization plane rotation angle of a probing laser beam due to the Faraday effect allows one to determine an axially resolved current flowing through the exploding wire, unlike commonly used current probes. This optical method of measuring current yields results that match those obtained using a current viewing resistor within an accuracy of 10%. The same optical setup allows simultaneous space-resolved measurement of the electric field using the Kerr effect. It was shown that the maximal amplitude of the electric field in the vicinity of the high-voltage electrode is ˜80 kV/cm and that the radial electric field is <1 MV/cm during the wire explosion. Finally, it was shown that the use of Schlieren diagnostics allows one to obtain qualitatively the density distribution behind the shock wave front, which is important for the determination of the energy transfer from the discharge channel to the generated water flow.
Polarimetry and Schlieren diagnostics of underwater exploding wires
International Nuclear Information System (INIS)
Fedotov-Gefen, A. V.; Krasik, Ya. E.
2009-01-01
Nondisturbing laser-probing polarimetry (based on the Faraday and Kerr effects) and Schlieren diagnostics were used in the investigation of underwater electrical wire explosion. Measuring the polarization plane rotation angle of a probing laser beam due to the Faraday effect allows one to determine an axially resolved current flowing through the exploding wire, unlike commonly used current probes. This optical method of measuring current yields results that match those obtained using a current viewing resistor within an accuracy of 10%. The same optical setup allows simultaneous space-resolved measurement of the electric field using the Kerr effect. It was shown that the maximal amplitude of the electric field in the vicinity of the high-voltage electrode is ∼80 kV/cm and that the radial electric field is <1 MV/cm during the wire explosion. Finally, it was shown that the use of Schlieren diagnostics allows one to obtain qualitatively the density distribution behind the shock wave front, which is important for the determination of the energy transfer from the discharge channel to the generated water flow.
Gold Wire-networks: Particle Array Guided Evaporation Lithograpy
Lone, Saifullah
2015-06-29
We exploited the combination of dry deposition of monolayer of 2D (two dimensional) templates, lift-up transfer of 2D template onto flat surfaces and evaporation lithography [1] to fabricate gold micro- and submicron size wire networks. The approach relies upon the defect free dry deposition of 2D monolayer of latex particles [2] on patterned silicon template and flat PDMS-substrate to create square centered and honey-comb wire networks respectively. The process is followed by lift-up transfer of 2D latex crystal on glass substrate. Subsequently, a small amount of AuNP-suspension is doped on top of the transferred crystal; the suspension is allowed to spread instantaneously and dried at low temperature. The liquid evaporates uniformly to the direction perpendicular to glass substrate. During evaporation, AuNPs are de-wetted along with the movement of liquid to self-assemble in-between the inter-particle spaces and therefore, giving rise to liquid-bridge networks which upon delayed evaporation, transforms into wire networks. The approach is used to fabricate both micro- and submicron wire-networks by simply changing the template dimensions. One of the prime motives behind this study is to down-scale the existing particle array template-based evaporation lithography process to fabricate connected gold wire networks at both micro- and submicron scale. Secondly, the idea of combining the patterned silicon wafer with lifted latex particle template creates an opportunity to clean and res-use the patterned wafer more often and thereby, saving fabrication time and resources. Finally, we illustrated the validity of this approach by creating an easy and high-speed approach to develop gold wire networks on a flexible substrate with a thin deposited adhesive. These advances will not only serve as a platform to scale up the production, but also demonstrated that the fabrication method can produce metallic wire networks of different scale and onto a variety of substrates.
Development of Ti-sheathed MgB2 wires with high critical current density
International Nuclear Information System (INIS)
Liang, G; Fang, H; Hanna, M; Yen, F; Lv, B; Alessandrini, M; Keith, S; Hoyt, C; Tang, Z; Salama, K
2006-01-01
Working towards developing lightweight superconducting magnets for future space and other applications, we have successfully fabricated mono-core Ti-sheathed MgB 2 wires by the powder-in-tube method. The wires were characterized by magnetization, electrical resistivity, x-ray diffraction, scanning electron microscopy, and energy dispersive spectrometry measurements. The results indicate that the Ti sheath does not react with the magnesium and boron, and the present wire rolling process can produce MgB 2 wires with a superconducting volume fraction of at least 64% in the core. Using the Bean model, it was found that at 5 K, the magnetic critical current densities, J c , measured in magnetic fields of 0, 5, and 8 T are about 4.2 x 10 5 , 3.6 x 10 4 , and 1.4 x 10 4 A cm -2 , respectively. At 20 K and 0 T, the magnetic J c is about 2.4 x 10 5 A cm -2 . These results show that at zero and low fields, the values of the magnetic J c for Ti-sheathed MgB 2 wires are comparable with the best results available for the Fe-sheathed MgB 2 wires. At high fields, however, the J c for Ti-sheathed MgB 2 wires appears higher than that for the Fe-sheathed MgB 2 wires
Reliability Criteria for Thick Bonding Wire.
Dagdelen, Turker; Abdel-Rahman, Eihab; Yavuz, Mustafa
2018-04-17
Bonding wire is one of the main interconnection techniques. Thick bonding wire is widely used in power modules and other high power applications. This study examined the case for extending the use of traditional thin wire reliability criteria, namely wire flexure and aspect ratio, to thick wires. Eleven aluminum (Al) and aluminum coated copper (CucorAl) wire samples with diameter 300 μm were tested experimentally. The wire response was measured using a novel non-contact method. High fidelity FEM models of the wire were developed and validated. We found that wire flexure is not correlated to its stress state or fatigue life. On the other hand, aspect ratio is a consistent criterion of thick wire fatigue life. Increasing the wire aspect ratio lowers its critical stress and increases its fatigue life. Moreover, we found that CucorAl wire has superior performance and longer fatigue life than Al wire.
Reliability Criteria for Thick Bonding Wire
Yavuz, Mustafa
2018-01-01
Bonding wire is one of the main interconnection techniques. Thick bonding wire is widely used in power modules and other high power applications. This study examined the case for extending the use of traditional thin wire reliability criteria, namely wire flexure and aspect ratio, to thick wires. Eleven aluminum (Al) and aluminum coated copper (CucorAl) wire samples with diameter 300 μm were tested experimentally. The wire response was measured using a novel non-contact method. High fidelity FEM models of the wire were developed and validated. We found that wire flexure is not correlated to its stress state or fatigue life. On the other hand, aspect ratio is a consistent criterion of thick wire fatigue life. Increasing the wire aspect ratio lowers its critical stress and increases its fatigue life. Moreover, we found that CucorAl wire has superior performance and longer fatigue life than Al wire. PMID:29673194
Reliability Criteria for Thick Bonding Wire
Directory of Open Access Journals (Sweden)
Turker Dagdelen
2018-04-01
Full Text Available Bonding wire is one of the main interconnection techniques. Thick bonding wire is widely used in power modules and other high power applications. This study examined the case for extending the use of traditional thin wire reliability criteria, namely wire flexure and aspect ratio, to thick wires. Eleven aluminum (Al and aluminum coated copper (CucorAl wire samples with diameter 300 μm were tested experimentally. The wire response was measured using a novel non-contact method. High fidelity FEM models of the wire were developed and validated. We found that wire flexure is not correlated to its stress state or fatigue life. On the other hand, aspect ratio is a consistent criterion of thick wire fatigue life. Increasing the wire aspect ratio lowers its critical stress and increases its fatigue life. Moreover, we found that CucorAl wire has superior performance and longer fatigue life than Al wire.
1998 wire development workshop proceedings
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-04-01
This report consists of vugraphs of the presentations at the conference. The conference was divided into the following sessions: (1) First Generation Wire Development: Status and Issues; (2) First Generation Wire in Pre-Commercial Prototypes; (3) Second Generation Wire Development: Private Sector Progress and Issues; (4) Second Generation Wire Development: Federal Laboratories; and (5) Fundamental Research Issues for HTS Wire Development.
1998 wire development workshop proceedings
International Nuclear Information System (INIS)
1998-04-01
This report consists of vugraphs of the presentations at the conference. The conference was divided into the following sessions: (1) First Generation Wire Development: Status and Issues; (2) First Generation Wire in Pre-Commercial Prototypes; (3) Second Generation Wire Development: Private Sector Progress and Issues; (4) Second Generation Wire Development: Federal Laboratories; and (5) Fundamental Research Issues for HTS Wire Development
Right wire in orthodontics: a review
Ali, Hashim
2015-01-01
Quality of orthodontic wire such as stiffness, hardness, resiliency, elasticity and working range are important determinants of the effectivenes of tooth movement. Commonly used types of orthodontic arch wire:1) stainless steel(ss) wire, 2) conventional nickel- titanium (NiTi)alloy wire,3) improved super elastic NiTi- alloy wire( also called low hysteresis(LH)wire), and titanium molybdenum alloy(TMA) wire.
Energy Technology Data Exchange (ETDEWEB)
Niculae, D; Mihailescu, A [Romanian Electricity Authority (Romania); Indreias, I; Martin, D [Institute of Atomic Physics, Bucharest (Romania); Margaritescu, A [ICPE Electrostatica, Bucharest, (Romania); Zlatonovici, D
1998-12-31
Underground insulated telecommunication cables must be impregnated with a hydrophobic material in order to prevent water penetration damage. To do so, the cable wire bundle must be heated to a temperature of 60 to 90 degrees C to ensure proper fluidity of the hydrophobic material that must fill the free spaces between the copper wires of the telephone cable. This paper described the microwave heating method of the wires before their impregnation. A cylindrical applicator was designed to perform a telephone bundle heating test. 800 W of microwave power were used on a telephone cable made up of 800 wires of 0.4 mm in diameter. A uniform heating was obtained throughout the section. Microwave heating was also found to be 53 per cent more energy efficient than hot air heating. 4 refs., 4 figs.
Application of irradiated wire
International Nuclear Information System (INIS)
Uda, I.; Kozima, K.; Suzuki, S.; Tada, S.; Torisu, S.; Veno, K.
1984-01-01
Rubber insulated wires are still useful for internal wiring in motor vehicles and electrical equipment because of flexibility and toughness. Irradiated cross-linked rubber materials have been successfully introduced for use with fusible link wire and helically coiled cord
14 CFR 125.285 - Pilot qualifications: Recent experience.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot qualifications: Recent experience... Requirements § 125.285 Pilot qualifications: Recent experience. (a) No certificate holder may use any person, nor may any person serve, as a required pilot flight crewmember unless within the preceding 90...
Phenomenological studies of electron-beam transport in wire-plasma channels
International Nuclear Information System (INIS)
Lockwood, G.J.; Beezhold, W.
1980-01-01
Multiple electron-beam transport in air through plasma channels is an important method for delivering many intense beams to a bremsstrahlung converter system. This paper reports work intended to optimize this transport technique with emphasis on transport through curved channels and on transport efficiencies. Curved-channel transport allows accelerators such as Sandia's PROTO II and PBFA I facilities to be used as flash x-ray sources for weapon effects simulation without reconfiguring the diodes or developing advanced converters. The formation mechanisms of wire-initiated plasma channels in air were examined and the subsequent transport efficiencies of relativistic electron beams through various-length straight and curved plasma channels were determined. Electron transport efficiency through a channel was measured to be 80 to 100% of a zero length channel for 40 cm long straight channels and for curved channels which re-directed the electron beam through an angle of 90 0 . Studies of simultaneous e-beam transport along two curved channels closely spaced at the converter showed that transport efficiency remained at 80 to 100%. However, it was observed that the two e-beams were displaced towards each other. Transport efficiency was observed to depend only weakly on parameters such as wire material, wire length and shape, diode anode aperture, e-beam injection time, and wire-channel applied voltage. For off-center injection conditions the electron beam strongly perturbed the plasma channel in periodic or regularly spaced patterns even though the total energy lost by the electron beam remained small. Plasma-channel transport, when all experimental parameters have been optimized for maximum transport efficiency, is a workable method for directing electron beams to a converter target
Effect of discrete wires on the implosion dynamics of wire array Z pinches
International Nuclear Information System (INIS)
Lebedev, S. V.; Beg, F. N.; Bland, S. N.; Chittenden, J. P.; Dangor, A. E.; Haines, M. G.; Kwek, K. H.; Pikuz, S. A.; Shelkovenko, T. A.
2001-01-01
A phenomenological model of wire array Z-pinch implosions, based on the analysis of experimental data obtained on the mega-ampere generator for plasma implosion experiments (MAGPIE) generator [I. H. Mitchell , Rev. Sci. Instrum. 67, 1533 (1996)], is described. The data show that during the first ∼80% of the implosion the wire cores remain stationary in their initial positions, while the coronal plasma is continuously jetting from the wire cores to the array axis. This phase ends by the formation of gaps in the wire cores, which occurs due to the nonuniformity of the ablation rate along the wires. The final phase of the implosion starting at this time occurs as a rapid snowplow-like implosion of the radially distributed precursor plasma, previously injected in the interior of the array. The density distribution of the precursor plasma, being peaked on the array axis, could be a key factor providing stability of the wire array implosions operating in the regime of discrete wires. The modified ''initial'' conditions for simulations of wire array Z-pinch implosions with one-dimension (1D) and two-dimensions (2D) in the r--z plane, radiation-magnetohydrodynamic (MHD) codes, and a possible scaling to a larger drive current are discussed
Packaging Technologies for 500C SiC Electronics and Sensors
Chen, Liang-Yu
2013-01-01
Various SiC electronics and sensors are currently under development for applications in 500C high temperature environments such as hot sections of aerospace engines and the surface of Venus. In order to conduct long-term test and eventually commercialize these SiC devices, compatible packaging technologies for the SiC electronics and sensors are required. This presentation reviews packaging technologies developed for 500C SiC electronics and sensors to address both component and subsystem level packaging needs for high temperature environments. The packaging system for high temperature SiC electronics includes ceramic chip-level packages, ceramic printed circuit boards (PCBs), and edge-connectors. High temperature durable die-attach and precious metal wire-bonding are used in the chip-level packaging process. A high temperature sensor package is specifically designed to address high temperature micro-fabricated capacitive pressure sensors for high differential pressure environments. This presentation describes development of these electronics and sensor packaging technologies, including some testing results of SiC electronics and capacitive pressure sensors using these packaging technologies.
Microstructure and strengthening mechanisms in cold-drawn pearlitic steel wire
DEFF Research Database (Denmark)
Zhang, Xiaodan; Godfrey, Andy; Huang, Xiaoxu
2011-01-01
Strengthening mechanisms and strength–structure relationships have been analyzed in a cold-drawn pearlitic steel with a structural scale in the nanometer range and a flow stress of about 3.5GPa. The wires have been drawn up to a strain of 3.7 and the structures analyzed and quantified by transmis......Strengthening mechanisms and strength–structure relationships have been analyzed in a cold-drawn pearlitic steel with a structural scale in the nanometer range and a flow stress of about 3.5GPa. The wires have been drawn up to a strain of 3.7 and the structures analyzed and quantified...... by transmission electron microscopy and high resolution electron microscopy. The mechanical properties have been determined by tensile testing. It is found that the interlamellar spacing and the thickness of the cementite lamellae are reduced in accordance with the changes in wire diameter up to a strain of 2...... at the ferrite/cementite interface. Three strengthening mechanisms have been analyzed: (i) boundary strengthening, (ii) dislocation strengthening and (iii) solid solution hardening. The individual and combined contributions, based on an assumption of linear additivity, of these mechanisms to the wire strength...
Inoue, Junji; Kaneta, Takashi; Imasaka, Totaro
2012-09-01
Here, we report the detection of native amino acids using a sheath-flow electrochemical detector with a working electrode made of copper wire. A separation capillary that was inserted into a platinum tube in the detector acted as a grounded electrode for electrophoresis and as a flow channel for sheath liquid. Sheath liquid flowed outside the capillary to support the transport of the separated analytes to the working electrode for electrochemical detection. The copper wire electrode was aligned at the outlet of the capillary in a wall-jet configuration. Amino acids injected into the capillary were separated following elution from the end of the capillary and detection by the copper electrode. Three kinds of copper electrodes with different diameters-50, 125, and 300 μm-were examined to investigate the effect of the electrode diameter on sensitivity. The peak widths of the analytes were independent of the diameter of the working electrode, while the 300-μm electrode led to a decrease in the signal-to-noise ratio compared with the 50- and 125-μm electrodes, which showed no significant difference. The flow rate of the sheath liquid was also varied to optimize the detection conditions. The limits of detection for amino acids ranged from 4.4 to 27 μM under optimal conditions. © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Reliability analysis of magnetic logic interconnect wire subjected to magnet edge imperfections
Zhang, Bin; Yang, Xiaokuo; Liu, Jiahao; Li, Weiwei; Xu, Jie
2018-02-01
Nanomagnet logic (NML) devices have been proposed as one of the best candidates for the next generation of integrated circuits thanks to its substantial advantages of nonvolatility, radiation hardening and potentially low power. In this article, errors of nanomagnetic interconnect wire subjected to magnet edge imperfections have been evaluated for the purpose of reliable logic propagation. The missing corner defects of nanomagnet in the wire are modeled with a triangle, and the interconnect fabricated with various magnetic materials is thoroughly investigated by micromagnetic simulations under different corner defect amplitudes and device spacings. The results show that as the defect amplitude increases, the success rate of logic propagation in the interconnect decreases. More results show that from the interconnect wire fabricated with materials, iron demonstrates the best defect tolerance ability among three representative and frequently used NML materials, also logic transmission errors can be mitigated by adjusting spacing between nanomagnets. These findings can provide key technical guides for designing reliable interconnects. Project supported by the National Natural Science Foundation of China (No. 61302022) and the Scientific Research Foundation for Postdoctor of Air Force Engineering University (Nos. 2015BSKYQD03, 2016KYMZ06).
Effect of transverse compression on I/sub c/ of Nb3Sn multifilamentary wire
International Nuclear Information System (INIS)
Specking, W.; Goldacker, W.; Fluekiger, R.
1988-01-01
The effect of transverse compressive stress on critical current in bronze processed Nb 3 Sn multifilamentary wires was measured at 13.5 T. For the same wire the critical current was more sensitive to this stress than to axial stress. An increase in this stress first caused a slight enhancement of the critical current followed by a drastic decrease of 50 percent at a stress equal to 100 MPa. X-ray diffraction under transverse compression revealed a decrease in the spacing between the lattice planes parallel to the wire axis. This provided a physical basis for the initial enhancement of the critical current under transverse compressive stress
International Nuclear Information System (INIS)
Harty, R.B.
1991-01-01
The development of the wire core system for Nuclear Thermal Propulsion (NTP) that took place from 1963 to 1965 is discussed. A wire core consists of a fuel wire with spacer wires. It's an annular flow core having a central control rod. There are actually four of these, with beryllium solid reflectors on both ends and all the way around. Much of the information on the concept is given in viewgraph form. Viewgraphs are presented on design details of the wire core, the engine design, engine weight vs. thrust, a technique used to fabricate the wire fuel element, and axial temperature distribution
International Nuclear Information System (INIS)
Zhao, Xiubin; Pang, Zhanwen; Wu, Mingzai; Liu, Xiansong; Zhang, Hui; Ma, Yongqing; Sun, Zhaoqi; Zhang, Lide; Chen, Xiaoshuang
2013-01-01
Graphical abstract: Schematic illustration for the magnetic field-assisted growth of wire-like Co 3 O 4 nanostructure. Display Omitted Highlights: ► Co 3 O 4 nanowires are prepared by magnetic field hydrothermal reduction and annealing. ► These Co 3 O 4 nanowires possess enhanced capacitance. ► The Co 3 O 4 nanowires have a good photocatalytic activity for methyl orange. -- Abstract: Wire-like Co 3 O 4 nanostructures were prepared by the combination of magnetic field-assisted hydrothermal reduction of cobalt ions and the subsequent ambient annealing at 500 °C. X-ray diffraction (XRD) and scanning electron microscopy (SEM) were used to characterize the structure and morphological evolution of the products. The results show that the wire-like nanostructures possess diameters about 250 nm and lengths over 10 μm. The possible formation mechanism of the wire-like Co 3 O 4 nanostructures is also proposed based on the SEM results. Galvanostatic methods were used to characterize the electrochemical properties. The measurements indicate that the wire-like Co 3 O 4 nanostructures show larger discharge and charge capacities than that of spherical Co 3 O 4 nanoparticles prepared in the absence of magnetic field. In addition, the photocatalytic activity of the products was investigated by measuring the photodegradation of methyl orange solution under ultraviolet radiation, which shows that both the wire-like and spherical products have a good photocatalytic activity.
Magnetic characterization of the nickel layer protecting the copper wires in harsh applications
Directory of Open Access Journals (Sweden)
Roger Daniel
2017-06-01
Full Text Available High Temperature (HT° motor coils open new perspectives for extending the applications of electrical motors or generators to very harsh environments or for designing very high power density machines working with high internal temperature gradients. Over a temperature of 300°C, the classic enameled wire cannot work permanently, the turn-to-turn insulation must be inorganic and made with high temperature textiles or vitro-ceramic compounds. For both cases, a diffusion barrier must protect the copper wire against oxidation. The usual solution consists of adding a nickel layer that yields an excellent chemical protection. Unfortunately, the nickel has ferromagnetic properties that change a lot the skin effect in the HT wire at high frequencies. For many applications such as aeronautics, electrical machines are always associated with PWM inverters for their control. The windings must resist to high voltage short spikes caused by the fast fronted pulses imposed by the feeding inverter. The nickel protection layer of the HT° inorganic wire has a large influence on the high frequency behavior of coils and, consequently, on the magnitude of the voltage spikes. A good knowledge of the non-linear magnetic characteristics of this nickel layer is helpful for designing reliable HT inorganic coils. The paper presents a method able to characterize non-linear electromagnetic properties of this nickel layer up to 500°C.
Porada, S.; Sales, B.B.; Hamelers, H.V.M.; Biesheuvel, P.M.
2012-01-01
We show the significant potential of water desalination using a novel capacitive wire-based technology in which anode/cathode wire pairs are constructed from coating a thin porous carbon electrode layer on top of electrically conducting rods (or wires). By alternately dipping an array of electrode
Adamatzky, Andrew
2014-01-01
In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self...
Quantum-well exciton polariton emission from multi-quantum-well wire structures
Kohl, M.; Heitmann, D.; Grambow, P.; Ploog, K.
The radiative decay of quantum-well exciton (QWE) polaritons in microstructured Al0.3Ga0.7As - GaAs multi-quantum wells (MQW) has been studied by photoluminescence spectroscopy. Periodic wire structures with lateral periodicities a = 250-500 nm and lateral widths t = 100-200 nm have been fabricated by plasma etching. The thickness of the QWs was 13 nm. In the QW wire samples the free-exciton photoluminescence was strongly reduced and the QWE polariton emission was observed as a maximum peaked at a 3 meV higher energy than the free QWE transition. In samples which had only a microstructured cladding layer, the free-exciton photoluminescence was dominant in the spectrum and the QWE polariton emission was observed as a shoulder on the high-energy side of the free QWE transition. In addition, two transitions at the low energy side of the free QWE photoluminescence were present in the microstructured samples, which were related to etching induced states.
Evolution of cementite morphology in pearlitic steel wire during wet wire drawing
DEFF Research Database (Denmark)
Zhang, Xiaodan; Godfrey, Andrew; Hansen, Niels
2010-01-01
The evolution of the cementite phase during wet wire drawing of a pearlitic steel wire has been followed as a function of strain. Particular attention has been given to a quantitative characterization of changes in the alignment and in the dimensions of the cementite phase. Scanning electron...... microscope observations show that cementite plates become increasingly aligned with the wire axis as the drawing strain is increased. Measurements in the transmission electron microscope show that the cementite deforms plastically during wire drawing , with the average thickness of the cementite plates...... decreasing from 19 nm (ε = 0) to 2 nm (ε = 3.7) in correspondence with the reduction in wire diameter. The deformation of the cementite is strongly related to plastic deformation in the ferrite, with coarse slip steps, shear bands and cracks in the cementite plates/particles observed parallel to either {110...
Synthesis of (125) I-lamivudine and (125) I-lamivudine-ursodeoxycholic acid codrug.
Motaleb, M A; Abo-Kul, M; Ibrahim, Samy M; Saad, Shokry M; Arafat, Muhammad
2016-09-01
The preparation of (125) I-lamivudine ((125) I-3TC) and (125) I-lamivudine-ursodeoxycholic acid codrug ((125) I-3TC-UDCA), suitable for comparative biodistribution studies, is described. The synthesis of the unlabeled precursor 3TC-UDCA proceeds in an 11.6% yield, and the radiolabelling yields for (125) I-3TC and (125) I-3TC-UDCA were 89 and 92%, respectively. The final products are radiochemically pure (greater than 98%). Copyright © 2016 John Wiley & Sons, Ltd.
Goffin, N J; Higginson, R L; Tyrer, J R
2016-12-01
In laser cladding, the potential benefits of wire feeding are considerable. Typical problems with the use of powder, such as gas entrapment, sub-100% material density and low deposition rate are all avoided with the use of wire. However, the use of a powder-based source material is the industry standard, with wire-based deposition generally regarded as an academic curiosity. This is because, although wire-based methods have been shown to be capable of superior quality results, the wire-based process is more difficult to control. In this work, the potential for wire shaping techniques, combined with existing holographic optical element knowledge, is investigated in order to further improve the processing characteristics. Experiments with pre-placed wire showed the ability of shaped wire to provide uniformity of wire melting compared with standard round wire, giving reduced power density requirements and superior control of clad track dilution. When feeding with flat wire, the resulting clad tracks showed a greater level of quality consistency and became less sensitive to alterations in processing conditions. In addition, a 22% increase in deposition rate was achieved. Stacking of multiple layers demonstrated the ability to create fully dense, three-dimensional structures, with directional metallurgical grain growth and uniform chemical structure.
International Nuclear Information System (INIS)
Plokhoi, Vladimir; Kandiev, Yadgar; Samarin, Sergey; Malyshkin, Gennady; Baidin, Grigory; Litvinenko, Igor; Nikitin, Valery
1999-01-01
The paper provides results of numeric simulations of in-target positron production process, processes of moderation, thermalization, diffusion, and reemission of positrons in high efficiency multi-wire moderator made of tungsten monocrystalline wire with regular wire spacing. The paper looks into dynamics of slow positrons in the moderator's vacuum gaps taking into account of external fields. The possibility for using multi-wire moderator with non-regular structure - multi-layer w ire felt m oderator is discussed. According to maximal estimate the multi-wire moderators can reach very high efficiency of fast-slow positron transformation ∼ 10 -2 . Using such moderator the intensity of slow positron source on hard synchrotron radiation of Spring-8 can reach the level of ∼10 11 e + /s. (author)
Evolution of cementite morphology in pearlitic steel wire during wet wire drawing
International Nuclear Information System (INIS)
Zhang Xiaodan; Godfrey, Andrew; Hansen, Niels; Huang Xiaoxu; Liu Wei; Liu Qing
2010-01-01
The evolution of the cementite phase during wet wire drawing of a pearlitic steel wire has been followed as a function of strain. Particular attention has been given to a quantitative characterization of changes in the alignment and in the dimensions of the cementite phase. Scanning electron microscope observations show that cementite plates become increasingly aligned with the wire axis as the drawing strain is increased. Measurements in the transmission electron microscope show that the cementite deforms plastically during wire drawing , with the average thickness of the cementite plates decreasing from 19 nm (ε = 0) to 2 nm (ε = 3.7) in correspondence with the reduction in wire diameter. The deformation of the cementite is strongly related to plastic deformation in the ferrite, with coarse slip steps, shear bands and cracks in the cementite plates/particles observed parallel to either {110} α or {112} α slip plane traces in the ferrite.
Energy Technology Data Exchange (ETDEWEB)
Huff, Johnathon; McLean, Michael B.; Jenkins, Mark W.; Rutherford, Brian Milne
2013-05-01
In microcircuit fabrication, the diameter and length of a bond wire have been shown to both affect the current versus fusing time ratio of a bond wire as well as the gap length of the fused wire. This study investigated the impact of current level on the time-to-open and gap length of 1 mil by 60 mil gold bond wires. During the experiments, constant current was provided for a control set of bond wires for 250ms, 410ms and until the wire fused; non-destructively pull-tested wires for 250ms; and notched wires. The key findings were that as the current increases, the gap length increases and 73% of the bond wires will fuse at 1.8A, and 100% of the wires fuse at 1.9A within 60ms. Due to the limited scope of experiments and limited data analyzed, further investigation is encouraged to confirm these observations.
Corrosion of Wires on Wooden Wire-Bound Packaging Crates
Samuel L. Zelinka; Stan Lebow
2015-01-01
Wire-bound packaging crates are used by the US Army to transport materials. Because these crates may be exposed to harsh environments, they are dip-treated with a wood preservative (biocide treatment). For many years, zinc-naphthenate was the most commonly used preservative for these packaging crates and few corrosion problems with the wires were observed. Recently,...
Design of Model-based Controller with Disturbance Estimation in Steer-by-wire System
Directory of Open Access Journals (Sweden)
Jung Sanghun
2018-01-01
Full Text Available The steer-by-wire system is a next generation steering control technology that has been actively studied because it has many advantages such as fast response, space efficiency due to removal of redundant mechanical elements, and high connectivity with vehicle chassis control, such as active steering. Steer-by-wire system has disturbance composed of tire friction torque and self-aligning torque. These disturbances vary widely due to the weight or friction coefficient change. Therefore, disturbance compensation logic is strongly required to obtain desired performance. This paper proposes model-based controller with disturbance compensation to achieve the robust control performance. Targeted steer-by-wire system is identified through the experiment and system identification method. Moreover, model-based controller is designed using the identified plant model. Disturbance of targeted steer-by-wire is estimated using disturbance observer(DOB, and compensate the estimated disturbance into control input. Experiment of various scenarios are conducted to validate the robust performance of proposed model-based controller.
14 CFR 125.223 - Airborne weather radar equipment requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... Equipment Requirements § 125.223 Airborne weather radar equipment requirements. (a) No person may operate an airplane governed by this part in passenger-carrying operations unless approved airborne weather radar...
SU-E-T-259: Particle Swarm Optimization in Radial Dose Function Fitting for a Novel Iodine-125 Seed
Energy Technology Data Exchange (ETDEWEB)
Wu, X [University of Alabama at Birmingham, Birmingham, Al (United States); Duan, J; Popple, R; Huang, M; Shen, S; Brezovich, I [University of Alabama Birmingham, Birmingham, AL (United States); Cardan, R [UAB University of Alabama, Birmingham, Birmingham, AL (United States); Benhabib, S [University of Alabama at Birmingham, Birmingham, AL (United States)
2014-06-01
Purpose: To determine the coefficients of bi- and tri-exponential functions for the best fit of radial dose functions of the new iodine brachytherapy source: Iodine-125 Seed AgX-100. Methods: The particle swarm optimization (PSO) method was used to search for the coefficients of the biand tri-exponential functions that yield the best fit to data published for a few selected radial distances from the source. The coefficients were encoded into particles, and these particles move through the search space by following their local and global best-known positions. In each generation, particles were evaluated through their fitness function and their positions were changed through their velocities. This procedure was repeated until the convergence criterion was met or the maximum generation was reached. All best particles were found in less than 1,500 generations. Results: For the I-125 seed AgX-100 considered as a point source, the maximum deviation from the published data is less than 2.9% for bi-exponential fitting function and 0.2% for tri-exponential fitting function. For its line source, the maximum deviation is less than 1.1% for bi-exponential fitting function and 0.08% for tri-exponential fitting function. Conclusion: PSO is a powerful method in searching coefficients for bi-exponential and tri-exponential fitting functions. The bi- and tri-exponential models of Iodine-125 seed AgX-100 point and line sources obtained with PSO optimization provide accurate analytical forms of the radial dose function. The tri-exponential fitting function is more accurate than the bi-exponential function.
Design and fabrication of a three-finger prosthetic hand using SMA muscle wires
Simone, Filomena; York, Alexander; Seelecke, Stefan
2015-03-01
Bio-inspired hand-like gripper systems based on shape memory alloy (SMA) wire actuation have the potential to enable a number of useful applications in, e.g., the biomedical field or industrial assembly systems. The inherent high energy density makes SMA solutions a natural choice for systems with lightweight, low noise and high force requirements, such as hand prostheses or robotic systems in a human/machine environment. The focus of this research is the development, design and realization of a SMA-actuated prosthetic hand prototype with three fingers. The use of thin wires (100 μm diameter) allows for high cooling rates and therefore fast movement of each finger. Grouping several small wires mechanically in parallel allows for high force actuation. To save space and to allow for a direct transmission of the motion to each finger, the SMA wires are attached directly within each finger, across each phalanx. In this way, the contraction of the wires will allow the movement of the fingers without the use of any additional gears. Within each finger, two different bundles of wires are mounted: protagonist ones that create bending movement and the antagonist ones that enable stretching of each phalanx. The resistance change in the SMA wires is measured during actuation, which allows for monitoring of the wire stroke and potentially the gripping force without the use of additional sensors. The hand is built with modern 3D-printing technologies and its performance while grasping objects of different size and shape is experimentally investigated illustrating the usefulness of the actuator concept.
Forming Refractory Insulation On Copper Wire
Setlock, J.; Roberts, G.
1995-01-01
Alternative insulating process forms flexible coat of uncured refractory insulating material on copper wire. Coated wire formed into coil or other complex shape. Wire-coating apparatus forms "green" coat on copper wire. After wire coiled, heating converts "green" coat to refractory electrical insulator. When cured to final brittle form, insulating material withstands temperatures above melting temperature of wire. Process used to make coils for motors, solenoids, and other electrical devices to be operated at high temperatures.
Stirling Space Engine Program. Volume 1; Final Report
Dhar, Manmohan
1999-01-01
The objective of this program was to develop the technology necessary for operating Stirling power converters in a space environment and to demonstrate this technology in full-scale engine tests. Hardware development focused on the Component Test Power Converter (CTPC), a single cylinder, 12.5-kWe engine. Design parameters for the CTPC were 150 bar operating pressure, 70 Hz frequency, and hot-and cold-end temperatures of 1050 K and 525 K, respectively. The CTPC was also designed for integration with an annular sodium heat pipe at the hot end, which incorporated a unique "Starfish" heater head that eliminated highly stressed brazed or weld joints exposed to liquid metal and used a shaped-tubed electrochemical milling process to achieve precise positional tolerances. Selection of materials that could withstand high operating temperatures with long life were another focus. Significant progress was made in the heater head (Udimet 700 and Inconel 718 and a sodium-filled heat pipe); the alternator (polyimide-coated wire with polyimide adhesive between turns and a polyimide-impregnated fiberglass overwrap and samarium cobalt magnets); and the hydrostatic gas bearings (carbon graphite and aluminum oxide for wear couple surfaces). Tests on the CTPC were performed in three phases: cold end testing (525 K), engine testing with slot radiant heaters, and integrated heat pipe engine system testing. Each test phase was successful, with the integrated engine system demonstrating a power level of 12.5 kWe and an overall efficiency of 22 percent in its maiden test. A 1500-hour endurance test was then successfully completed. These results indicate the significant achievements made by this program that demonstrate the viability of Stirling engine technology for space applications.
International Nuclear Information System (INIS)
Sakai, K.; Hishida, H.
1978-01-01
Probabilistic fuel pin gap distributions within a wire-spaced fuel subassembly and sensitivities of the related uncertainties to fuel pin gaps are discussed. The analyses consist mainly of expressing a local fuel pin gap in terms of sensitivity functions of the related uncertainties and calculating the corresponding probabilistic distribution through taking all the possible combinations of the distribution of uncertainties. The results of illustrative calculations show that with the reliability level of 0.9987, the maximum deviation of the pin gap at the cladding hot spot of a center fuel subassembly is 8.05% from its nominal value and the corresponding probabilistic pin gap distribution is shifted to the narrower side due to the external confinement of a pin bundle with a wrapper tube. (Auth.)
NiTi bonded space regainer/maintainer
Directory of Open Access Journals (Sweden)
Negi K
2010-06-01
Full Text Available Early orthodontic interventions are often initiated in the developing dentition to promote favorable developmental changes. Interceptive orthodontic can eliminate or reduce the severity of a developing malocclusion, the complexity of orthodontic treatment, overall treatment time and cost. Premature loss of deciduous tooth or teeth can often destroy the integrity of normal occlusion. There are many space regaining and maintaining devices mentioned in literature. In this article, I present a simple space regaining method by a piece of nickel titanium (NiTi wire bonded between the teeth in active loop form, and the unique shape memory property of NiTi wire will upright or move the teeth and the lost space can be regained easily.
Wire chambers: Trends and alternatives
Energy Technology Data Exchange (ETDEWEB)
Regler, Meinhard
1992-05-15
The subtitle of this year's Vienna Wire Chamber Conference - 'Recent Trends and Alternative Techniques' - signalled that it covered a wide range of science and technology. While an opening Vienna talk by wire chamber pioneer Georges Charpak many years ago began 'Les funerailles des chambres a fils (the burial of wire chambers)', the contrary feeling this year was that wire chambers are very much alive!.
Wiring economy and volume exclusion determine neuronal placement in the Drosophila brain.
Rivera-Alba, Marta; Vitaladevuni, Shiv N; Mishchenko, Yuriy; Mischenko, Yuriy; Lu, Zhiyuan; Takemura, Shin-Ya; Scheffer, Lou; Meinertzhagen, Ian A; Chklovskii, Dmitri B; de Polavieja, Gonzalo G
2011-12-06
Wiring economy has successfully explained the individual placement of neurons in simple nervous systems like that of Caenorhabditis elegans [1-3] and the locations of coarser structures like cortical areas in complex vertebrate brains [4]. However, it remains unclear whether wiring economy can explain the placement of individual neurons in brains larger than that of C. elegans. Indeed, given the greater number of neuronal interconnections in larger brains, simply minimizing the length of connections results in unrealistic configurations, with multiple neurons occupying the same position in space. Avoiding such configurations, or volume exclusion, repels neurons from each other, thus counteracting wiring economy. Here we test whether wiring economy together with volume exclusion can explain the placement of neurons in a module of the Drosophila melanogaster brain known as lamina cartridge [5-13]. We used newly developed techniques for semiautomated reconstruction from serial electron microscopy (EM) [14] to obtain the shapes of neurons, the location of synapses, and the resultant synaptic connectivity. We show that wiring length minimization and volume exclusion together can explain the structure of the lamina microcircuit. Therefore, even in brains larger than that of C. elegans, at least for some circuits, optimization can play an important role in individual neuron placement. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Va'Vra, J.
1986-02-01
This paper makes an overview of the wire chamber aging problems as a function of various chamber design parameters. It emphasizes the chemistry point of view and many examples are drawn from the plasma chemistry field as a guidance for a possible effort in the wire chamber field. The paper emphasizes the necessity of variable tuning, the importance of purity of the wire chamber environment, as well as it provides a practical list of presently known recommendations. In addition, several models of the wire chamber aging are qualitatively discussed. The paper is based on a summary talk given at the Wire Chamber Aging Workshop held at LBL, Berkeley on January 16-17, 1986. Presented also at Wire Chamber Conference, Vienna, February 25-28, 1986. 74 refs., 18 figs., 11 tabs
Wire chambers: Trends and alternatives
International Nuclear Information System (INIS)
Regler, Meinhard
1992-01-01
The subtitle of this year's Vienna Wire Chamber Conference - 'Recent Trends and Alternative Techniques' - signalled that it covered a wide range of science and technology. While an opening Vienna talk by wire chamber pioneer Georges Charpak many years ago began 'Les funerailles des chambres a fils (the burial of wire chambers)', the contrary feeling this year was that wire chambers are very much alive!
Vibrating wire for beam profile scanning
Directory of Open Access Journals (Sweden)
S. G. Arutunian
1999-12-01
Full Text Available A method that measures the transverse profile (emittance of the bunch by detecting radiation arising at the scattering of the bunch on scanning wire is widely used. In this work information about bunch scattering is obtained by measuring the oscillation frequency of the tightened scanning wire. In such a way, the system of radiation (or secondary particles extraction and measurement can be removed. The entire unit consists of a compact fork with tightened wire and a scanning system. Normal oscillation frequency of a wire depends on wire tension, its geometric parameters, and, in a second approximation, its elastic characteristics. Normal oscillations are generated by interaction of an alternating current through the wire with magnetic field of a permanent magnet. In this case, it is suggested that the magnetic field of the accelerator (field of dipole magnets or quadrupole magnets be used for excitation of oscillations. The dependence of oscillation frequency on beam scattering is determined by several factors, including changes of wire tension caused by transverse force of the beam and influence of beam self-field. Preliminary calculations show that the influence of wire heating will dominate. We have studied strain gauges on the basis of vibrating wire from various materials (tungsten, beryl bronze, and niobium zirconium alloys. A scheme of normal oscillation generation by alternating current in autogeneration circuit with automatic frequency adjustment was selected. A special method of wire fixation and elimination of transverse degrees of freedom allows us to achieve relative stability better than 10^{-5} during several days at a relative resolution of 10^{-6}. Experimental results and estimates of wire heating of existing scanners show that the wire heats up to a few hundred grades, which is enough for measurements. The usage of wire of micrometer thickness diminishes the problem of wire thermalization speed during the scanning of the bunch.
Charpak hemispherical wire chamber
1970-01-01
pieces. Mesures are of the largest one. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.
Directory of Open Access Journals (Sweden)
Jan Karbowski
2015-10-01
Full Text Available The structure and quantitative composition of the cerebral cortex are interrelated with its computational capacity. Empirical data analyzed here indicate a certain hierarchy in local cortical composition. Specifically, neural wire, i.e., axons and dendrites take each about 1/3 of cortical space, spines and glia/astrocytes occupy each about (1/3(2, and capillaries around (1/3(4. Moreover, data analysis across species reveals that these fractions are roughly brain size independent, which suggests that they could be in some sense optimal and thus important for brain function. Is there any principle that sets them in this invariant way? This study first builds a model of local circuit in which neural wire, spines, astrocytes, and capillaries are mutually coupled elements and are treated within a single mathematical framework. Next, various forms of wire minimization rule (wire length, surface area, volume, or conduction delays are analyzed, of which, only minimization of wire volume provides realistic results that are very close to the empirical cortical fractions. As an alternative, a new principle called "spine economy maximization" is proposed and investigated, which is associated with maximization of spine proportion in the cortex per spine size that yields equally good but more robust results. Additionally, a combination of wire cost and spine economy notions is considered as a meta-principle, and it is found that this proposition gives only marginally better results than either pure wire volume minimization or pure spine economy maximization, but only if spine economy component dominates. However, such a combined meta-principle yields much better results than the constraints related solely to minimization of wire length, wire surface area, and conduction delays. Interestingly, the type of spine size distribution also plays a role, and better agreement with the data is achieved for distributions with long tails. In sum, these results suggest
Electrodeposition of nickel nano wire arrays
International Nuclear Information System (INIS)
Nur Ubaidah Saidin; Kok Kuan Ying; Ng Inn Khuan; Nurazila Mat Zali; Siti Salwa Zainal Abidin
2010-01-01
Synthesis, characterization and assembly of one-dimensional nickel nano wires prepared by template directed electrodeposition are discussed in this paper. Parallel arrays of high aspect ratio nickel nano wires were electrodeposited using electrolytes with different cations and pH. The nano wires were characterized using X-ray diffractometry and scanning electron microscopy. It was found that the orientations of the electro deposited Ni nano wires were governed by the deposition current and the electrolyte conditions. Free standing nickel nano wires can be obtained by dissolving the template. Due to the magnetic nature of the nano wires, magnetic alignment was employed to assemble and position the free standing nano wires in the device structure. (author)
Wire-number effects on high-power annular z-pinches and some characteristics at high wire number
Energy Technology Data Exchange (ETDEWEB)
SANFORD,THOMAS W. L.
2000-05-23
Characteristics of annular wire-array z-pinches as a function of wire number and at high wire number are reviewed. The data, taken primarily using aluminum wires on Saturn are comprehensive. The experiments have provided important insights into the features of wire-array dynamics critical for high x-ray power generation, and have initiated a renaissance in z-pinches when high numbers of wires are used. In this regime, for example, radiation environments characteristic of those encountered during the early pulses required for indirect-drive ICF ignition on the NIF have been produced in hohlraums driven by x-rays from a z-pinch, and are commented on here.
Wire-number effects on high-power annular z-pinches and some characteristics at high wire number
International Nuclear Information System (INIS)
SANFORD, THOMAS W. L.
2000-01-01
Characteristics of annular wire-array z-pinches as a function of wire number and at high wire number are reviewed. The data, taken primarily using aluminum wires on Saturn are comprehensive. The experiments have provided important insights into the features of wire-array dynamics critical for high x-ray power generation, and have initiated a renaissance in z-pinches when high numbers of wires are used. In this regime, for example, radiation environments characteristic of those encountered during the early pulses required for indirect-drive ICF ignition on the NIF have been produced in hohlraums driven by x-rays from a z-pinch, and are commented on here
Production of diamond wire by Cu15 v-% Nb 'in situ' process
International Nuclear Information System (INIS)
Filgueira, M.; Pinatti, D.G.
2001-01-01
Diamond wires are cutting tools used in the slabbing of dimension stones, such as marbles and granites, as well as in cutting of concrete structures. This tool consists of a steel cable on which diamond annular segments (pearls) are mounted with spacing between them. This work has developed a new technological route to obtain the diamond wires, whose fabrication involves metal forming processes such as rotary forging and wire drawing, copper tubes restacking, and thermal treatments of sintering and recrystallization. It was idealized the use of Cu 15v% Nb composite wires as the high tensile strength cable, covered with an external cutting rope made of bronze 4wt% diamond composite, along the overall wire surface. Investigations were carried out on the mechanical behavior and on the microstructural evolution of the Cu 15 vol % Nb wires, which showed ultimate tensile strength (UTS) of 960 MPa and deformation of approximately 3,0 %. The cutting external rope of 1.84 mm in diameter showed UTS = 230 MPa. On the microstructural side aspect it was observed that the diamond crystals were uniformly distributed throughout the tool bulk in the several processing steps. Cutting tests were carried out starting with an external diamond rope of 1.93 mm in diameter, which cut a marble sectional area of 1188 cm 2 , and the tool degraded to a final diameter of 1.23 mm. For marble the 'in situ' wire showed a probable performance 4 times higher than the diamond saws, however their probable performance was about 5 to 8 times less than the conventional diamond wires due to the low abrasion resistance of the bronze matrix and the low adhesion between the pair bronze-diamond. (author)
Diagnostics for exploding wires (abstract)
International Nuclear Information System (INIS)
Moosman, B.; Bystritskii, V.; Wessel, F.J.; Van Drie, A.
1999-01-01
Two diagnostics, capable of imaging fast, high temperature, plasmas were used on exploding wire experiments at UC Irvine. An atmospheric pressure nitrogen laser (λ=337.1 nm) was used to generate simultaneous shadow and shearing interferogram images with a temporal resolution of ∼1 ns and a spatial resolution of 10 μm. An x-ray backlighter imaged the exploding wire 90 degree with respect to the laser and at approximately the same instant in time. The backlighter spatial resolution as determined by geometry and film resolution was 25 μm. Copper wires of diameters (25, 50, and 100 μm) and steel wire d=25 μm were exploded in vacuum (10 -5 Torr) at a maximum current level of 12 kA, by a rectified marx bank at a voltage of 50 kV and a current rise time (quarter period) of 900 ns. Copper wires which were cleaned and then resistively heated under vacuum to incandescence for several hours prior to high current initiation, exhibited greater expansion velocities at peak current than wires which had not been heated prior to discharge. Axial variations on the surface of the wire observed with the laser were found to correlate with bulk axial mass differences from x-ray backlighting. High electron density, measured near the opaque surface of the exploding wire, suggests that much of the current is shunted outward away from the bulk of the wire. copyright 1999 American Institute of Physics
Vorobiev, Dmitry; Ninkov, Zoran
2017-11-01
Recent advances in photolithography allowed the fabrication of high-quality wire grid polarizers for the visible and near-infrared regimes. In turn, micropolarizer arrays (MPAs) based on wire grid polarizers have been developed and used to construct compact, versatile imaging polarimeters. However, the contrast and throughput of these polarimeters are significantly worse than one might expect based on the performance of large area wire grid polarizers or MPAs, alone. We investigate the parameters that affect the performance of wire grid polarizers and MPAs, using high-resolution two-dimensional and three-dimensional (3-D) finite-difference time-domain simulations. We pay special attention to numerical errors and other challenges that arise in models of these and other subwavelength optical devices. Our tests show that simulations of these structures in the visible and near-IR begin to converge numerically when the mesh size is smaller than ˜4 nm. The performance of wire grid polarizers is very sensitive to the shape, spacing, and conductivity of the metal wires. Using 3-D simulations of micropolarizer "superpixels," we directly study the cross talk due to diffraction at the edges of each micropolarizer, which decreases the contrast of MPAs to ˜200∶1.
Long term results of 125I for treatment of hyperthyroidism
International Nuclear Information System (INIS)
Bremner, W.F.; McDougall, I.R.; Greig, W.R.; Ratcliffe, J.G.
1976-01-01
125 I emits very low energy conversion and Auger electrons. This radionuclide has been used in place of 131 I with the hope of reducing the incidence of post treatment hypothyroidism. 303 of 360 patients treated have been reviewed. Originally very large doses of 125 I were prescribed (751-1,600 μCi/g) but 9 out of 15 patients (60%) became hypothyroid, therefore 4 smaller therapeutic regimes were employed. (1) 55 patients received doses of 200 μCi or less/g thyroid, 69% are euthyroid and 24% hypothyroid after an average of 33 months from treatment. (2) 87 patients received doses of 201-350 μCi/g thyroid, 67% are euthyroid and 21% hypothyroid after an average follow up of 30 months. (3) 70 patients received doses of 351-500 μCi/g thyroid, 77% are euthyroid and 18% hypothyroid 36 months after treatment and (4) 76 patients received doses of 501-750 μCi/g, 41% are euthyroid and 56% hypothyroid 49 months after therapy. No long term complications such as thyroid cancer or leukaemia have occurred but because 125 I does not eliminate or reduce the incidence of post treatment hypothyroidism it probably should not be used in preference to 131 I for the routine treatment of hyperthyroidism
Miller, Henry A
2013-01-01
Practical Wiring, Volume 1 is a 13-chapter book that first describes some of the common hand tools used in connection with sheathed wiring. Subsequent chapters discuss the safety in wiring, cables, conductor terminations, insulating sheathed wiring, conductor sizes, and consumer's control equipments. Other chapters center on socket outlets, plugs, lighting subcircuits, lighting accessories, bells, and primary and secondary cells. This book will be very valuable to students involved in this field of interest.
Wire EDM for Refractory Materials
Zellars, G. R.; Harris, F. E.; Lowell, C. E.; Pollman, W. M.; Rys, V. J.; Wills, R. J.
1982-01-01
In an attempt to reduce fabrication time and costs, Wire Electrical Discharge Machine (Wire EDM) method was investigated as tool for fabricating matched blade roots and disk slots. Eight high-strength nickel-base superalloys were used. Computer-controlled Wire EDM technique provided high quality surfaces with excellent dimensional tolerances. Wire EDM method offers potential for substantial reductions in fabrication costs for "hard to machine" alloys and electrically conductive materials in specific high-precision applications.
Detection Limits Of The 125I Air Sampler ''RIS125''
International Nuclear Information System (INIS)
Belaish, I.; Levinson, S.; German, U.; Kravchik, T.
1999-01-01
A system for 125 I monitoring in air (RIS-125) was designed and manufactured at NRCN. The main features of the system are described elsewhere. The system can monitor 125 I air contamination in gaseous and aerosol forms. An air monitoring system should have a fast response and the lowest available Minimum Detectable Activity (MDA). The present work presents the characteristic MDA values of the system
Audio wiring guide how to wire the most popular audio and video connectors
Hechtman, John
2012-01-01
Whether you're a pro or an amateur, a musician or into multimedia, you can't afford to guess about audio wiring. The Audio Wiring Guide is a comprehensive, easy-to-use guide that explains exactly what you need to know. No matter the size of your wiring project or installation, this handy tool provides you with the essential information you need and the techniques to use it. Using The Audio Wiring Guide is like having an expert at your side. By following the clear, step-by-step directions, you can do professional-level work at a fraction of the cost.
X-ray residual stress measurements on cold-drawn steel wire
Willemse, P.F.; Naughton, B.P.; Verbraak, C.A.
1982-01-01
The interplanar spacing d{hkl} versus sin2 ψ distributions were measured for the 211, 310, 220 and 200 reflections from severely cold-drawn 0.7% C steel wire with a diameter of 0.25 mm. From the shape of the curves it was concluded that, as well as a 110 fibre texture and elastic anisotropy, plastic
K-wire and tension band wire fixation in treating sternoclavicular joint dislocation
Directory of Open Access Journals (Sweden)
CHEN Qing-yu
2011-02-01
Full Text Available 【Abstract】Objective: To evaluate the feasibility and therapeutic effect of treating sternoclavicular joint dislocation by K-wire and tension band wire fixation, and to improve the safety and stability of this technique. Methods: This study consisted of 9 cases, 6 males and 3 females with the mean age of 25 years (range, 9-62 years. The causes were traffic accident in 7 cases, falling in 1 case and fight in 1 case. The duration from injury to operation was 2 hours to 7 days. There were 5 left dislocations and 4 right dislocations; 8 anterior dislocations and 1 posterior dislocation, including one combined with left scapular fracture and one with left olecranon fracture. Open reduction and internal fixation using K-wires and tension band wires were performed to treat dislocations. Results: All patients were followed up for 6 to 24 months, 10 months on average. According to Rockwood’s rating scale on postoperative sternoclavicular joint, 8 cases achieved excellent outcomes with an average score of 13.88, and the rest case achieved a good outcome with the score of 12. Anatomical reduction was obtained in all cases. There were no such postoperative complications as severe infection, injury to blood vessel and nerve, failure of fixation, etc. Patients were all satisfied with the anatomical reduction and functional recovery. Conclusions: The technique of K-wire and tension band wire fixation is safe, simple, effective, less invasive and has been successfully used in orthopedic surgery. It is effective in treating sternoclavicular joint dislocation though it has some disadvantages. Key words: Sternoclavicular joint; Dislocations; Bone wires; Fracture fixation, internal
Determination of the strain status of GaAs/AlAs quantum wires and quantum dots
Darhuber, A.A.; Bauer, G.; Wang, P.D.; Song, Y.P.; Sotomayor Torres, C.M.; Holland, M.C.
1995-01-01
We have investigated periodic arrays of 150 and 175 nm wide GaAs-AlAs quantum wires and quantum dots, fabricated by electron beam lithography and SiCI4/O2 reactive ion etching, by means of reciprocal space mapping using triple axis x-ray diffractometry (TAD). The reciprocal space maps reveal that
Wire Position Monitoring with FPGA based Electronics
International Nuclear Information System (INIS)
Eddy, N.; Lysenko, O.
2009-01-01
This fall the first Tesla-style cryomodule cooldown test is being performed at Fermilab. Instrumentation department is preparing the electronics to handle the data from a set of wire position monitors (WPMs). For simulation purposes a prototype pipe with a WMP has been developed and built. The system is based on the measurement of signals induced in pickups by 320 MHz signal carried by a wire through the WPM. The wire is stretched along the pipe with a tensioning load of 9.07 kg. The WPM consists of four 50 (Omega) striplines spaced 90 o apart. FPGA based digitizer scans the WPM and transmits the data to a PC via VME interface. The data acquisition is based on the PC running LabView. In order to increase the accuracy and convenience of the measurements some modifications were required. The first is implementation of an average and decimation filter algorithm in the integrator operation in the FPGA. The second is the development of alternative tool for WPM measurements in the PC. The paper describes how these modifications were performed and test results of a new design. The last cryomodule generation has a single chain of seven WPMs (placed in critical positions: at each end, at the three posts and between the posts) to monitor a cold mass displacement during cooldown. The system was developed in Italy in collaboration with DESY. Similar developments have taken place at Fermilab in the frame of cryomodules construction for SCRF research. This fall preliminary cryomodule cooldown test is being performed. In order to prepare an appropriate electronic system for the test a prototype pipe with a WMP has been developed and built, figure 1. The system is based on the measurement of signals induced in pickups by 320 MHz signal carried by a wire through the WPM. The 0.5 mm diameter Cu wire is stretched along the pipe with a tensioning load of 9.07 kg and has a length of 1.1 m. The WPM consists of four 50 (Omega) striplines spaced 90 o apart. An FPGA based digitizer
International Nuclear Information System (INIS)
Gay, D.A.T.; Edwards, A.J.; Puckett, M.A.; Roobottom, C.A.
2005-01-01
AIMS: To evaluate the success of two different types of wire in common use in their ability to successfully cannulate the superficial femoral artery (SFA) using antegrade puncture. METHODS: 50 consecutive patients in whom antegrade infra-inguinal intervention was planned, underwent common femoral arterial puncture and then cannulation with either a standard 3 mm 'J' wire or a floppy tipped straight wire (William Cook--Europe). The frequency with which each type of wire entered the SFA or profunda femoris artery without image guidance was recorded. Further analysis was also made of the success of manipulation of the wire into the SFA following profunda cannulation and the use of alternative guide wires. RESULTS: In 19 out of 25 (76%) patients the 'J' wire correctly entered the SFA without image guidance. Only 5 out of 25 (25%) of straight wires entered the SFA with the initial pass (p<0.0001). Following further manipulation with the same wire all except 1 'J' wire was successfully negotiated into the SFA. The same was true for only 9 of the remaining straight wires with 11 patients requiring an alternative guide wire. CONCLUSIONS: When performing antegrade cannulation of the SFA a 'J' wire is more likely to be successful than a straight guide wire
MgB2 superconducting wires basics and applications
2016-01-01
The compendium gives a complete overview of the properties of MgB2 (Magnesium Diboride), a superconducting compound with a transition temperature of Tc = 39K, from the fundamental properties to the fabrication of multifilamentary wires and to the presentation of various applications. Written by eminent researchers in the field, this indispensable volume not only discusses superconducting properties of MgB2 compounds, but also describes known preparation methods of thin films and of bulk samples obtained under high pressure methods. A unique selling point of the book is the detailed coverage of various applications based on MgB2, starting with MRI magnets and high current cables, cooled by Helium (He) vapor. High current cables cooled by liquid hydrogen are also highlighted as an interesting alternative due to the shrinking He reserves on earth. Other pertinent subjects comprise permanent magnets, ultrafine wires for space applications and wind generator projects.
Directory of Open Access Journals (Sweden)
Suliga M.
2015-04-01
Full Text Available In this work the analysis of the wire drawing process in hydrodynamic dies has been done. The drawing process of φ5.5 mm wire rod to the final wire of φ1.7 mm was conducted in 12 passes, in drawing speed range of 5-25 m/s. For final wires of φ1.7 mm the investigation of topography of wire surface, the amount of lubricant on the wire surface and the pressure of lubricant in hydrodynamic dies were determined. Additionally, in the work selected mechanical properties of the wires have been estimated.
14 CFR Appendix C to Part 125 - Ice Protection
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Ice Protection C Appendix C to Part 125...—Ice Protection If certification with ice protection provisions is desired, compliance with the following must be shown: (a) The recommended procedures for the use of the ice protection equipment must be...
Adamatzky, Andrew
2014-08-01
In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self-growing wetware circuits and devices, and integration of plant-based electronic components into future and emergent bio-hybrid systems. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
Report of a minor 125I exposure in a research laboratory
International Nuclear Information System (INIS)
Lambert, J.P.
1981-01-01
In routine thyroid scanning of personnel whose work involved the use of 125 I in biological research, it was discovered that an individual who had been iodinating proteins periodically for over 6 months showed a high thyroid count rate. It was decided to monitor the individual's thyroid weekly and to curtail his work in the laboratory until the cause of the thyroid uptake could be determined. Initially the 125 I concentration in his thyroid decreased as expected but a subsequent scan on the 21st day showed an 125 I concentration even greater than the initial level despite his absence from the laboratory. However on monitoring his office space, it was discovered that a felt pen was grossly contaminated and that the individual habitually put the pen in his mouth during moments of cogitation. It was concluded that a contaminated glove had transferred some 125 I to the pen during the course of the experiment. (U.K.)
Subscale Winged Rocket Development and Application to Future Reusable Space Transportation
Directory of Open Access Journals (Sweden)
Koichi YONEMOTO
2018-03-01
Full Text Available Kyushu Institute of Technology has been studying unmanned suborbital winged rocket called WIRES (WInged REusable Sounding rocket and its research subjects concerning aerodynamics, NGC (Navigation, Guidance and Control, cryogenic composite tanks etc., and conducting flight demonstration of small winged rocket since 2005. WIRES employs the original aerodynamic shape of HIMES (HIghly Maneuverable Experimental Sounding rocket studied by ISAS (Institute of Space and Astronautical Science of JAXA (Japan Aerospace Exploration Agency in 1980s. This paper presents the preliminary design of subscale non-winged and winged rockets called WIRES#013 and WIRES#015, respectively, that are developed in collaboration with JAXA, USC (University of Southern California, UTEP (University of Texas at El Paso and Japanese industries. WIRES#013 is a conventional pre-test rocket propelled by two IPA-LOX (Isopropyl Alcohol and Liquid Oxygen engines under development by USC. It has the total length of 4.6m, and the weight of 1000kg to reach the altitude of about 6km. The flight objective is validation of the telemetry and ground communication system, recovery parachute system, and launch operation of liquid engine. WIRES#015, which has the same length of WIRES#013 and the weight of 1000kg, is a NGC technology demonstrator propelled by a fully expander-cycle LOX-Methane engine designed and developed by JAXA to reach the altitude more than 6km. The flight tests of both WIRES#013 and WIRES#015 will be conducted at the launch facility of FAR (Friends of Amateur Rocketry, Inc., which is located at Mojave Desert of California in United States of America, in May 2018 and March 2019 respectively. After completion of WIRES#015 flight tests, the suborbital demonstrator called WIRES-X will be developed and its first flight test well be performed in 2020. Its application to future fully reusable space transportation systems, such as suborbital space tour vehicles and two
Iodine-125-labelled tamoxifen is differentially cytoxic to cells containing oestrogen receptors
International Nuclear Information System (INIS)
Bloomer, W.D.; McLaughlin, W.H.; Weichselbaum, R.R.
1980-01-01
Tamoxifen, a non-steroidal anti-oestrogen competes with 17 - oestradiol for oestrogen receptor protein and is translocated to the nucleus. Carrier-free 125 I-TAM was tested for cytotoxicity in oestrogen receptor rich (human breast cancer MCF-7) and poor (V-79 Chinese hamster) cells. 125 I-TAM was differentially cytotoxic to MCF-7 cells. The D 37 values for MCF-7 and V-79 cells were 0.5 and 1.5 pCi/cell respectively. No radiotoxicity was observed with Na 125 I at doses equal to 125 I-TAM; iodide was effectively excluded from both cell lines and remained in the extracellular space. Also, nonradioactive 127 I-TAM and TAM were both non-toxic when tested at levels comparable to 125 I-TAM. It is suggested that the marked cytotoxicity in MCF-7 cells results from close approximation of 125 I with the genetic apparatus as a result of direct charging of specific nuclear receptors and/or translocation of 125 I-TAM receptor complexes from the cytoplasm to the nucleus, and that the minimal toxicity in V-79 cells reflects transmitted cytoplasmic radiation effects, limited direct nuclear charging and/or limited nuclear translocation resulting from the relative paucity of oestrogen in the cells. (U.K.)
PPM-based System for Guided Waves Communication Through Corrosion Resistant Multi-wire Cables
Trane, G.; Mijarez, R.; Guevara, R.; Pascacio, D.
Novel wireless communication channels are a necessity in applications surrounded by harsh environments, for instance down-hole oil reservoirs. Traditional radio frequency (RF) communication schemes are not capable of transmitting signals through metal enclosures surrounded by corrosive gases and liquids. As an alternative to RF, a pulse position modulation (PPM) guided waves communication system has been developed and evaluated using a corrosion resistant 4H18 multi-wire cable, commonly used to descend electronic gauges in down-hole oil applications, as the communication medium. The system consists of a transmitter and a receiver that utilizes a PZT crystal, for electrical/mechanical coupling, attached to each extreme of the multi-wire cable. The modulator is based on a microcontroller, which transmits60 kHz guided wave pulses, and the demodulator is based on a commercial digital signal processor (DSP) module that performs real time DSP algorithms. Experimental results are presented, which were obtained using a 1m corrosion resistant 4H18multi-wire cable, commonly used with downhole electronic gauges in the oil sector. Although there was significant dispersion and multiple mode excitations of the transmitted guided wave energy pulses, the results show that data rates on the order of 500 bits per second are readily available employing PPM and simple communications techniques.
Investigation of method for Stainless Steel Welding Wire as a Replacement for Arc Wire Comsumables
Directory of Open Access Journals (Sweden)
Koiprasert, H.
2005-01-01
Full Text Available Arc spraying as a coating method is being employed in various industrial applications as a part of maintenance service, and also as a surface engineering technique for many machine parts and components. The major cost in producing the arc spray coating is, however, based on the cost of the arc wire comsumables. This project was carried out to investigate the use of the commercially-available gas metal arc welding wire (GMAW wire as a cheaper alternative to the special-purpose arc wire comsumables. The wire material chosen for this early study is the 316L stainless steel, due to its popularity in many applications as a built-up coating for worn parts. The physical properties of the coatings produced from the two sets of 316L stainless steel wire were determined to be different in the percentage of porosity and the oxide content. The mechanical properties, including the tensile bond strength and the wear rate of the coatings produced from the two types of sprayed wire, were also different. This will, in turn, result in a slight difference in the performance of thecoatings.
Welding wire pressure sensor assembly
Morris, Timothy B. (Inventor); Milly, Peter F., Sr. (Inventor); White, J. Kevin (Inventor)
1994-01-01
The present invention relates to a device which is used to monitor the position of a filler wire relative to a base material being welded as the filler wire is added to a welding pool. The device is applicable to automated welding systems wherein nonconsumable electrode arc welding processes are utilized in conjunction with a filler wire which is added to a weld pool created by the electrode arc. The invention senses pressure deviations from a predetermined pressure between the filler wire and the base material, and provides electrical signals responsive to the deviations for actuating control mechanisms in an automatic welding apparatus so as to minimize the pressure deviation and to prevent disengagement of the contact between the filler wire and the base material.
DETECTORS: Vienna - beyond the wire
International Nuclear Information System (INIS)
Krammer, Manfred; Regler, Meinhard
1995-01-01
In 1986, at the fourth Vienna Wire Chamber Conference, Georges Charpak, the inventor of the multiwire proportional chamber, had confidently announced ''Les funérailles des chambres à fils''. Was this the writing on the wall for the conference series as well as this type of detector technology? The demand for detector innovation, coupled with imaginative thinking on the part of the organizers, have kept the Vienna venue at the forefront of the physics calendar. An additional boost to the success of the series was certainly the Nobel Prize awarded to Georges Charpak in 1992. While the major topic naturally is still wire chambers, alternative technologies are also covered. However in fields like calorimetry or ring imaging Cherenkovs, a sample of only a few prominent detectors were presented, giving some participants the impression of a biased selection. The fact that silicon detectors, electronics and track reconstruction strategies were, with the exception of the invited talks, restricted to poster presentations led to the same conclusion. As a result the organizing committee saw that it will have to revise its brief for the next conference. The conference opened with philosophical thoughts by Nobel Prizewinner Georges Charpak. The first day at Vienna is traditionally devoted to applications of gaseous detectors outside high energy physics. L. Shektman gave an overview of wire chambers for medical imaging. Further applications in medicine and in other fields like biology and space science were described by subsequent speakers. The exciting idea of flying a spectrometer on a balloon to study the fraction of electrons and positrons in cosmic rays attracted a lot of attention. The next day covered wire chambers in general. V. Polychronakos presented applications of cathode strip chambers in muon spectrometers for experiments at CERN's LHC proton-proton detector. Certainly the challenges of LHC for detector development dominated many
International Nuclear Information System (INIS)
Hawley, J.T.; Chiu, C.; Todreas, N.E.; Rohsenow, W.M.
1980-01-01
Correlations are presented for subchannel and bundle friction factors and flowsplit parameters for laminar, transition and turbulent longitudinal flows in wire wrap spaced hexagonal arrays. These results are obtained from pressure drop models of flow in individual subchannels. For turbulent flow, an existing pressure drop model for flow in edge subchannels is extended, and the resulting edge subchannel friction factor is identified. Using the expressions for flowsplit parameters and the equal pressure drops assumption, the interior subchannel and bundle friction factors are obtained. For laminar flow, models are developed for pressure drops of individual subchannels. From these models, expressions for the subchannel friction factors are identified and expressions for the flowsplit parameters are derived
Energy Technology Data Exchange (ETDEWEB)
Hawley, J.T.; Chiu, C.; Rohsenow, W.M.; Todreas, N.E.
1980-08-01
Correlations are presented for subchannel and bundle friction factors and flowsplit parameters for laminar, transition and turbulent longitudinal flows in wire wrap spaced hexagonal arrays. These results are obtained from pressure drop models of flow in individual subchannels. For turbulent flow, an existing pressure drop model for flow in edge subchannels is extended, and the resulting edge subchannel friction factor is identified. Using the expressions for flowsplit parameters and the equal pressured drop assumption, the interior subchannel and bundle friction factors are obtained. For laminar flow, models are developed for pressure drops of individual subchannels. From these models, expressions for the subchannel friction factors are identified and expressions for the flowsplit parameters are derived.
Effect of thermocycling on nickel release from orthodontic arch wires: an in vitro study.
Sheibaninia, Ahmad
2014-12-01
The amount of daily intake of metals from orthodontic appliances over time is a matter of great concern. Nickel results in one of the most common metal-induced allergic contact dermatitis in humans; it produces more allergic reactions than all the other metals combined together. The purpose of this study was to evaluate the effects of thermocycling on the nickel release from orthodontic arch wires stored in artificial saliva with different pH values. Forty new wire pieces were selected. Each wire piece was placed in a special capillary Pyrex tube filled with artificial saliva, which was sealed and immersed in deionized water at 37 °C. The samples were divided into four groups of ten. Group I received no treatment; group II was subjected to thermocycling. The pH of storage in groups III and IV was reduced to 4.5, and group IV was subjected to thermocycling. Thermocycling was carried out between 5 and 55 °C for 500 cycles. The release of nickel ions was statistically analyzed by two-way ANOVA for the effects of two variables: pH and thermocycling. The interaction between pH and thermocycling was found to be statistically significant (F = 12.127, P = 0.001). Two-way ANOVA showed that different storage media or pH and thermocycling had a significant effect on the nickel release (F = 52.812, P nickel from orthodontic wires, while thermocycling is clearly the dominant factor.
Directory of Open Access Journals (Sweden)
You Na Oh
2015-08-01
Full Text Available Background: Stainless steel wiring remains the most popular technique for primary sternal closure. Recently, a multifilament cable wiring system (Pioneer Surgical Technology Inc., Marquette, MI, USA was introduced for sternal closure and has gained wide acceptance due to its superior resistance to tension. We aimed to compare conventional steel wiring to multifilament cable fixation for sternal closure in patients undergoing major cardiac surgery. Methods: Data were collected retrospectively on 1,354 patients who underwent sternal closure after major cardiac surgery, using either the multifilament cable wiring system or conventional steel wires between January 2009 and October 2010. The surgical outcomes of these two groups of patients were compared using propensity score matching based on 18 baseline patient characteristics. Results: Propensity score matching yielded 392 pairs of patients in the two groups whose baseline profiles showed no significant differences. No significant differences between the two groups were observed in the rates of early mortality (2.0% vs. 1.3%, p=0.578, major wound complications requiring reconstruction (1.3% vs. 1.3%, p>0.99, minor wound complications (3.6% vs. 2.0%, p=0.279, or mediastinitis (0.8% vs. 1.0%, p=1.00. Patients in the multifilament cable group had fewer sternal bleeding events than those in the conventional wire group, but this tendency was not statistically significant (4.3% vs. 7.4%, p=0.068. Conclusion: The surgical outcomes of sternal closure using multifilament cable wires were comparable to those observed when conventional steel wires were used. Therefore, the multifilament cable wiring system may be considered a viable option for sternal closure in patients undergoing major cardiac surgery.
Oh, You Na; Ha, Keong Jun; Kim, Joon Bum; Jung, Sung-Ho; Choo, Suk Jung; Chung, Cheol Hyun; Lee, Jae Won
2015-08-01
Stainless steel wiring remains the most popular technique for primary sternal closure. Recently, a multifilament cable wiring system (Pioneer Surgical Technology Inc., Marquette, MI, USA) was introduced for sternal closure and has gained wide acceptance due to its superior resistance to tension. We aimed to compare conventional steel wiring to multifilament cable fixation for sternal closure in patients undergoing major cardiac surgery. Data were collected retrospectively on 1,354 patients who underwent sternal closure after major cardiac surgery, using either the multifilament cable wiring system or conventional steel wires between January 2009 and October 2010. The surgical outcomes of these two groups of patients were compared using propensity score matching based on 18 baseline patient characteristics. Propensity score matching yielded 392 pairs of patients in the two groups whose baseline profiles showed no significant differences. No significant differences between the two groups were observed in the rates of early mortality (2.0% vs. 1.3%, p=0.578), major wound complications requiring reconstruction (1.3% vs. 1.3%, p>0.99), minor wound complications (3.6% vs. 2.0%, p=0.279), or mediastinitis (0.8% vs. 1.0%, p=1.00). Patients in the multifilament cable group had fewer sternal bleeding events than those in the conventional wire group, but this tendency was not statistically significant (4.3% vs. 7.4%, p=0.068). The surgical outcomes of sternal closure using multifilament cable wires were comparable to those observed when conventional steel wires were used. Therefore, the multifilament cable wiring system may be considered a viable option for sternal closure in patients undergoing major cardiac surgery.
Clinical bending of nickel titanium wires
Directory of Open Access Journals (Sweden)
Stephen Chain
2015-01-01
Full Text Available Since the evolution and the involvement of Nickel Titanium wires in the field of Orthodontics. The treatment plan has evolved with the use of low force Nickel Titanium wires. Because of their high springback, low stiffness, they are the key initial wires in leveling and alignment but have poor formability. Since poor formability limits its ability to create variable arch forms thus; limits the form of treatment. We have devised a method to bend the Nickel Titanium wires to help in our inventory but also customized the wire according to the treatment.
Energy Deposition in a Septum Wire
Ferioli, G; Knaus, P; Koopman, J; CERN. Geneva. SPS and LHC Division
2001-01-01
The present note describes a machine development (MD) aimed to confirm experimentally the need for protection of the extraction wire septum ZS in SPS long straight section LSS6 during LHC operation. Single wires identical to the ones mounted on the extraction septum were fixed on a fast wire scanner and put into the beam path. The beam heated the wire until it broke after a measured number of turns. The maximum single shot intensity the septum wires could withstand was thus calculated and compared with simulation results.
F-8 Digital Fly-by-Wire (DFBW) in flight over snow capped mountains
1973-01-01
F-8 Digital Fly-by-Wire (DFBW) aircraft in flight over snow capped mountains. Externally identical to a standard Navy F-8C, this aircraft had its control system replaced initially by a primary system using an Apollo digital computer. The backup system used three analog computers. When the pilot moved the airplane's stick and rudder, electronic signals went to the computer, which would generate signals to move the control surfaces. The system was designed so that the digital fly-by-wire aircraft would handle almost identically to a standard F-8C. Later, in Phase 2, the aircraft used three IBM AP-101 computers for its flight control system. The F-8 Digital Fly-By-Wire (DFBW) flight research project validated the principal concepts of all-electric flight control systems now used on nearly all modern high-performance aircraft and on military and civilian transports. The first flight of the 13-year project was on May 25, 1972, with research pilot Gary E. Krier at the controls of a modified F-8C Crusader that served as the testbed for the fly-by-wire technologies. The project was a joint effort between the NASA Flight Research Center, Edwards, California, (now the Dryden Flight Research Center) and Langley Research Center. It included a total of 211 flights. The last flight was December 16, 1985, with Dryden research pilot Ed Schneider at the controls. The F-8 DFBW system was the forerunner of current fly-by-wire systems used in the space shuttles and on today's military and civil aircraft to make them safer, more maneuverable, and more efficient. Electronic fly-by-wire systems replaced older hydraulic control systems, freeing designers to design aircraft with reduced in-flight stability. Fly-by-wire systems are safer because of their redundancies. They are more maneuverable because computers can command more frequent adjustments than a human pilot can. For airliners, computerized control ensures a smoother ride than a human pilot alone can provide. Digital-fly-by-wire
Feasibility studies on the direct wire readout on wire scanners in electron accelerators
International Nuclear Information System (INIS)
Markert, Michael
2010-10-01
This bachelor thesis deals essentially with the signal processing of a so-called wire scanner, a special monitor, which comes to application in the beam diagnostics of particle accelerators. In this direct wire readout the voltage signal, which is induced by the particle beam in the measurement wire of the wire scanner, shall be directly read out. The aim of this thesis is to show fundamental considerations and perform studies, which study, whether and how in the future by means of a suited data transmission as well as readout electronics conclusion on the most important parameters of the beam, like position and profile, are possible. The measurement system presented here is divided in three main components: Signal measurement, signal preparation, and signal stretching. A suited test facility was developed and is presented in detail, in which then all components, like for instance the transmission cables, the wire-scanner fork, and the developed measurement circuit, are studied, which are of importance for a faultless signal transmission and presentation. Extensive measurements on the single components, as well as calculations for the signal transmission on and in the wire scanner were performed, whereby a good agreement could be found. Thereafter a comparison and a selection of the component used in this project were made. Furthermore improvement proposals, new constructions, and outlooks are presented, which could be of importance in further works.
Wire Scanner Motion Control Card
Forde, S E
2006-01-01
Scientists require a certain beam quality produced by the accelerator rings at CERN. The discovery potential of LHC is given by the reachable luminosity at its interaction points. The luminosity is maximized by minimizing the beam size. Therefore an accurate beam size measurement is required for optimizing the luminosity. The wire scanner performs very accurate profile measurements, but as it can not be used at full intensity in the LHC ring, it is used for calibrating other profile monitors. As the current wire scanner system, which is used in the present CERN accelerators, has not been made for the required specification of the LHC, a new design of a wire scanner motion control card is part of the LHC wire scanner project. The main functions of this card are to control the wire scanner motion and to acquire the position of the wire. In case of further upgrades at a later stage, it is required to allow an easy update of the firmware, hence the programmable features of FPGAs will be used for this purpose. The...
K-wire and tension band wire fixation in treating sternoclavicular joint dislocation.
Chen, Qing-yu; Cheng, Shao-wen; Wang, Wei; Lin, Zhong-qin; Zhang, Wei; Kou, Dong-quan; Shen, Yue; Ying, Xiao-zhou; Cheng, Xiao-jie; Lv, Chuan-zhu; Peng, Lei
2011-02-01
To evaluate the feasibility and therapeutic effect of treating sternoclavicular joint dislocation by K-wire and tension band wire fixation, and to improve the safety and stability of this technique. This study consisted of 9 cases, 6 males and 3 females with the mean age of 25 years (range, 9-62 years). The causes were traffic accident in 7 cases, falling in 1 case and fight in 1 case. The duration from injury to operation was 2 hours to 7 days. There were 5 left dislocations and 4 right dislocations; 8 anterior dislocations and 1 posterior dislocation, including one combined with left scapular fracture and one with left olecranon fracture. Open reduction and internal fixation using K-wires and tension band wires were performed to treat dislocations. All patients were followed up for 6 to 24 months, 10 months on average. According to Rockwood's rating scale on postoperative sternoclavicular joint, 8 cases achieved excellent outcomes with an average score of 13.88, and the rest case achieved a good outcome with the score of 12. Anatomical reduction was obtained in all cases. There were no such postoperative complications as severe infection, injury to blood vessel and nerve, failure of fixation, etc. Patients were all satisfied with the anatomical reduction and functional recovery. The technique of K-wire and tension band wire fixation is safe, simple, effective, less invasive and has been successfully used in orthopedic surgery. It is effective in treating sternoclavicular joint dislocation though it has some disadvantages.
Wire chamber radiation detector with discharge control
International Nuclear Information System (INIS)
Perez-Mendez, V.; Mulera, T.A.
1984-01-01
A wire chamber radiation detector has spaced apart parallel electrodes and grids defining an ignition region in which charged particles or other ionizing radiations initiate brief localized avalanche discharges and defining an adjacent memory region in which sustained glow discharges are initiated by the primary discharges. Conductors of the grids at each side of the memory section extend in orthogonal directions enabling readout of the X-Y coordinates of locations at which charged particles were detected by sequentially transmitting pulses to the conductors of one grid while detecting transmissions of the pulses to the orthogonal conductors of the other grid through glow discharges. One of the grids bounding the memory region is defined by an array of conductive elements each of which is connected to the associated readout conductor through a separate resistance. The wire chamber avoids ambiguities and imprecisions in the readout of coordinates when large numbers of simultaneous or near simultaneous charged particles have been detected. Down time between detection periods and the generation of radio frequency noise are also reduced
2010-09-30
... Welding Wire Containers and Components Thereof and Welding Wire; Notice of Commission Determination To... within the United States after importation of certain bulk welding wire containers, components thereof, and welding wire by reason of infringement of certain claims of United States Patent Nos. 6,260,781; 6...
Liu, Wei-Ting; Hsiao, Chun-I.; Hsu, Wen-Dung
2014-01-01
In this study we have used atomistic simulations to investigate the role of surface on the size-dependent mechanical properties of nano-wires. In particular, we have performed computational investigation on single crystal face-centered cubic copper nano-wires with diameters ranging from 2 to 20 nm. The wire axis for all the nano-wires are considered along the [0 0 1] direction. Characterization of the initial optimized structures revealed clear differences in interatomic spacing, stress, and potential energy in all the nano-wires. The mechanical properties with respect to wire diameter are evaluated by applying tension along the [0 0 1] direction until yielding. We have discussed the stress-strain relationships, Young's modulus, and the variation in potential energy from surface to the center of the wire for all the cases. Our results indicate that the mechanical response (including yield strain, Young's modulus, and resilience) is directly related to the proportion of surface to bulk type atoms present in each nano-wire. Thus the size-dependent mechanical properties of single crystal copper nano-wire within elastic region are attributed to the surface to volume ratio (surface effect). Using the calculated response, we have formulated a mathematical relationship, which predicts the nonlinear correlation between the mechanical properties and the diameter of the wire.
Self-expandable stent loaded with {sup 125}I seeds: Feasibility and safety in a rabbit model
Energy Technology Data Exchange (ETDEWEB)
Guo Jinhe [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China); Teng Gaojun [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China)]. E-mail: gjteng@vip.sina.com; Zhu Guangyu [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China); He Shicheng [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China); Deng Gang [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China); He Jie [Department of Radiology, Zhong-Da Hospital, Southeast University, 87 Dingjiaqiao Road, Nanjing 210009 (China)
2007-02-15
Objective: To evaluate technical feasibility and acute and subacute radiotolerance of a self-expandable stent loaded with {sup 125}I seeds in the rabbit esophagus. Methods: A self-expandable stent designed for esophageal application was made of 0.16 mm nitinol wire and loaded with {sup 125}I seeds (CIAE-6711). Twenty-seven stents with three different radioactive dosages (n = 9 in each dosage group) were implanted in the esophagus of healthy rabbits, while nine stents alone were used as controls. The stents were perorally deployed into the esophagus under fluoroscopic guidance. Radiological follow-up included plain chest film, CT scan, and barium esophagography which were undertaken in all rabbits of each group at 2, 4, and 8 weeks, respectively, which were correlated to histopathological findings. The stented esophageal segments along with their adjacent tissues were harvested for histopathological examinations. Results: The stent was successfully deployed into the targeted esophageal segment in all rabbits. Neither {sup 125}I seeds dislodged from the stent during the deployment, nor they did during the follow-up period. The greatest (16.2 Gy) absorbed dose was found in the tissue 10 mm from {sup 125}I seeds at 8 weeks. Slight epithelial hyperplasia on the stent surface and submucosal inflammatory process developed at 2 weeks, which reached the peak at 8 weeks after the procedure. Significant thickness of the esophageal muscular layer was found at 8 weeks only in the groups with {sup 125}I seeds. On radiologic follow-up, moderate strictures on both ends of the stents developed at 4 weeks and became severe at 8 weeks after the procedure in all groups. Conclusion: Deployment of a self-expandable stent loaded with {sup 125}I seeds is technically feasible and safe within the first 8 weeks. Acute and subacute radiotolerance of the treated esophagus and its adjacent tissues by {sup 125}I seeds is well preserved in a healthy rabbit model.
14 CFR 21.125 - Production inspection system: Materials Review Board.
2010-01-01
... § 21.125 Production inspection system: Materials Review Board. Link to an amendment published at 74 FR... Materials Review Board action for at least two years. (b) The production inspection system required in § 21... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Production inspection system: Materials...
Plasma chemistry in wire chambers
International Nuclear Information System (INIS)
Wise, J.
1990-05-01
The phenomenology of wire chamber aging is discussed and fundamentals of proportional counters are presented. Free-radical polymerization and plasma polymerization are discussed. The chemistry of wire aging is reviewed. Similarities between wire chamber plasma (>1 atm dc-discharge) and low-pressure rf-discharge plasmas, which have been more widely studied, are suggested. Construction and use of a system to allow study of the plasma reactions occurring in wire chambers is reported. A proportional tube irradiated by an 55 Fe source is used as a model wire chamber. Condensable species in the proportional tube effluent are concentrated in a cryotrap and analyzed by gas chromatography/mass spectrometry. Several different wire chamber gases (methane, argon/methane, ethane, argon/ethane, propane, argon/isobutane) are tested and their reaction products qualitatively identified. For all gases tested except those containing methane, use of hygroscopic filters to remove trace water and oxygen contaminants from the gas resulted in an increase in the average molecular weight of the products, consistent with results from low-pressure rf-discharge plasmas. It is suggested that because water and oxygen inhibit polymer growth in the gas phase that they may also reduce polymer deposition in proportional tubes and therefore retard wire aging processes. Mechanistic implications of the plasma reactions of hydrocarbons with oxygen are suggested. Unresolved issues in this work and proposals for further study are discussed
Klocke, F.; Herrig, T.; Zeis, M.; Klink, A.
2017-10-01
Combining the working principle of electrochemical machining (ECM) with a universal rotating tool, like a wire, could manage lots of challenges of the classical ECM sinking process. Such a wire-ECM process could be able to machine flexible and efficient 2.5-dimensional geometries like fir tree slots in turbine discs. Nowadays, established manufacturing technologies for slotting turbine discs are broaching and wire electrical discharge machining (wire EDM). Nevertheless, high requirements on surface integrity of turbine parts need cost intensive process development and - in case of wire-EDM - trim cuts to reduce the heat affected rim zone. Due to the process specific advantages, ECM is an attractive alternative manufacturing technology and is getting more and more relevant for sinking applications within the last few years. But ECM is also opposed with high costs for process development and complex electrolyte flow devices. In the past, few studies dealt with the development of a wire ECM process to meet these challenges. However, previous concepts of wire ECM were only suitable for micro machining applications. Due to insufficient flushing concepts the application of the process for machining macro geometries failed. Therefore, this paper presents the modeling and simulation of a new flushing approach for process assessment. The suitability of a rotating structured wire electrode in combination with an axial flushing for electrodes with high aspect ratios is investigated and discussed.
Empolder and application of LiveWire program
International Nuclear Information System (INIS)
Zhang Bo; Li Jing; Wang Xiaoming
2007-01-01
LiveWire is a specific module of Netscape Web server to actualize CGI function; through LiveWire application program one can create dynamic web page on web site. This article introduces how to write LiveWire application code, have to compile, debug and manage LiveWire application programs, and how to apply LiveWire application program on Netscape Web server to create a dynamic web page. (authors)
R.I.S.-125 {sup 125}I air monitor system
Energy Technology Data Exchange (ETDEWEB)
Belaish, I; Levinson, S; German, U; Pelled, O; Laichter, Y; Wangrovitz, U; Tirosh, D; Barak, D [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev
1996-12-01
We have developed at NRCN a prototype of a continuous K-Ray air monitoring (CAM) system called `R.1.S.-125` (Radioactive Isotope Sampler for {sup 125}I). The system. was checked according to ANSI N42.17B -1989 (authors).
Wire-array initiation and interwire-plasma merger concerns in PBFA-Z tungsten z-pinch implosions
Energy Technology Data Exchange (ETDEWEB)
Sanford, T.W.L.; Spielman, R.B.; Allshouse, G.O. [Sandia National Labs., Albuquerque, NM (United States)] [and others
1997-12-31
Experiments with annular wire-array loads to generate high quality, high-power, z-pinch implosions on Saturn have shown the importance of maintaining azimuthal symmetry and how the individual wire plasmas merge to form a plasma shell. Here the authors discuss the impact of current symmetry, current prepulse, interwire spacing, and wire size on generating high-quality, high-power, z-pinch implosions on PBFA-Z, with annular tungsten wire loads. B-dot monitors measured the current as a function of azimuth in the MITLs and 4.5 cm upstream of the load. Bolometers and filtered XRDs and PCDs, spanning the energy range {approximately} 0 eV to 6 keV, monitored the temporal characteristics of the radiation. Time-integrated and time-resolved, filtered, fast-framing, x-ray pinhole cameras, and a crystal spectrometer monitored the spatial and spectral structure of the radiation. The radial dynamics of single-wire plasmas from the solid-state, using the measured current, was calculated by 1D radiation magnetohydrodynamics code (RMHC) and used as input to an xy RMHC. These calculations together with 2D RMHC simulations in the rz plane are discussed and correlated with the measurements.
Wire-array initiation and interwire-plasma merger concerns in PBFA-Z tungsten z-pinch implosions
International Nuclear Information System (INIS)
Sanford, T.W.L.; Spielman, R.B.; Allshouse, G.O.
1997-01-01
Experiments with annular wire-array loads to generate high quality, high-power, z-pinch implosions on Saturn have shown the importance of maintaining azimuthal symmetry and how the individual wire plasmas merge to form a plasma shell. Here the authors discuss the impact of current symmetry, current prepulse, interwire spacing, and wire size on generating high-quality, high-power, z-pinch implosions on PBFA-Z, with annular tungsten wire loads. B-dot monitors measured the current as a function of azimuth in the MITLs and 4.5 cm upstream of the load. Bolometers and filtered XRDs and PCDs, spanning the energy range ∼ 0 eV to 6 keV, monitored the temporal characteristics of the radiation. Time-integrated and time-resolved, filtered, fast-framing, x-ray pinhole cameras, and a crystal spectrometer monitored the spatial and spectral structure of the radiation. The radial dynamics of single-wire plasmas from the solid-state, using the measured current, was calculated by 1D radiation magnetohydrodynamics code (RMHC) and used as input to an xy RMHC. These calculations together with 2D RMHC simulations in the rz plane are discussed and correlated with the measurements
Control of flow past a circular cylinder via a spanwise surface wire: effect of the wire scale
Energy Technology Data Exchange (ETDEWEB)
Ekmekci, Alis [University of Toronto Institute for Aerospace Studies, Toronto, ON (Canada); Rockwell, Donald [Lehigh University, Department of Mechanical Engineering, Bethlehem, PA (United States)
2011-09-15
Flow phenomena induced by a single spanwise wire on the surface of a circular cylinder are investigated via a cinema technique of particle image velocimetry (PIV). The primary aim of this investigation is to assess the effect of the wire scale. To this end, consideration is given to wires with different diameters that are 0.5, 1.2, and 2.9% of the cylinder diameter. The Reynolds number has a subcritical value of 10,000. Compared to the thickness of the unperturbed boundary layer developing around the cylinder between 5 and 75 from the forward stagnation point, the former two wires have smaller scales and the latter has a larger scale. Two angular locations of the wire, defined with respect to the forward stagnation point of the cylinder, are found to be critical. When the wire is located at these critical angles, either the most significant extension or the contraction of the time-mean separation bubble occurs in the near wake. These critical angles depend on the wire scale: the smaller the wire, the larger the critical angle. The small-scale and large-scale wires that have diameters of 1.2 and 2.9% of the cylinder diameter induce bistable shear-layer oscillations between different separation modes when placed at their respective critical angles corresponding to maximum extension of the near-wake bubble. These oscillations have irregular time intervals that are much longer than the time scale associated with the classical Karman instability. Moreover, the large-scale wire can either significantly attenuate or intensify the Karman mode of vortex shedding at the critical states; in contrast, the small-scale wires do not notably alter the strength of the Karman instability. (orig.)
Preliminary Single-Phase Mixing Test using Wire Mesh System in a wire-wrapped 37-rod Bundle
International Nuclear Information System (INIS)
Bae, Hwang; Kim, Hyungmo; Lee, Dong Won; Choi, Hae Seob; Choi, Sun Rock; Chang, Seokkyu; Kim, Seok; Euh, Dongjin; Lee, Hyeongyeon
2014-01-01
In this paper, preliminary tests of the wire-mesh sensor are introduced before measuring of mixing coefficient in the wire-wrapped 37-pin fuel assembly for a sodium-cooled fast reactor. Through this preliminary test, it was confirmed that city water can be used as a tracer for demineralized water as a base. A simple test was performed to evaluate the characteristics of a wire mesh with of a short pipe shape. The conductivity of de-mineralized water and city water is linearly increased for the limited temperature ranges as the temperature is increased. The reliability of the wire mesh sensor was estimated based on the averages and standard deviations of the plane image using the cross points. A wire mesh sensor is suitable to apply to a single-phase flow measurement for a mixture with de-mineralized water and city water. A wire mesh sensor and system have been traditionally used to measure the void fraction of a two-phase flow field with gas and liquid. Recently, Ylonen et al. successfully designed and commissioned a measurement system for a single-phase flow using a wire mesh sensor
Precision multiloop (PM Design) with space closing circles for lingual orthodontics
Mugdha P Mankar; Achint Chachada; Harish Atram; Avanti Kulkarni
2016-01-01
The proficiency of ancient orthodontics has been benefitted colossally and is being continually promoted over the present, by use of multiple loop wires designed for correction of dentoalveolar malocclusions. The presented discussion provides an insight into a simple, frictionless biomechanical concept of anterior space closure in lingual orthodontics by means of precision multiloop design with incorporated space closing circles. A multiple loop wire design has been demonstrated where the ent...
Wire sawing for the application for dismantling of nuclear facilities
Energy Technology Data Exchange (ETDEWEB)
Toenshoff, H.K.; Hillmann-Apmann, H. [Hannover Univ. (Germany). Inst. for Production Engineering and Machine Tools
2001-07-01
In recent years diamond wire sawing process has been established as a technique for machining of hard and brittle materials in the quarrying and dimensioning of natural stone, i.e. marble and granite /Bor94/, or in machining of concrete and reinforced concrete /NN89, NN90, Rus93, Zil89/. It is more and more applied in different industrial sectors, namely the building and road-building industry, for purposes of reconstruction and decommissioning/. For the application of cutting austenitic steel most of the current wire sawing tools can not be used. First the diamond get in chemical reaction with the steel (graphitisation) and also the plastic flow of the workpiece material (''smearing'') while processing this material, the chip spaces between the diamonds are filled with the steel chips and thus the effective processing is reduced. Only the very tips of the diamonds are in contact with the workpiece, which leads in most cases to rapid wear of the grains. The tool loses its ability to grind in short terms of time. All these problems exclude the wire sawing technique from wide areas of application of cutting ductile steel materials. (orig.)
Wire sawing for the application for dismantling of nuclear facilities
International Nuclear Information System (INIS)
Toenshoff, H.K.; Hillmann-Apmann, H.
2001-01-01
In recent years diamond wire sawing process has been established as a technique for machining of hard and brittle materials in the quarrying and dimensioning of natural stone, i.e. marble and granite /Bor94/, or in machining of concrete and reinforced concrete /NN89, NN90, Rus93, Zil89/. It is more and more applied in different industrial sectors, namely the building and road-building industry, for purposes of reconstruction and decommissioning/. For the application of cutting austenitic steel most of the current wire sawing tools can not be used. First the diamond get in chemical reaction with the steel (graphitisation) and also the plastic flow of the workpiece material (''smearing'') while processing this material, the chip spaces between the diamonds are filled with the steel chips and thus the effective processing is reduced. Only the very tips of the diamonds are in contact with the workpiece, which leads in most cases to rapid wear of the grains. The tool loses its ability to grind in short terms of time. All these problems exclude the wire sawing technique from wide areas of application of cutting ductile steel materials. (orig.)
submitter Dynamical Models of a Wire Scanner
Barjau, Ana; Dehning, Bernd
2016-01-01
The accuracy of the beam profile measurements achievable by the current wire scanners at CERN is limited by the vibrations of their mechanical parts. In particular, the vibrations of the carbon wire represent the major source of wire position uncertainty which limits the beam profile measurement accuracy. In the coming years, due to the Large Hadron Collider (LHC) luminosity upgrade, a wire traveling speed up to 20 $m s^{−1}$ and a position measurement accuracy of the order of 1 μm will be required. A new wire scanner design based on the understanding of the wire vibration origin is therefore needed. We present the models developed to understand the main causes of the wire vibrations observed in an existing wire scanner. The development and tuning of those models are based on measurements and tests performed on that CERN proton synchrotron (PS) scanner. The final model for the (wire + fork) system has six degrees-of-freedom (DOF). The wire equations contain three different excitation terms: inertia...
Standardization of 125 Sb in equilibrium non-equilibrium situations with 125m Te
International Nuclear Information System (INIS)
Rodriguez Barquero, L.; Jimenez de Mingo, A.; Grau Carles, A.
1997-10-01
We study the stability of ''125 Sb in the following scintillators: HiSafeIII''TM, Insta- Gel reg s ign Plus and '' Ultima-Gold'' TM. Since ''125 m Te requires more than one year to reach the secular equilibrium with ''125 Sb, we cannot be sure, for a given sample, whether equilibrium is reached or not. In this report we present a new procedure that permits one calibrate mixtures of ''125 Sb+''125 m Te out of the equilibrium. The steps required for the radiochemical separation of the components are indicated. Finally, we study the evolution of counting rate when column yields are less than 100%. (Author)
47 CFR 32.2321 - Customer premises wiring.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Customer premises wiring. 32.2321 Section 32... Customer premises wiring. (a) This account shall include all amounts transferred from the former Account 232, Station Connections, inside wiring subclass. (b) Embedded Customer Premises Wiring is that...
Energy Technology Data Exchange (ETDEWEB)
Jarosz, A., E-mail: arctgh@ifmpan.poznan.pl [Institute of Molecular Physics, Polish Academy of Sciences, ul. M. Smoluchowskiego 17, 60-179 Poznań (Poland); Gaul, A. [Department of Physics and Center for Interdisciplinary Nanostructure Science and Technology (CINSaT), University of Kassel, Heinrich-Plett-Str. 40, D-34132 Kassel (Germany); Urbaniak, M. [Institute of Molecular Physics, Polish Academy of Sciences, ul. M. Smoluchowskiego 17, 60-179 Poznań (Poland); Ehresmann, A. [Department of Physics and Center for Interdisciplinary Nanostructure Science and Technology (CINSaT), University of Kassel, Heinrich-Plett-Str. 40, D-34132 Kassel (Germany); Stobiecki, F. [Institute of Molecular Physics, Polish Academy of Sciences, ul. M. Smoluchowskiego 17, 60-179 Poznań (Poland)
2017-08-01
Highlights: • Electron lithography and ion bombardment were used to modify the Co/Pt micro-wires. • Two-dimensional perpendicular magnetic anisotropy gradient was engineered. • Engineered anisotropy gradient allowed to control domain wall positions in the wires. • Simulations confirm the influence of defects on a remanent state of the wires. - Abstract: Pt(15 nm)/[Co(0.6 nm)/Pt(1.5 nm)]{sub 4} multilayers with perpendicular magnetic anisotropy were patterned into several-micrometer wide wires by electron-beam lithography. Bombarding the wires with He{sup +} ions with a fluence gradient along the wire results in a spatial gradient of switching fields that allows a controllable positioning of domain walls. The influence of the reduced anisotropy near the wire edges causes a remanent state in which the reversal close to the long edges precedes that in the middle of the wires. Experiments using Kerr microscopy prove this effect and micromagnetic simulations corroborate that a decrease of the anisotropy at the edges is responsible for the effect.
Energy Technology Data Exchange (ETDEWEB)
Madhukeshwara, N. [Department of Mechanical Engineering, B.I.E.T, Davanagere, Karnataka (India); Prakash, E.S. [Department of Studies in Mechanical Engineering, U.B.D.T.C.E, Davanagere, Karnataka (India)
2013-07-01
An experimental investigation of heat transfer augmentation and friction characteristics of fully developed turbulent flow in a rectangular duct of solar air heater with absorber plate having V-shaped wire ribs as artificial roughness on its underside is carried out. The investigation covers wide range of different parameters of wire ribbed roughness: relative roughness pitch (p/e) from 10 to 40, relative roughness height (e/Dh) from 0.01 to 0.04 and angle of attack of flow from 20° to 90°. Duct aspect ratio (W/B) is kept 5 and Reynolds number (Re) is varied from 2,500 to 8,500. The heat transfer and friction factor values obtained are compared with those of smooth duct under similar flow conditions. Expressions are developed for Nusselt number and friction factor for the roughness geometry. Enhancement of Nusselt number and friction factor for roughened duct are 1.5 and 2.7 times of smooth duct respectively.
Sensitive and simple method for measuring wire tensions
International Nuclear Information System (INIS)
Atac, M.; Mishina, M.
1982-08-01
Measuring tension of wires in drift chambers and multiwire proportional chambers after construction is an important process because sometimes wires get loose after soldering, crimping or glueing. One needs to sort out wires which have tensions below a required minimum value to prevent electrostatic instabilities. There have been several methods reported on this subject in which the wires were excited either with sinusoidal current under magnetic field or with sinusoidal voltage electrostatically coupled to the wire, searching for a resonating frequency with which the wires vibrate mechanically. Then the vibration is detected either visually, optically or with magnetic pick-up directly touching the wires. Any of these is only applicable to the usual multiwire chamber which has open access to the wire plane. They also need fairly large excitation currents to induce a detectable vibration to the wires. Here we report a very simple method that can be used for any type of wire chamber or proportional tube system for measuring wire tension. Only a very small current is required for the wire excitation to obtain a large enough signal because it detects the induced emf voltage across a wire. A sine-wave oscillator and a digital voltmeter are sufficient devices aside from a permanent magnet to provide the magnetic field around the wire. A useful application of this method to a large system is suggested
Mountain Plains Learning Experience Guide: Electrical Wiring. Course: Electrical Wiring Rough-In.
Arneson, R.; And Others
One of two individualized courses included in an electrical wiring curriculum, this course covers electrical installations that are generally hidden within the structure. The course is comprised of four units: (1) Outlet and Switch Boxes, (2) Wiring, (3) Service Entrance, and (4) Signal and Low Voltage Systems. Each unit begins with a Unit…
49 CFR 393.28 - Wiring systems.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Wiring systems. 393.28 Section 393.28 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... NECESSARY FOR SAFE OPERATION Lamps, Reflective Devices, and Electrical Wiring § 393.28 Wiring systems...
Electromagnetic Behaviour of Metallic Wire Structures
Chui, S T
2013-01-01
Despite the recent development and interest in the photonics of metallic wire structures, the relatively simple concepts and physics often remain obscured or poorly explained to those who do not specialize in the field. Electromagnetic Behaviour of Metallic Wire Structures provides a clear and coherent guide to understanding these phenomena without excessive numerical calculations. Including both background material and detailed derivations of the various different formulae applied, Electromagnetic Behaviour of Metallic Wire Structures describes how to extend basic circuit theory relating to voltages, currents, and resistances of metallic wire networks to include situations where the currents are no longer spatially uniform along the wire. This lays a foundation for a deeper understanding of the many new phenomena observed in meta-electromagnetic materials. Examples of applications are included to support this new approach making Electromagnetic Behaviour of Metallic Wire Structures a comprehensive and ...
Directory of Open Access Journals (Sweden)
D. B. Zuev
2016-01-01
Full Text Available The paper presents the main technical specifications of galvanized low carbon wire for muzzles (bottle’hood wire, consistent with the exploitation requirements to the wire in the manufacture and use of muzzles. The main criteria when selecting the steel grade and upon selection of the technological processes are given.
Preliminary experimental results of tungsten wire-array Z-pinches on primary test stand
Energy Technology Data Exchange (ETDEWEB)
Huang, Xian-Bin; Zhou, Shao-Tong; Dan, Jia-Kun; Ren, Xiao-Dong, E-mail: amosrxd@163.com; Wang, Kun-Lun; Zhang, Si-Qun; Li, Jing; Xu, Qiang; Cai, Hong-Chun; Duan, Shu-Chao; Ouyang, Kai; Chen, Guang-Hua; Ji, Ce; Wei, Bing; Feng, Shu-Ping; Wang, Meng; Xie, Wei-Ping; Deng, Jian-Jun [Key Laboratory of Pulsed Power, Institute of Fluid Physics, China Academy of Engineering Physics, P.O. Box 919-108, Mianyang, Sichuan 621999 (China); Zhou, Xiu-Wen; Yang, Yi [Research Center of Laser Fusion, China Academy of Engineering Physics, P.O. Box 919-987, Mianyang, Sichuan 621999 (China)
2015-07-15
The Primary Test Stand (PTS) developed at the China Academy of Engineering Physics is a 20 TW pulsed power driver, which can deliver a ∼10 MA, 70 ns rise-time (10%–90%) current to a short-circuit load and has important applications in Z-pinch driven inertial confinement fusion and high energy density physics. Preliminary results of tungsten wire-array Z-pinch experiments on PTS are presented. The load geometries investigated include 15-mm-tall cylindrical single and nested arrays with diameter ranging from 13 mm to 30 mm, consisting of 132–300 tungsten wires with 5–10 μm in diameter. Multiple diagnostics were fielded to characterize the x-ray radiation from wire-array Z pinches. The x-ray peak power (∼50 TW) and total radiated energy (∼500 kJ) were obtained from a single 20-mm-diam array with 80-ns stagnation time. The highest x-ray peak power up to 80 TW with 2.4 ns FWHM was achieved by using a nested array with 20-mm outer diameter, and the total x-ray energy from the nested array is comparable to that of single array. Implosion velocity estimated from the time-resolved image measurement exceeds 30 cm/μs. The detailed experimental results and other findings are presented and discussed.
International Nuclear Information System (INIS)
Fransson, S.G.
1993-01-01
Evaluation of pacemaker wires were performed by comparing Advanced Multiple Beam Equalization Radiography (AMBER) with conventional chest radiography. The scanning equalization technique of the AMBER unit makes it superior to conventional technique in the depiction of different structures in the mediastinum or in the pleural sinuses. So far motion artifacts have not been considered clinically important. The longer exposure time, however, may impair the assessment of pacemaker wires. The motion artifact described may not only make adequate evaluation impossible but may even give a false impression of a lead fracture. The difference between the two systems was significant. (orig.)
Inhomogeneous wire explosion in water
International Nuclear Information System (INIS)
Hwangbo, C.K.; Kong, H.J.; Lee, S.S.
1980-01-01
Inhomogeneous processes are observed in underwater copper wire explosion induced by a condensed capacitor discharge. The wire used is 0.1 mm in diameter and 10 mm long, and the capacitor of 2 μF is charged to 5 KV. A N 2 laser is used for the diagnostic of spatial extension of exploding copper vapour. The photographs obtained in this experiment show unambiguously the inhomogeneous explosion along the exploding wire. The quenching of plasma by the surrounding water inhibits the expansion of the vapour. It is believed the observed inhomogeneous explosion along the wire is located and localized around Goronkin's striae, which was first reported by Goronkin and discussed by Froengel as a pre-breakdown phenomenon. (author)
HTS Wire Development Workshop: Proceedings
Energy Technology Data Exchange (ETDEWEB)
1994-07-01
The 1994 High-Temperature Superconducting Wire Development Workshop was held on February 16--17 at the St. Petersburg Hilton and Towers in St. Petersburg, Florida. The meeting was hosted by Florida Power Corporation and sponsored by the US Department of Energy`s Superconductivity Program for Electric Power Systems. The meeting focused on recent high-temperature superconducting wire development activities in the Department of Energy`s Superconductivity Systems program. The meeting opened with a general discussion on the needs and benefits of superconductivity from a utility perspective, the US global competitiveness position, and an outlook on the overall prospects of wire development. The meeting then focused on four important technology areas: Wire characterization: issues and needs; technology for overcoming barriers: weak links and flux pinning; manufacturing issues for long wire lengths; and physical properties of HTS coils. Following in-depth presentations, working groups were formed in each technology area to discuss the most important current research and development issues. The working groups identified research areas that have the potential for greatly enhancing the wire development effort. These areas are discussed in the summary reports from each of the working groups. This document is a compilation of the workshop proceedings including all general session presentations and summary reports from the working groups.
Boettcher, Shannon
2010-03-01
Micron-scale Si wire arrays are three-dimensional photovoltaic absorbers that enable orthogonalization of light absorption and carrier collection and hence allow for the utilization of relatively impure Si in efficient solar cell designs. The wire arrays are grown by a vapor-liquid-solid-catalyzed process on a crystalline (111) Si wafer lithographically patterned with an array of metal catalyst particles. Following growth, such arrays can be embedded in polymethyldisiloxane (PDMS) and then peeled from the template growth substrate. The result is an unusual photovoltaic material: a flexible, bendable, wafer-thickness crystalline Si absorber. In this paper I will describe: 1. the growth of high-quality Si wires with controllable doping and the evaluation of their photovoltaic energy-conversion performance using a test electrolyte that forms a rectifying conformal semiconductor-liquid contact 2. the observation of enhanced absorption in wire arrays exceeding the conventional light trapping limits for planar Si cells of equivalent material thickness and 3. single-wire and large-area solid-state Si wire-array solar cell results obtained to date with directions for future cell designs based on optical and device physics. In collaboration with Michael Kelzenberg, Morgan Putnam, Joshua Spurgeon, Daniel Turner-Evans, Emily Warren, Nathan Lewis, and Harry Atwater, California Institute of Technology.
Pereira, Erika S J; Gomes, Renata O; Leroy, Agnès M F; Singh, Rupinderpal; Peters, Ove A; Bahia, Maria G A; Buono, Vicente T L
2013-12-01
Comparison of physical and mechanical properties of one conventional and a new NiTi wire, which had received an additional thermomechanical treatment. Specimens of both conventional (NiTi) and the new type of wire, called M-Wire (MW), were subjected to tensile and three-point bending tests, Vickers microhardness measurements, and to rotating-bending fatigue tests at a strain-controlled level of 6%. Fracture surfaces were observed by scanning electron microscopy and the non-deformed microstructures by transmission electron microscopy. The thermomechanical treatment applied to produce the M-Wire apparently increased the tensile strength and Vickers microhardness of the material, but its apparent Young modulus was smaller than that of conventionally treated NiTi. The three-point bending tests showed a higher flexibility for MW which also exhibited a significantly higher number of cycles to failure. M-Wire presented mechanical properties that can render endodontic instruments more flexible and fatigue resistant than those made with conventionally processed NiTi wires. Copyright © 2013 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Comparison of Analysis, Simulation, and Measurement of Wire-to-Wire Crosstalk. Part 2
Bradley, Arthur T.; Yavoich, Brian James; Hodson, Shane M.; Godley, Franklin
2010-01-01
In this investigation, we compare crosstalk analysis, simulation, and measurement results for electrically short configurations. Methods include hand calculations, PSPICE simulations, Microstripes transient field solver, and empirical measurement. In total, four representative physical configurations are examined, including a single wire over a ground plane, a twisted pair over a ground plane, generator plus receptor wires inside a cylindrical conduit, and a single receptor wire inside a cylindrical conduit. Part 1 addresses the first two cases, and Part 2 addresses the final two. Agreement between the analysis methods and test data is shown to be very good.
Comparison of Analysis, Simulation, and Measurement of Wire-to-Wire Crosstalk. Part 1
Bradley, Arthur T.; Yavoich, Brian James; Hodson, Shame M.; Godley, Richard Franklin
2010-01-01
In this investigation, we compare crosstalk analysis, simulation, and measurement results for electrically short configurations. Methods include hand calculations, PSPICE simulations, Microstripes transient field solver, and empirical measurement. In total, four representative physical configurations are examined, including a single wire over a ground plane, a twisted pair over a ground plane, generator plus receptor wires inside a cylindrical conduit, and a single receptor wire inside a cylindrical conduit. Part 1 addresses the first two cases, and Part 2 addresses the final two. Agreement between the analysis, simulation, and test data is shown to be very good.
International Nuclear Information System (INIS)
Huang, S.H.; Chen Zhanghai; Wang, F.Z.; Shen, S.C.; Tan, H.H.; Fu, L.; Fraser, M.; Jagadish, C.
2006-01-01
A single Al 0.5 Ga 0.5 As/GaAs V-grooved quantum wire modified by selective ion implantation and rapid thermal annealing was investigated by using spatially resolved micro-photoluminescence spectroscopy and magneto-resistance measurements. The results of spatially resolved photoluminescence indicate that the ion-implantation-induced quantum well intermixing significantly raises the electronic sub-band energies in the side quantum wells (SQWs) and vertical quantum wells, and a more efficient accumulation of electrons in the quantum wires is achieved. Processes of real space carrier transfer from the SQW to the quantum wire was experimentally observed, and showed the blocking effect of carrier transfer due to the existence of the necking quantum well region. Furthermore, magneto-transport investigation on the ion-implanted quantum wire samples shows the quasi-one-dimensional intrinsic motion of electrons, which is important for the design and the optimization of one-dimensional electronic devices
Getting "Wired" for McLuhan's Cyberculture.
McMurdo, George
1995-01-01
Examines the introduction of the computing magazine, "Wired", into the United Kingdom's (UK) market. Presents conversations with the founder and editorial staff of the UK edition, and discusses the accessibility of "Wired" via the World Wide Web. Describes 10 articles from United States "Wired" back-issues and…
Ignition and spread of electrical wire fires
Huang, Xinyan
2012-01-01
Ignition of electrical wires by external heating is investigated in order to gain a better understanding of the initiation of electrical-wire fires. An ignition-to- spread model is developed to systematically explain ignition and the following transition to spread. The model predicts that for a higher-conductance wire it is more difficult to achieve ignition and the weak flame may extinguish during the transition phase because of a large conductive heat loss along the wire core. Wires with tw...
Phosphorus in antique iron music wire.
Goodway, M
1987-05-22
Harpsichords and other wire-strung musical instruments were made with longer strings about the beginning of the 17th century. This change required stronger music wire. Although these changes coincided with the introduction of the first mass-produced steel (iron alloyed with carbon), carbon was not found in samples of antique iron harpsichord wire. The wire contained an amount of phosphorus sufficient to have impeded its conversion to steel, and may have been drawn from iron rejected for this purpose. The method used to select pig iron for wire drawing ensured the highest possible phosphorus content at a time when its presence in iron was unsuspected. Phosphorus as an alloying element has had the reputation for making steel brittle when worked cold. Nevertheless, in replicating the antique wire, it was found that lowcarbon iron that contained 0.16 percent phosphorus was easily drawn to appropriate gauges and strengths for restringing antique harpsichords.
Electro-mechanics of drift tube wires
International Nuclear Information System (INIS)
Milburn, R.H.
1997-01-01
The position and stability of the sense wires in very long drift tubes are affected by both gravitational and electrostatic forces, as well as by the wire tension. For a tube to be used as an element of a high-resolution detector all these forces and their effects must be understood in appropriately precise detail. In addition, the quality control procedures applied during manufacture and detector installation must be adequate to ensure that the internal wire positions remain within tolerances. It may be instructive to practitioners to review the simple theory of a taut wire in the presence of anisotropic gravitational and electrostatic fields to illustrate the conditions for stability, the equilibrium wire displacement from straightness, and the effect of the fields on the mechanical vibration frequencies. These last may be used to monitor the wire configuration externally. A number of practical formulae result and these are applied to illustrative examples. (orig.)
Research on FR-HDPE/EPDM for cable and wire insulation by γ rays
International Nuclear Information System (INIS)
Jia Shaojin; Zhang Zhicheng; Ge Xuewu; Du Zhiwen; Wang Zhenzhou
2002-01-01
By blending low-halogen flame-retarding agent with the basic resin and using γ irradiation FR-HDPE/EPDM for cable and wire insulation with 125 degree C heat resistance was prepared. The mechanical and electrical measurement showed that radiation crosslinking improves some essential properties of the material, such as the heat resistance, tensile strength et al. The dynamic flammability of the material was researched by cone calorimeter, it was found that radiation crosslinking decreases both release heat rate and effective heat of combustion while burning, besides, crosslinking increases oxygen index and the residues of combustion though the time to ignition of the irradiated material is somewhat decreased. The work was compared with the traditional method TG measurement
14 CFR Appendix D to Part 125 - Airplane Flight Recorder Specification
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane Flight Recorder Specification D... AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD... Appendix D to Part 125—Airplane Flight Recorder Specification Parameters Range Accuracy sensor input to...
Lansce Wire Scanning Diagnostics Device Mechanical Design
International Nuclear Information System (INIS)
Rodriguez Esparza, Sergio; Batygin, Yuri K.; Gilpatrick, John D.; Gruchalla, Michael E.; Maestas, Alfred J.; Pillai, Chandra; Raybun, Joseph L.; Sattler, F.D.; Sedillo, James Daniel; Smith, Brian G.
2011-01-01
The Accelerator Operations and Technology Division at Los Alamos National Laboratory operates a linear particle accelerator which utilizes 110 wire scanning diagnostics devices to gain position and intensity information of the proton beam. In the upcoming LANSCE improvements, 51 of these wire scanners are to be replaced with a new design, up-to-date technology and off-the-shelf components. This document outlines the requirements for the mechanical design of the LANSCE wire scanner and presents the recently developed linac wire scanner prototype. Additionally, this document presents the design modifications that have been implemented into the fabrication and assembly of this first linac wire scanner prototype. Also, this document will present the design for the second, third, and fourth wire scanner prototypes being developed. Prototypes 2 and 3 belong to a different section of the particle accelerator and therefore have slightly different design specifications. Prototype 4 is a modification of a previously used wire scanner in our facility. Lastly, the paper concludes with a plan for future work on the wire scanner development.
Lansce Wire Scanning Diagnostics Device Mechanical Design
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Esparza, Sergio [Los Alamos National Laboratory; Batygin, Yuri K. [Los Alamos National Laboratory; Gilpatrick, John D. [Los Alamos National Laboratory; Gruchalla, Michael E. [Los Alamos National Laboratory; Maestas, Alfred J. [Los Alamos National Laboratory; Pillai, Chandra [Los Alamos National Laboratory; Raybun, Joseph L. [Los Alamos National Laboratory; Sattler, F. D. [Los Alamos National Laboratory; Sedillo, James Daniel [Los Alamos National Laboratory; Smith, Brian G. [Los Alamos National Laboratory
2011-01-01
The Accelerator Operations & Technology Division at Los Alamos National Laboratory operates a linear particle accelerator which utilizes 110 wire scanning diagnostics devices to gain position and intensity information of the proton beam. In the upcoming LANSCE improvements, 51 of these wire scanners are to be replaced with a new design, up-to-date technology and off-the-shelf components. This document outlines the requirements for the mechanical design of the LANSCE wire scanner and presents the recently developed linac wire scanner prototype. Additionally, this document presents the design modifications that have been implemented into the fabrication and assembly of this first linac wire scanner prototype. Also, this document will present the design for the second, third, and fourth wire scanner prototypes being developed. Prototypes 2 and 3 belong to a different section of the particle accelerator and therefore have slightly different design specifications. Prototype 4 is a modification of a previously used wire scanner in our facility. Lastly, the paper concludes with a plan for future work on the wire scanner development.
Directory of Open Access Journals (Sweden)
Meysam Mirzaie
2013-09-01
Full Text Available Introduction: When using sliding mechanics for space closure during orthodontic treatment, friction occurs at the bracket-wire interface. The aim of this study was to evaluate the frictional resistance between monocrystalline (ICE brackets and Stainless Steel, Beta TMA and NiTi wires. Methods: In this experimental study, we used 5 different types of orthodontic wires. Brackets and wires were divided in to 5 groups: 1-(monocrystalline+stainless steel 18 2–(monocrystalline+stainless steel 19×25 3-(monocrystalline+Beta-TMA 4–(monocrystalline+Beta TMA 19×25 5-(monocrystalline+NiTi 18. Instron Universal Testing Machine was used to investigate the static frictional resistance. The angulation between bracket and wire was 0 and the wires were pulled through the slots at a speed of 10 mm/min. Tests were performed 10 times for each group in artificial saliva. The average of 10 forces recorded was considered as static friction. One-way ANOVA and SPSS Version 18 and LSD post hoc test were used to evaluate the results of the study. Results: The mean static frictional force for each group was: group1: 0.82 ± 0.14, group 2: 1.09 ± 0.30, group 3: 0.87 ± 0.53, group 4: 1.9 ± 1.16, group 5: 1.42 ± 0.30. There was a significant difference when comparing the two groups of similar wires in terms of shape (round or rectangular cross-section as when comparing Beta TMA 18 and 19×25 arch wires with each other, the obtained p-value was 0.023, while the obtained p-value for the comparison of stainles steel arch wires was 0.034 . Conclusions: The result of this study shows that Stainless Steel 18 wires generate the least amount of friction and round wires produce less friction than the rectangular wires. Beta TMA wires generate the highest amount of friction.
Commercial and Industrial Wiring.
Kaltwasser, Stan; Flowers, Gary
This module is the third in a series of three wiring publications, includes additional technical knowledge and applications required for job entry in the commercial and industrial wiring trade. The module contains 15 instructional units that cover the following topics: blueprint reading and load calculations; tools and equipment; service;…
Cu-Al-Ni Shape Memory Single Crystal Wires with High Transformation Temperature
Hautcoeur, Alain; Fouché, Florian; Sicre, Jacques
2016-01-01
CN-250X is a new material with higher performance than Nickel-Titanium Shape Memory Alloy (SMA). For space mechanisms, the main disadvantage of Nickel-Titanium Shape Memory Alloy is the limited transformation temperature. The new CN-250X Nimesis alloy is a Cu-Al-Ni single crystal wire available in large quantity because of a new industrial process. The triggering of actuators made with this Cu-Al-Ni single crystal wire can range from ambient temperature to 200 C in cycling and even to 250 C in one-shot mode. Another advantage of CN-250X is a better shape recovery (8 to 10%) than Ni-Ti (6 to 7%). Nimesis is the first company able to produce this type of material with its new special industrial process. A characterization study is presented in this work, including the two main solicitation modes for this material: tensile and torsion. Different tests measure the shape recovery of Cu-Al-Ni single crystals wires during heating from room temperature to a temperature higher than temperature of end of martensitic transformation.
A Wire Position Monitor System for the ISAC-II Cryomodule Components Alignment
Rawnsley, B; Dutto, G; Fong, K; Laxdal, R E; Ries, T
2004-01-01
TRIUMF is developing ISAC-II, a superconducting (SC) linac. It will comprise 9 cryomodules with a total of 48 niobium cavities and 12 SC solenoids. They must remain aligned at liquid He temperatures: cavities to ±400 μm and solenoids to ±200 μm after a vertical contraction of ~4 mm. A wire position monitor (WPM) system based on a TESLA design has been developed, built, and tested with a prototype cryomodule. The system is based on the measurement of signals induced in pickups by a 215 MHz signal carried by a wire through the WPMs. The wire is stretched between the warm tank walls parallel to the beam axis providing a position reference. The sensors, one per cavity and two per solenoid, are attached to the cold elements to monitor their motion during pre-alignment, pumping and cool down. A WPM consists of four 50 Ω striplines spaced 90° apart. A GaAs multiplexer scans the WPMs and a Bergoz card converts the RF signals to DC X and Y voltages. National Ins...
Development of procedure using plasma welding process to produce 125I seeds
International Nuclear Information System (INIS)
Feher, Anselmo
2006-01-01
The prostate cancer, which is the second cause of death by cancer in men, overcome only by lung cancer, is a problem of public health in Brazil. Brachytherapy is among the possible available treatments for prostate cancer, in which small seeds containing 125 I radioisotope are implanted in the prostate. The seed consists of a titanium sealed capsule with 0.8 mm external diameter and 4.5 mm length, containing a central silver wire with adsorbed 125 I. The plasma arc welding is one of the viable techniques for the sealing process. The equipment used in this technique is less costly than in other processes. The main objective of this work was the development and the validation of the welding procedure using plasma welding process and the elaboration of a sealing routine according to Good Manufacturing Practices. The development of this work has presented the following phases: cut and cleaning of the titanium material, determination of the welding parameters, development of a device for holding the titanium tube during the welding process, validation of sealed sources according to ISO 2919 Sealed Radioactive Sources - General Requirements and Classification, leakage test according to ISO 9978 Sealed Radioactive Sources - Leakage Test Methods and metallographic assays. The developed procedure, to seal 125 I seeds using plasma welding process, has shown to be efficient, satisfying all the established requirements of ISO 2919. The results obtained in this work have given the possibility to establish a routine production process according to the orientations presented in resolution RDC number 59 - Good Manufacturing Practices do Medical Products of the ANVISA - Brazilian Nacional Agency of Sanitary Surveillance. (author)
Wire alignment system for ATF LINAC
International Nuclear Information System (INIS)
Hayano, H.; Takeda, S.; Matsumoto, H.; Matsui, T.
1994-01-01
A wire based alignment system is adopted to make less than 40μm precision alignment for injector linac of Accelerator Test Facility (ATF). The system consists of two stretched SUS wires, pickup coils and active mover stages. The position of pickup coils in a mount which will be installed into LINAC stages is set to the calculated wire position prior to installation. All of LINAC stages are then moved to keep the calculated position by the active mover. The test results of wire position detection in a long term are described. (author)
Nickel contaminated titanium weld wire study
International Nuclear Information System (INIS)
Coffin, G.R.; Sumstine, R.L.
1979-01-01
Attachment of thermocouples to fuel rod welding problems at Exxon Nuclear Company and INEL prompted an investigation study of the titanium filler wire material. It was found that the titanium filler wire was contaminated with nickel which was jacketed on the wire prior to the drawing process at the manufacturers. A method was developed to 100% inspect all filler wire for future welding application. This method not only indicates the presence of nickel contamination but indicates quantity of contamination. The process is capable of high speed inspection necessary for various high speed manufacturing processes
Californium Recovery from Palladium Wire
Energy Technology Data Exchange (ETDEWEB)
Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-08-01
The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.
Energy Technology Data Exchange (ETDEWEB)
Saxena, S.K. [Therapeutic and Reference Sources Section, Radiopharmaceuticals Division, RLG, BARC, Mumbai-400 085 (India)]. E-mail: snr1991@yahoo.co.in; Shanta, A. [Radiological Physics and Advisory Division, Bhabha Atomic Research Centre, Trombay, Mumbai-400 085 (India); Rajurkar, Nilima S. [Department of Chemistry, University of Pune (India); Majali, M.A. [Therapeutic and Reference Sources Section, Radiopharmaceuticals Division, RLG, BARC, Mumbai-400 085 (India)
2006-04-15
{sup 125}I sources were prepared by adsorption of {sup 125}I on palladium-coated silver wires. The effect of reducing agent on percentage adsorption of {sup 125}I was studied and the amount of adsorbed activity on source core was studied by repeated adsorption cycles. The activity per source in the sources produced from the same batch varied with coefficient of variation (i.e. the ratio of standard deviation to mean multiplied by 100) less than 10%. The unencapsulated source exhibited low leachability (< 0.01%). The laser parameters were optimized to obtain quality welds with negligible leak rate. The sources were laser-encapsulated in titanium capsules of 0.8 mm (OD)x4.5 mm (l). The release of radioactivity from encapsulated sources in an immersion test at 50 {sup o}C for 5 h was <5 nCi (185 Bq). The surface contamination on the sealed capsules was found to be<0.05 nCi or 1.85 Bq per source. The sources were used in the treatment of a child having retinoblastoma.
14 CFR 125.175 - Protection of other airplane components against fire.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Protection of other airplane components... CERTIFICATION AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD... Requirements § 125.175 Protection of other airplane components against fire. (a) Except as provided in...
14 CFR Appendix E to Part 125 - Airplane Flight Recorder Specifications
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane Flight Recorder Specifications E... AND OPERATIONS: AIRPLANES HAVING A SEATING CAPACITY OF 20 OR MORE PASSENGERS OR A MAXIMUM PAYLOAD... Appendix E to Part 125—Airplane Flight Recorder Specifications The recorded values must meet the designated...
2-D Fractal Wire Antenna Design and Performance
Tebbens, S. F.; Barton, C. C.; Peterman, D. J.; Ewing, J. J.; Abbott, C. S.; Rizki, M. M.
2017-12-01
A 2-D fractal wire antenna uses a fractal (self-similar) pattern to increase its length by iteration and can receive or transmit electromagnetic radiation. 2-D fractals are shapes that, at their mathematical limit (of infinite iterations) have an infinite length. The fractal dimension describes the degree of space filling. A fundamental property of fractal antennas lies in iteration (repetition) of a fractal pattern over a range of length scales. Iteration produces fractal antennas that can be very compact, wideband and multiband. As the number of iterations increases, the antenna tends to have additional frequencies that minimize far field return loss. This differs from traditional antenna designs in that a single fractal antenna can operate well at multiple frequencies. We have created a MATLAB code to generate deterministic and stochastic modes of fractal wire antennas with a range of fractal dimensions between 1 and 2. Variation in fractal dimension, stochasticity, and number of iterations have been computationally tested using COMSOL Multiphysics software to determine their effect on antenna performance.
Energy Technology Data Exchange (ETDEWEB)
Mazarakis, Michael G.; Stygar, William A.; Sinars, Daniel B.; Cuneo, Michael E.; Nash, Thomas J.; Chandler, Gordon A.; Keith Matzen, M.; Porter, John L.; Struve, Kenneth W.; McDaniel, Dillon H. [Sandia National Laboratories, P.O. Box 5800, Albuquerque, New Mexico 87185 (United States); Deeney, Christopher E. [National Nuclear Security Administration, Washington, D.C. 20585 (United States); Douglas, Melissa R. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Chittenden, Jerry [Imperial College, London, SW and 2BW (United Kingdom)
2011-11-15
We report results of the experimental campaign, which studied the initiation, implosion dynamics, and radiation yield of tungsten wire arrays as a function of the wire number. The wire array dimensions and mass were those of interest for the Z-pinch driven Inertial Confinement Fusion (ICF) program. An optimization study of the x-ray emitted peak power, rise time, and full width at half maximum was effectuated by varying the wire number while keeping the total array mass constant and equal to {approx}5.8 mg. The driver utilized was the {approx}20-MA Z accelerator before refurbishment in its usual short pulse mode of 100 ns. We studied single arrays of 20-mm diameter and 1-cm height. The smaller wire number studied was 30 and the largest 600. It appears that 600 is the highest achievable wire number with present day's technology. Radial and axial diagnostics were utilized including crystal monochromatic x-ray backlighter. An optimum wire number of {approx}375 was observed which was very close to the routinely utilized 300 for the ICF program in Sandia.
International Nuclear Information System (INIS)
Mazarakis, Michael G.; Stygar, William A.; Sinars, Daniel B.; Cuneo, Michael E.; Nash, Thomas J.; Chandler, Gordon A.; Keith Matzen, M.; Porter, John L.; Struve, Kenneth W.; McDaniel, Dillon H.; Deeney, Christopher E.; Douglas, Melissa R.; Chittenden, Jerry
2011-01-01
We report results of the experimental campaign, which studied the initiation, implosion dynamics, and radiation yield of tungsten wire arrays as a function of the wire number. The wire array dimensions and mass were those of interest for the Z-pinch driven Inertial Confinement Fusion (ICF) program. An optimization study of the x-ray emitted peak power, rise time, and full width at half maximum was effectuated by varying the wire number while keeping the total array mass constant and equal to ∼5.8 mg. The driver utilized was the ∼20-MA Z accelerator before refurbishment in its usual short pulse mode of 100 ns. We studied single arrays of 20-mm diameter and 1-cm height. The smaller wire number studied was 30 and the largest 600. It appears that 600 is the highest achievable wire number with present day's technology. Radial and axial diagnostics were utilized including crystal monochromatic x-ray backlighter. An optimum wire number of ∼375 was observed which was very close to the routinely utilized 300 for the ICF program in Sandia.
Metabolism in the isolated rat heart: comparison of 125I-BMIPP with 125I-IPPA
International Nuclear Information System (INIS)
Chen Shaoliang; Cheng Aiping; Xu Lanwen; Qiao Weiwei
2008-01-01
Objective: The fatty acid metabolism in myocardium is recently one of the most interesting subjects in nuclear cardiology. The purpose of this study was to clarify the metabolic fate of 125 I-labeled 15-(p-iodophenyl)-3-(R, S)-methyl-pentadecanoic acid ( 125 I-BMIPP) and 15-(p-[ 125 I] iodophenyl) pentadecanoic acid ( 125 I-IPPA) by means of isolated rat hearts. Methods: Ten isolated rat hearts were prepared and perfused with 125 I-BMIPP (5 rats) or 125 I-IPPA (5 rats) for 3 h following a basic perfusion of 30 min. After perfusion, the radioactivity in the recirculated buffer was measured. The metabolites in the buffer were then extracted and analyzed using high performance liquid chromatography (HPLC) and thin-layer chromatography (TLC). Results: At the beginning (5 rain) of 125 I-BMIPP perfusion, the main radioactive peak appeared on HPLC at 37 min, which remained after 3 h perfusion. Several small peaks eluting were found before the parent peak at 30, 26, 21, 16, 12 and 9 min, respectively. At the beginning (5 min) of 125 I-IPPA perfusion, the main peak appeared on HPLC at 33 min, which disappeared after 3 h. Conclusions: 125 I-BMIPP strongly inhibited beta-oxidation, therefore appeared suitable for myocardial metabolic imaging. 125 I-IPPA was metabolized rapidly. (authors)
Energy Technology Data Exchange (ETDEWEB)
Feher, Anselmo
2006-07-01
The prostate cancer, which is the second cause of death by cancer in men, overcome only by lung cancer, is a problem of public health in Brazil. Brachytherapy is among the possible available treatments for prostate cancer, in which small seeds containing {sup 125}I radioisotope are implanted in the prostate. The seed consists of a titanium sealed capsule with 0.8 mm external diameter and 4.5 mm length, containing a central silver wire with adsorbed {sup 125}I. The plasma arc welding is one of the viable techniques for the sealing process. The equipment used in this technique is less costly than in other processes. The main objective of this work was the development and the validation of the welding procedure using plasma welding process and the elaboration of a sealing routine according to Good Manufacturing Practices. The development of this work has presented the following phases: cut and cleaning of the titanium material, determination of the welding parameters, development of a device for holding the titanium tube during the welding process, validation of sealed sources according to ISO 2919 Sealed Radioactive Sources - General Requirements and Classification, leakage test according to ISO 9978 Sealed Radioactive Sources - Leakage Test Methods and metallographic assays. The developed procedure, to seal {sup 125}I seeds using plasma welding process, has shown to be efficient, satisfying all the established requirements of ISO 2919. The results obtained in this work have given the possibility to establish a routine production process according to the orientations presented in resolution RDC number 59 - Good Manufacturing Practices do Medical Products of the ANVISA - Brazilian Nacional Agency of Sanitary Surveillance. (author)
Energy Technology Data Exchange (ETDEWEB)
Marques, Andre Luis Ferreira
1995-12-31
This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 10{sup 9} neutrons/cm{sup 2}.s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core 73 refs., 60 figs., 31 tabs.
Energy Technology Data Exchange (ETDEWEB)
Marques, Andre Luis Ferreira
1996-12-31
This dissertation has aimed at developing a neutron flux measurement technique by means of detectors activation analysis. The main task of this work was the implementation of this thermal neutron flux measurement technique, using gold wires as activation detectors in the IPEN/MB-01 reactor core. The neutron thermal flux spatial distribution was obtained by gold wire activation technique, with wire diameters of 0.125 mm and 0.250 mm in seven selected reactor experimental channels. The values of thermal flux were about 10{sup 9} neutrons/cm{sup 2}.s. This experiment has been the first one conducted with gold wires in the IPEN/MB-01 reactor, being this technique implemented for use by experiments in flux mapping of the core 73 refs., 60 figs., 31 tabs.
Subarachnoid and basal cistern navigation through the sacral hiatus with guide wire assistance.
Layer, Lauren; Riascos, Roy; Firouzbakht, Farhood; Amole, Adewumi; Von Ritschl, Rudiger; Dipatre, Pier; Cuellar, Hugo
2011-07-01
Intraspinal navigation with catheters and fiberscopes has shown feasible results for diagnosis and treatment of intraspinal and intracranial lesions. The most common approach, lumbar puncture, has allowed access to the spinal cord, however, coming with the difficulties of fiberscope damage and decreased torque for guidance. Our objective in this study is to allow an alternate access, the sacral hiatus, with guide wire assistance into the subarachnoid and intracranial structures, while easing the angle of entry and increasing torque. We advanced catheters with guide wire and fluoroscopy assistance into the sacral hiatus of three cadavers. After entry, the thecal sac was punctured and the catheter with guide wire was advanced rostrally until positioned in the basal cisterns of the brain. We confirmed catheter placement with contrast injection, autopsy, and dissection. In our study, the sacral hiatus was easily accessed, but resistance was found when attempting to puncture the thecal sac. The advancement of the catheter with guide wire assistance glided easily rostrally until some mild resistance was discovered at entry into the foramen magnum. With redirection, all catheters passed with ease into the basal cisterns. Positioning was confirmed with contrast injection with fluoroscopy evidence, autopsy, and dissection. There was no macroscopic or microscopic evidence of damage to the spinal roots, spinal cord, or cranial nerves. The sacral hiatus with guide wire assistance is an accessible conduit for uncomplicated entry into the subarachnoid and basal cistern space without damaging surrounding structures.
High-performance, stretchable, wire-shaped supercapacitors.
Chen, Tao; Hao, Rui; Peng, Huisheng; Dai, Liming
2015-01-07
A general approach toward extremely stretchable and highly conductive electrodes was developed. The method involves wrapping a continuous carbon nanotube (CNT) thin film around pre-stretched elastic wires, from which high-performance, stretchable wire-shaped supercapacitors were fabricated. The supercapacitors were made by twisting two such CNT-wrapped elastic wires, pre-coated with poly(vinyl alcohol)/H3PO4 hydrogel, as the electrolyte and separator. The resultant wire-shaped supercapacitors exhibited an extremely high elasticity of up to 350% strain with a high device capacitance up to 30.7 F g(-1), which is two times that of the state-of-the-art stretchable supercapacitor under only 100% strain. The wire-shaped structure facilitated the integration of multiple supercapacitors into a single wire device to meet specific energy and power needs for various potential applications. These supercapacitors can be repeatedly stretched from 0 to 200% strain for hundreds of cycles with no change in performance, thus outperforming all the reported state-of-the-art stretchable electronics. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Lei, Jih-Fen; Kiser, J. Douglas; Singh, Mrityunjay; Cuy, Mike; Blaha, Charles A.; Androjna, Drago
2000-01-01
An advanced thin film sensor system instrumented on silicon carbide (SiC) fiber reinforced SiC matrix ceramic matrix composites (SiC/SiC CMCs), was evaluated in a Mach 0.3 burner rig in order to determine its durability to monitor material/component surface temperature in harsh environments. The sensor system included thermocouples in a thin film form (5 microns thick), fine lead wires (75 microns diameter), and the bonds between these wires and the thin films. Other critical components of the overall system were the heavy, swaged lead wire cable (500 microns diameter) that contained the fine lead wires and was connected to the temperature readout, and ceramic attachments which were bonded onto the CMCs for the purpose of securing the lead wire cables, The newly developed ceramic attachment features a combination of hoops made of monolithic SiC or SiC/SiC CMC (which are joined to the test article) and high temperature ceramic cement. Two instrumented CMC panels were tested in a burner rig for a total of 40 cycles to 1150 C (2100 F). A cycle consisted of rapid heating to 1150 C (2100 F), a 5 minute hold at 1150 C (2100 F), and then cooling down to room temperature in 2 minutes. The thin film sensor systems provided repeatable temperature measurements for a maximum of 25 thermal cycles. Two of the monolithic SiC hoops debonded during the sensor fabrication process and two of the SiC/SiC CMC hoops failed during testing. The hoops filled with ceramic cement, however, showed no sign of detachment after 40 thermal cycle test. The primary failure mechanism of this sensor system was the loss of the fine lead wire-to-thin film connection, which either due to detachment of the fine lead wires from the thin film thermocouples or breakage of the fine wire.
Haghighi, Kayvon; Manolakakis, Manolis G; Balog, Connor
2017-06-01
The aim of this study was to determine the feasibility of direct transcortical stabilization of fracture dislocations of the mandibular condyle (FDMCs) using narrow-diameter non-threaded Kirschner wire (K-wire). This retrospective review reports on the treatment outcomes for 12 patients (15 fractures) with FDMCs treated with open reduction using transcortical 0.027-inch K-wire stabilization. Postoperative parameters of relevance included infection, facial nerve function, hardware removal, mandibular range of motion, and radiographic determination of fracture union. Three patients had bilateral FDMCs and 9 had unilateral FDMCs (age range at time of injury, 14 to 72 yr; mean age, 32 yr). Postoperative follow-up ranged from 6 weeks to 2 years. Four patients required removal of K-wire hardware for different reasons. K-wires were removed because of infection in 1 patient. Another patient required removal because of migration of the pin into the joint space. One pin was removed electively and another was removed for nonspecific postoperative symptoms that resolved after pin removal. Persistent facial nerve deficit was observed in 1 patient. Open reduction with transcortical K-wire stabilization can achieve satisfactory outcomes for the treatment of FDMC. Further investigation is needed in determining the efficacy of this fixation technique in the management of FDMC. Copyright © 2017 American Association of Oral and Maxillofacial Surgeons. Published by Elsevier Inc. All rights reserved.
[Mechanics analysis of fracture of orthodontic wires].
Wang, Yeping; Sun, Xiaoye; Zhang, Longqi
2003-03-01
Fracture problem of orthodontic wires was discussed in this paper. The calculation formulae of bending stress and tensile stress were obtained. All main factors that affect bending stress and tensile stress of orthodontic wires were analyzed and discussed. It was concluded that the main causes of fracture of orthodontic wires were fatigue and static disruption. Some improving proposals for preventing fracture of orthodontic wires were put forward.
Lunar Module Wiring Design Considerations and Failure Modes
Interbartolo, Michael
2009-01-01
This slide presentation reviews the considerations for the design of wiring for the Lunar Module. Included are a review of the choice of conductors and insulations, the wire splicing (i.e., crimping, and soldering), the wire connectors, and the fabrication of the wire harnesses. The problems in fabrication include the wires being the wrong length, the damage due to the sharp edges, the requried use of temproary protective covers and inadequate training. The problems in the wire harness installation include damge from sharp eges, work on adjacent harnesses, connector damage, and breaking wires. Engineering suggestions from the Apollo-era in reference to the conductors that are reviewed include: the use of plated conductors, and the use of alloys for stronger wiring. In refernce to insulation, the suggestions from Apollo era include the use of polymer tape-wrap wire insulation due to the light weight, however, other types of modern insulation might be more cost-effective. In reference to wire splices and terminal boards the suggestions from the Apollo Era include the use of crimp splices as superior to solder splices, joining multiple wire to a common point using modular plug-ins might be more reliable, but are heavier than crimp splicing. For connectors, the lessons from the Apollo era indicate that a rear environmental seal that does not require additional potting is preferred, and pins should be crimped or welded to the incoming wires and be removable from the rear of the connector.
Superconducting wire for the T-15 toroidal magnet
International Nuclear Information System (INIS)
Klimenko, E.Yu.; Kruglov, V.S.; Martovetskij, N.N.
1987-01-01
Main characteristics of a wire designed for the T-15 toroidal superconducting magnet production are given. The wire with circulation cooling is a twist of 11 niobium-tin wires 1.5 mm in diameter, joined electrolytically by two copper tubes with 3 mm inside diameter. The wire is capable to carry 10 kA current in the 8.5 T induction field. Wire features and structures promote to receive high structural current density in winding: diffuseness of superconducting-to-normal transition increases wire stability, screw symmetry od a current-carrying core provides wire resistance to pulse longitudinal field effect at plasma current disruption, low bronze thermal conductivity in a twist increases stability to outside pulse perturbations
Carbon wire chamber at sub-atmospheric pressure
Energy Technology Data Exchange (ETDEWEB)
Charles, G., E-mail: charlesg@ipno.in2p3.fr; Audouin, L., E-mail: audouin@ipno.in2p3.fr; Bettane, J.; Dupre, R.; Genolini, B.; Hammoudi, N.; Imre, M.; Le Ven, V.; Maroni, A.; Mathon, B.; Nguyen Trung, T.; Rauly, E.
2017-05-21
Present in many experiments, wire and drift chambers have been used in a large variety of shapes and configurations during the last decades. Nevertheless, their readout elements has not evolved much: tungsten, sometimes gold-plated or aluminum, wires. By taking advantage of the developments in the manufacture of conducting carbon fiber, we could obtain interesting improvements for wire detectors. In this article, we present recent tests and simulations using carbon fibers to readout signal in place of traditional tungsten wires. Unlike metallic wires, their low weight guaranties a reduced quantity of material in the active area.
Polarization-dependent thin-film wire-grid reflectarray for terahertz waves
Energy Technology Data Exchange (ETDEWEB)
Niu, Tiaoming [School of Electrical and Electronic Engineering, The University of Adelaide, Adelaide, South Australia 5005 (Australia); School of Information Science and Engineering, Lanzhou University, Lanzhou 730000 (China); Upadhyay, Aditi; Bhaskaran, Madhu; Sriram, Sharath [Functional Materials and Microsystems Research Group, RMIT University, Melbourne, Victoria 3001 (Australia); Withayachumnankul, Withawat [School of Electrical and Electronic Engineering, The University of Adelaide, Adelaide, South Australia 5005 (Australia); Interdisciplinary Graduate School of Science and Engineering, Tokyo Institute of Technology, 2-12-1-S9-3, Ookayama, Meguro-ku, Tokyo 152-8552 (Japan); Headland, Daniel; Abbott, Derek; Fumeaux, Christophe, E-mail: cfumeaux@eleceng.adelaide.edu.au [School of Electrical and Electronic Engineering, The University of Adelaide, Adelaide, South Australia 5005 (Australia)
2015-07-20
A thin-film polarization-dependent reflectarray based on patterned metallic wire grids is realized at 1 THz. Unlike conventional reflectarrays with resonant elements and a solid metal ground, parallel narrow metal strips with uniform spacing are employed in this design to construct both the radiation elements and the ground plane. For each radiation element, a certain number of thin strips with an identical length are grouped to effectively form a patch resonator with equivalent performance. The ground plane is made of continuous metallic strips, similar to conventional wire-grid polarizers. The structure can deflect incident waves with the polarization parallel to the strips into a designed direction and transmit the orthogonal polarization component. Measured radiation patterns show reasonable deflection efficiency and high polarization discrimination. Utilizing this flexible device approach, similar reflectarray designs can be realized for conformal mounting onto surfaces of cylindrical or spherical devices for terahertz imaging and communications.
2012-09-17
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines. The existing AD currently... TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but not limited to...
Sundaram, Rajyashree; Yamada, Takeo; Hata, Kenji; Sekiguchi, Atsuko
2018-04-01
We present the influence of density, structural regularity, and purity of carbon nanotube wires (CNTWs) used as Cu electrodeposition templates on fabricating homogeneous high-electrical performance CNT-Cu wires lighter than Cu. We show that low-density CNTWs (wires) with regular macro- and microstructures and high CNT content (>90 wt %) are essential for making homogeneous CNT-Cu wires. These homogeneous CNT-Cu wires show a continuous Cu matrix with evenly mixed nanotubes of high volume fractions (˜45 vol %) throughout the wire-length. Consequently, the composite wires show densities ˜5.1 g/cm3 (33% lower than Cu) and electrical conductivities ˜6.1 × 104 S/cm (>100 × CNTW conductivity). However, composite wires from templates with higher densities or structural inconsistencies are non-uniform with discontinuous Cu matrices and poor CNT/Cu mixing. These non-uniform CNT-Cu wires show conductivities 2-6 times lower than the homogeneous composite wires.
Unified Communications for Space Inventory Management
Gifford, Kevin K.; Fink, Patrick W.; Barton, Richard; Ngo, Phong H.
2009-01-01
To help assure mission success for long-duration exploration activities, NASA is actively pursuing wireless technologies that promote situational awareness and autonomy. Wireless technologies are typically extensible, offer freedom from wire tethers, readily support redundancy, offer potential for decreased wire weight, and can represent dissimilar implementation for increased reliability. In addition, wireless technologies can enable additional situational awareness that otherwise would be infeasible. For example, addition of wired sensors, the need for which might not have been apparent at the outset of a program, night be extremely costly due in part to the necessary routing of cables through the vehicle. RFID, or radio frequency identification, is a wireless technology with the potential for significant savings and increased reliability and safety in space operations. Perhaps the most obvious savings relate to the application of inventory management. A fully automated inventory management system is highly desirable for long-term sustaining operations in space environments. This assertion is evidenced by inventory activities on the International Space Station, which represents the most extensive inventory tracking experience base in the history of space operations. In the short tern, handheld RFID readers offer substantial savings owing to reduced crew time for inventory audits. Over the long term, a combination of improved RFID technology and operational concepts modified to fully utilize the technology should result in space based inventory management that is highly reliable and requires very little crew time. In addition to inventory management, RFID is likely to find space applications in real-time location and tracking systems. These could vary from coarse-resolution RFID portals to the high resolution afforded by ultra-wideband (UWB) RFID. Longer range RFID technologies that leverage passive surface acoustic wave (SAW) devices are being investigated to
Precision multiloop (PM Design with space closing circles for lingual orthodontics
Directory of Open Access Journals (Sweden)
Mugdha P Mankar
2016-01-01
Full Text Available The proficiency of ancient orthodontics has been benefitted colossally and is being continually promoted over the present, by use of multiple loop wires designed for correction of dentoalveolar malocclusions. The presented discussion provides an insight into a simple, frictionless biomechanical concept of anterior space closure in lingual orthodontics by means of precision multiloop design with incorporated space closing circles. A multiple loop wire design has been demonstrated where the entire interbracket distance is used as loop area.
Pre-wired systems prove their worth.
2012-03-01
The 'new generation' of modular wiring systems from Apex Wiring Solutions have been specified for two of the world's foremost teaching hospitals - the Royal London and St Bartholomew's Hospital, as part of a pounds sterling 1 billion redevelopment project, to cut electrical installation times, reduce on-site waste, and provide a pre-wired, factory-tested, power and lighting system. HEJ reports.
Directory of Open Access Journals (Sweden)
Meysam Mirzaie
2013-09-01
Full Text Available Introduction: When using sliding mechanics for space closure during orthodontic treatment, friction occurs at the bracket-wire interface. The aim of this study was to evaluate the frictional resistance between monocrystalline (ICE brackets and Stainless Steel, Beta TMA and NiTi wires. Methods: In this experimental study, we used 5 different types of orthodontic wires. Brackets and wires were divided in to 5 groups: 1-(monocrystalline+stainless steel 18 2–(monocrystalline+stainless steel 19×25 3-(monocrystalline+Beta-TMA 4–(monocrystalline+Beta TMA 19×25 5-(monocrystalline+NiTi 18. Instron Universal Testing Machine was used to investigate the static frictional resistance. The angulation between bracket and wire was 0 and the wires were pulled through the slots at a speed of 10 mm/min. Tests were performed 10 times for each group in artificial saliva. The average of 10 forces recorded was considered as static friction. One-way ANOVA and SPSS Version 18 and LSD post hoc test were used to evaluate the results of the study. Results: The mean static frictional force for each group was: group1: 0.82±0.14, group 2: 1.09±0.30, group 3: 0.87±0.53, group 4: 1.9±1.16, group 5: 1.42±0.30. There was a significant difference when comparing the two groups of similar wires in terms of shape (round or rectangular cross-section as when comparing Beta TMA 18 and 19×25 arch wires with each other, the obtained p-value was 0.023, while the obtained p-value for the comparison of stainles steel arch wires was 0.034. Conclusions: The result of this study shows that Stainless Steel 18 wires generate the least amount of friction and round wires produce less friction than the rectangular wires. Beta TMA wires generate the highest amount of friction.
Steward, W E
2012-01-01
Continuously in print since 1952, Modern Wiring Practice has now been fully revised to provide an up-to-date source of reference to building services design and installation in the 21st century. This compact and practical guide addresses wiring systems design and electrical installation together in one volume, creating a comprehensive overview of the whole process for contractors and architects, as well as electricians and other installation engineers. Best practice is incorporated throughout, combining theory and practice with clear and accessible explanation, all
Domain observations of Fe and Co based amorphous wires
International Nuclear Information System (INIS)
Takajo, M.; Yamasaki, J.
1993-01-01
Domain observations were made on Fe and Co based amorphous magnetic wires that exhibit a large Barkhausen discontinuity during flux reversal. Domain patterns observed on the wire surface were compared with those found on a polished section through the center of the wire. It was confirmed that the Fe based wire consists of a shell and core region as previously proposed, however, there is a third region between them. This fairly thick transition region made up of domains at an angle of about 45 degree to the wire axis clearly lacking the closure domains of the previous model. The Co based wire does not have a clear core and shell domain structure. The center of the wire had a classic domain structure expected of uniaxial anisotropy with the easy axis normal to the wire axis. When a model for the residual stress quenched-in during cooling of large Fe bars is applied to the wire, the expected anisotropy is consistent with the domain patterns in the Fe based wire, however, shape anisotropy still plays a dominant role in defining the wire core in the Co based wire
International Nuclear Information System (INIS)
Chalabi, H; Lorenzini, M; Morini, G L; Buchina, O; Valougeorgis, D; Saraceno, L
2012-01-01
In this paper a first experimental attempt is performed to measure heat conduction through rarefied air at rest contained between two concentric cylinders. The heat transfer between a heated platinum wire having a diameter (d) of 0.15 mm, disposed along the axis of a cylindrical shell in stainless steel having an inner diameter (D) of 100 mm, and a surrounded rarefied gas has been studied experimentally and numerically. The ratio between the outer and inner diameter of the annular region filled by the gas is large (D/d=667). In the annular region filled with air the pressure was varied by using a vacuum pump from atmospheric value down to 10 −3 mbar. Temperature differences between the wire and the external stainless steel wall in the range 50-125 K were imposed and the heat power transferred from the wire to the surround was measured as a function of the gas pressure starting from air at atmospheric conditions down to 10 −3 mbar. The experimental results obtained in these tests were compared with the numerical results obtained by using the linear and nonlinear Shakhov kinetic models.
Automatic reel controls filler wire in welding machines
Millett, A. V.
1966-01-01
Automatic reel on automatic welding equipment takes up slack in the reel-fed filler wire when welding operation is terminated. The reel maintains constant, adjustable tension on the wire during the welding operation and rewinds the wire from the wire feed unit when the welding is completed.
Method of preparing composite superconducting wire
International Nuclear Information System (INIS)
Verhoeven, J. D.; Finnemore, D. K.; Gibson, E. D.; Ostenson, J. E.; Schmidt, F. A.
1985-01-01
An improved method of preparing composite multifilament superconducting wire of Nb 3 Sn in a copper matrix which eliminates the necessity of coating the drawn wire with tin. A generalized cylindrical billet of an alloy of copper containing at least 15 weight percent niobium, present in the copper as discrete, randomly distributed and oriented dendritic-shaped particles, is provided with at least one longitudinal opening which is filled with tin to form a composite drawing rod. The drawing rod is then drawn to form a ductile composite multifilament wire containing a filament of tin. The ductile wire containing the tin can then be wound into magnet coils or other devices before heating to diffuse the tin through the wire to react with the niobium forming Nb 3 Sn. Also described is an improved method for making large billets of the copper-niobium alloy by consumable-arc casting
Protein clearance from the air spaces and lungs of unanesthetized sheep over 144 h
International Nuclear Information System (INIS)
Berthiaume, Y.; Albertine, K.H.; Grady, M.; Fick, G.; Matthay, M.A.
1989-01-01
We studied the rate, the routes, and the mechanisms for protein clearance from the air spaces and lungs of 20 unanesthetized sheep over 144 h. We instilled 100 ml of autologous serum labeled with 125I-albumin into one lung. At the end of 24, 48, 96, or 144 h, the lungs were removed and the residual native protein and 125I-albumin in the air spaces were determined by bronchoalveolar lavage. Also the fraction of the instilled 125I-albumin remaining in the rest of the lung was measured in the lung homogenate. Clearance of the 125I-albumin from the lung into the plasma, lymph, thyroid, urine, and feces was also determined. The removal of both the 125I-albumin and the native protein from the air spaces was slow, following a monoexponential decline. The removal rate of the 125I-albumin from the air spaces was slightly but significantly faster (1.6%/h) than the clearance rate of the native protein (0.9%/h). Clearance of the 125I-albumin from the lung also followed a slow monoexponential decline at a rate of 1.4%/h. At all time periods, 75% of the 125I-albumin remaining in the lung was located in the air spaces, thus indicating that the pulmonary epithelium is the principal barrier to protein clearance from the normal lung. Macrophages appeared to play a minor role in alveolar protein clearance because the quantity of 125I-albumin present in the phagocytic cells in the air spaces was less than 1% of the instilled 125I-albumin at all time periods. However, macrophages may play some role in protein clearance after 48 h because we visualized phagolysosomes in macrophages, and there was an increase in free iodine in lung lavage, urine, thyroid, and feces after 48 h. However, gel electrophoretic studies showed that most of the 125I-albumin was cleared from the lung as an intact molecule, although only 24.7 +/- 4.7% of the 125I-albumin was cleared by the lymphatics
2010-11-23
... Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 Reciprocating Engines AGENCY: Federal... Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE 125-02-114 reciprocating engines installed in, but..., Operation & Maintenance Manual OM- 01-02, Issue 3, Revision 13. (ii) For TAE 125-02-99 and TAE 125-02-114...
The preparation of 125I - gastrin I and 125 - minigastrin for medical diagnostics
International Nuclear Information System (INIS)
Byszewska-Szpocinska, E.; Markiewicz, A.
2002-01-01
Gastrin I G-17 and minigastrin G-13 were iodinated using direct methods with chloramin T and iodogen procedures and by indirect method with Bolton-Hunter reagent. 125 I - gastrin and 1 25 I - minigastrin were isolated from the iodination mixtures by gel filtration on Sephadex G-10 and Sephadex G-25 (PD-10 column) and by HPLC system (Lichrospher WP-300-RP-18 column). Radiochemical purity was shown by HPLC also. It was confirmed that iodogen procedure is the best for iodination of these peptides. 125 I - gastrin I obtained by this method with specific activity 80 μCi/nmol was homogeneous but iodination to higher specific activity (440μCi/nmol) caused appearance of two subfractions. 125 I - minigastrin with high and low specific activity were isolated by HPLC as the two forms (subfractions). It was shown that high performance liquid chromatography (HPLC) was the best method for isolation and purification of 125 I - gastrin I and 125 I - minigastrin. (author)
FE modeling of Cu wire bond process and reliability
Yuan, C.A.; Weltevreden, E.R.; Akker, P. van den; Kregting, R.; Vreugd, J. de; Zhang, G.Q.
2011-01-01
Copper based wire bonding technology is widely accepted by electronic packaging industry due to the world-wide cost reduction actions (compared to gold wire bond). However, the mechanical characterization of copper wire differs from the gold wire; hence the new wire bond process setting and new bond
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false [Reserved] 284.125 Section 284.125 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Transportation by Intrastate Pipelines § 284.125 [Reserved] ...
Monitoring and evaluation of wire mesh forming life
Enemuoh, Emmanuel U.; Zhao, Ping; Kadlec, Alec
2018-03-01
Forming tables are used with stainless steel wire mesh conveyor belts to produce variety of products. The forming tables will typically run continuously for several days, with some hours of scheduled downtime for maintenance, cleaning and part replacement after several weeks of operation. The wire mesh conveyor belts show large variation in their remaining life due to associated variations in their nominal thicknesses. Currently the industry is dependent on seasoned operators to determine the replacement time for the wire mesh formers. The drawback of this approach is inconsistency in judgements made by different operators and lack of data knowledge that can be used to develop decision making system that will be more consistent with wire mesh life prediction and replacement time. In this study, diagnostic measurements about the health of wire mesh former is investigated and developed. The wire mesh quality characteristics considered are thermal measurement, tension property, gage thickness, and wire mesh wear. The results show that real time thermal sensor and wear measurements would provide suitable data for the estimation of wire mesh failure, therefore, can be used as a diagnostic parameter for developing structural health monitoring (SHM) system for stainless steel wire mesh formers.
An update on irradiation of wire and cable
International Nuclear Information System (INIS)
Hildreth, N.
1981-01-01
Radiation curing with electron accelerators is a growing high technology application in the wire and cable industry. They are used with voltages ranging from 500,000 up to 3,000,000 electron volts. Furthermore new machines are available up to 5.0 MeV. These industrial machines are high powered accelerators which operate continuously between 60 and 75 kilowatts with a few of the new machines operating up to 200 kilowatts. Radiation curing is used as a tool for developing new insulation systems based on low cost materials for applications which previously required the use of expensive fluorocarbon or silicone rubber type insulations. With the development of the larger, more efficient and reliable accelerators and the continuous trend toward developing new insulations designed to fully utilize the potential of radiation chemistry, the authors are confident that industry will continue to be provided with better, lower cost insulation systems
Coker, A J
1992-01-01
Electric Wiring: Domestic, Tenth Edition, is a clear and reliable guide to the practical aspects of domestic electric wiring. Intended for electrical contractors, installation engineers, wiremen and students, its aim is to provide essential up to date information on modern methods and materials in a simple, clear, and concise manner. The main changes in this edition are those necessary to bring the work into line with the 16th Edition of the Regulations for Electrical Installations issued by the Institution of Electrical Engineers. The book begins by introducing the basic features of domestic
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Research. 1220.125 Section 1220.125 Agriculture... AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE SOYBEAN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.125 Research. The term...
DEFF Research Database (Denmark)
Zhang, Xiaodan; Hansen, Niels; Godfrey, Andrew
2016-01-01
The tensile properties and the deformation microstructure of pearlitic steel (0.8 wt % C) have been quantified in wires drawn to strains in the range from 3.7 to 5.4, having a flow stress in the range from 3.5 to 4.5 GPa. With increasing strain the interlamellar spacing (ILS) decreases from about...... mechanism in the wire and three strengthening mechanisms are applied: boundary strengthening, dislocation strengthening and solid solution hardening with their relative contributions to the total flow stress which change as the strain is increased. Based on linear additivity good correspondence between...
Micro Wire-Drawing: Experiments And Modelling
International Nuclear Information System (INIS)
Berti, G. A.; Monti, M.; Bietresato, M.; D'Angelo, L.
2007-01-01
In the paper, the authors propose to adopt the micro wire-drawing as a key for investigating models of micro forming processes. The reasons of this choice arose in the fact that this process can be considered a quasi-stationary process where tribological conditions at the interface between the material and the die can be assumed to be constant during the whole deformation. Two different materials have been investigated: i) a low-carbon steel and, ii) a nonferrous metal (copper). The micro hardness and tensile tests performed on each drawn wire show a thin hardened layer (more evident then in macro wires) on the external surface of the wire and hardening decreases rapidly from the surface layer to the center. For the copper wire this effect is reduced and traditional material constitutive model seems to be adequate to predict experimentation. For the low-carbon steel a modified constitutive material model has been proposed and implemented in a FE code giving a better agreement with the experiments
FernáNdez Pantoja, M.; Yarovoy, A. G.; Rubio Bretones, A.; GonzáLez GarcíA, S.
2009-12-01
This paper presents a procedure to extend the methods of moments in time domain for the transient analysis of thin-wire antennas to include those cases where the antennas are located over a lossy half-space. This extended technique is based on the reflection coefficient (RC) approach, which approximates the fields incident on the ground interface as plane waves and calculates the time domain RC using the inverse Fourier transform of Fresnel equations. The implementation presented in this paper uses general expressions for the RC which extend its range of applicability to lossy grounds, and is proven to be accurate and fast for antennas located not too near to the ground. The resulting general purpose procedure, able to treat arbitrarily oriented thin-wire antennas, is appropriate for all kind of half-spaces, including lossy cases, and it has turned out to be as computationally fast solving the problem of an arbitrary ground as dealing with a perfect electric conductor ground plane. Results show a numerical validation of the method for different half-spaces, paying special attention to the influence of the antenna to ground distance in the accuracy of the results.
Comparison between wire mesh sensor and gamma densitometry void measurements in two-phase flows
Sharaf, S.; Da Silva, M.; Hampel, U.; Zippe, C.; Beyer, M.; Azzopardi, B.
2011-10-01
Wire mesh sensors (WMS) are fast imaging instruments that are used for gas-liquid and liquid-liquid two-phase flow measurements and experimental investigations. Experimental tests were conducted at Helmholtz-Zentrum Dresden-Rossendorf to test both the capacitance and conductance WMS against a gamma densitometer (GD). A small gas-liquid test facility was utilized. This consisted of a vertical round pipe approximately 1 m in length, and 50 mm internal diameter. A 16 × 16 WMS was used with high spatial and temporal resolutions. Air-deionized water was the two-phase mixture. The gas superficial velocity was varied between 0.05 m s-1 and 1.4 m s-1 at two liquid velocities of 0.2 and 0.7 m s-1. The GD consisted of a collimated source and a collimated detector. The GD was placed on a moving platform close to the plane of wires of the sensor, in order to align it accurately using a counter mechanism, with each of the wires of the WMS, and the platform could scan the full section of the pipe. The WMS was operated as a conductivity WMS for a half-plane with eight wires and as a capacitance WMS for the other half. For the cross-sectional void (time and space averaged), along each wire, there was good agreement between WMS and the GD chordal void fraction near the centre of the pipe.
Comparison between wire mesh sensor and gamma densitometry void measurements in two-phase flows
International Nuclear Information System (INIS)
Sharaf, S; Azzopardi, B; Da Silva, M; Hampel, U; Zippe, C; Beyer, M
2011-01-01
Wire mesh sensors (WMS) are fast imaging instruments that are used for gas–liquid and liquid–liquid two-phase flow measurements and experimental investigations. Experimental tests were conducted at Helmholtz-Zentrum Dresden-Rossendorf to test both the capacitance and conductance WMS against a gamma densitometer (GD). A small gas–liquid test facility was utilized. This consisted of a vertical round pipe approximately 1 m in length, and 50 mm internal diameter. A 16 × 16 WMS was used with high spatial and temporal resolutions. Air–deionized water was the two-phase mixture. The gas superficial velocity was varied between 0.05 m s −1 and 1.4 m s −1 at two liquid velocities of 0.2 and 0.7 m s −1 . The GD consisted of a collimated source and a collimated detector. The GD was placed on a moving platform close to the plane of wires of the sensor, in order to align it accurately using a counter mechanism, with each of the wires of the WMS, and the platform could scan the full section of the pipe. The WMS was operated as a conductivity WMS for a half-plane with eight wires and as a capacitance WMS for the other half. For the cross-sectional void (time and space averaged), along each wire, there was good agreement between WMS and the GD chordal void fraction near the centre of the pipe
Seeded perturbations in wire array Z-Pinches
International Nuclear Information System (INIS)
Robinson, Allen Conrad; Fedin, Dmitry; Kantsyrev, Victor Leonidovich; Wunsch, Scott Edward; Oliver, Bryan Velten; Lebedev, Sergey V.; Coverdale, Christine Anne; Ouart, Nicholas D.; LePell, Paul David; Safronova, Alla S.; Shrestha, I.; McKenney, John Lee; Ampleford, David J.; Rapley, J.; Bott, S.C.; Palmer, J.B.A.; Sotnikov, Vladimir Isaakovich; Bland, Simon Nicholas; Ivanov, Vladimir V.; Chittenden, Jeremy Paul; Jones, B.; Garasi, Christopher Joseph; Hall, Gareth Neville; Yilmaz, M. Faith; Mehlhorn, Thomas Alan; Deeney, Christopher; Pokala, S.; Nalajala, V.
2005-01-01
Controlled seeding of perturbations is employed to study the evolution of wire array z-pinch implosion instabilities which strongly impact x-ray production when the 3D plasma stagnates on axis. Wires modulated in radius exhibit locally enhanced magnetic field and imploding bubble formation at discontinuities in wire radius due to the perturbed current path. Wires coated with localized spectroscopic dopants are used to track turbulent material flow. Experiments and MHD modeling offer insight into the behavior of z-pinch instabilities.
The Wire and the Disenchantment of the Outsider
DEFF Research Database (Denmark)
Jensen, Mikkel Bo Brendstrup
2019-01-01
for themselves but in the analysis of selected characters from the show – Omar Little, Jimmy McNulty, and Stringer Bell – it is shown that these characters all are outsiders in different ways and that the show tries to debunk the charisma of the outsider that relates to these characters. This deromanticization......This article presents a contextualist reading of the television serial The Wire (2002-2008). Drawing on Grace Hale’s A Nation of Outsiders (2011), the article argues that there is a tension between this show and its paratexts in the way that the creators of the show embrace an outsider rhetoric...... of the outsider is an important part of the politics that the show espouses and the article argues that this rejection is a part of the show’s “sociological gaze” where all social phenomena are seen in relation to each other and the The Wire is shown not to buy into the notion of a free space beyond...
Etravirine: R165335, TMC 125, TMC-125, TMC125.
2006-01-01
Etravirine [TMC 125] is a next-generation non-nucleoside reverse transcriptase inhibitor (NNRTI) that is being developed by Tibotec (Tibotec-Virco Group; now Johnson & Johnson) for the treatment of HIV-1 infections. Etravirine is a highly flexible, di-aryl-pyrimidine (DAPY) compound. The flexibility enables favourable binding interactions with mutant HIV strains as well as wild-type virus. Etravirine has superseded dapivirine as Tibotec's lead NNRTI in clinical development worldwide. Tibotec merged with Virco to form Tibotec-Virco Group in March 2001. Subsequently, Tibotec-Virco Group was acquired by Johnson & Johnson on 18 April 2002. Etravirine was discovered by Tibotec in collaboration with the Janssen Research Foundation. However, the Janssen Research Foundation is no longer involved in the development of etravirine. Etravirine has received fast-track status from the US FDA for the treatment of HIV-1 infections. An expanded access programme for etravirine began in the US in September 2006. The programme made etravirine available to HIV-1 infected adults who have limited treatment options due to virological failure or intolerance to multiple antiretroviral regimens. The progamme will also be introduced in Canada and Europe. In November 2005, Tibotec initiated two randomised, placebo-controlled phase III trials of etravirine in treatment-experienced HIV-1 infected patients with NNRTI resistance and at least three primary protease mutations. The two trials will each enroll 600 patients and will be conducted in 18 countries. Darunavir will be used as the background protease inhibitor in the trials. This is the first time that two investigational antivirals have been evaluated in combination in heavily treatment-experienced patients. The trial design is supported by the FDA, the Committee for Medicinal Products for Human Use (CHMP) of the EMEA and the HIV patient community. Patient enrolment in the two phase III trials was completed in September 2006. A multicentre
29 CFR 1926.404 - Wiring design and protection.
2010-07-01
.... Receptacles on a two-wire, single-phase portable or vehicle-mounted generator rated not more than 5kW, where the circuit conductors of the generator are insulated from the generator frame and all other grounded... wiring shall be grounded: (i) Three-wire DC systems. All 3-wire DC systems shall have their neutral...
Acoustic Emission from Elevator Wire Ropes During Tensile Testing
Bai, Wenjie; Chai, Mengyu; Li, Lichan; Li, Yongquan; Duan, Quan
The acoustic emission (AE) technique was used to monitor the tensile testing process for two kinds of elevator wire ropes in our work. The AE signals from wire breaks were obtained and analyzed by AE parameters and waveforms. The results showed that AE technique can be a useful tool to monitor wire break phenomenon of wire ropes and effectively capture information of wire break signal. The relationship between AE signal characteristics and wire breaks is investigated and it is found that the most effective acoustic signal discriminators are amplitude and absolute energy. Moreover, the wire break signal of two kinds of ropes is a type of burst signal and it is believed that the waveform and spectrum can be applied to analyze the AE wire break signals.
Superconducting wires and methods of making thereof
Energy Technology Data Exchange (ETDEWEB)
Xu, Xingchen; Sumption, Michael D.; Peng, Xuan
2018-03-13
Disclosed herein are superconducting wires. The superconducting wires can comprise a metallic matrix and at least one continuous subelement embedded in the matrix. Each subelement can comprise a non-superconducting core, a superconducting layer coaxially disposed around the non-superconducting core, and a barrier layer coaxially disposed around the superconducting layer. The superconducting layer can comprise a plurality of Nb.sub.3Sn grains stabilized by metal oxide particulates disposed therein. The Nb.sub.3Sn grains can have an average grain size of from 5 nm to 90 nm (for example, from 15 nm to 30 nm). The superconducting wire can have a high-field critical current density (J.sub.c) of at least 5,000 A/mm.sup.2 at a temperature of 4.2 K in a magnetic field of 12 T. Also described are superconducting wire precursors that can be heat treated to prepare superconducting wires, as well as methods of making superconducting wires.
Impedance Characterisation of the SPS Wire Scanner
AUTHOR|(CDS)2091911; Prof. Sillanpää, Mika
As a beam diagnostic tool, the SPS wire scanner interacts with the proton bunches traversing the vacuum pipes of the Super Proton Synchrotron particle accelerator. Following the interaction, the bunches decelerate or experience momentum kicks off-axis and couple energy to the cavity walls, resonances and to the diagnostic tool, the scanning wire. The beam coupling impedance and, in particular, the beam induced heating of the wire motivate the characterisation and redesign of the SPS wire scanner. In this thesis, we characterise RF-wise the low frequency modes of the SPS wire scanner. These have the highest contribution to the impedance. We measure the cavity modes in terms of resonance frequency and quality factor by traditional measurement techniques and data analysis. We carry out a 4-port measurement to evaluate the beam coupling to the scanning wire, that yields the spectral heating power. If combined with the simulations, one is able to extract the beam coupling impedance and deduce the spectral dissipa...
Body of Knowledge (BOK) for Copper Wire Bonds
Rutkowski, E.; Sampson, M. J.
2015-01-01
Copper wire bonds have replaced gold wire bonds in the majority of commercial semiconductor devices for the latest technology nodes. Although economics has been the driving mechanism to lower semiconductor packaging costs for a savings of about 20% by replacing gold wire bonds with copper, copper also has materials property advantages over gold. When compared to gold, copper has approximately: 25% lower electrical resistivity, 30% higher thermal conductivity, 75% higher tensile strength and 45% higher modulus of elasticity. Copper wire bonds on aluminum bond pads are also more mechanically robust over time and elevated temperature due to the slower intermetallic formation rate - approximately 1/100th that of the gold to aluminum intermetallic formation rate. However, there are significant tradeoffs with copper wire bonding - copper has twice the hardness of gold which results in a narrower bonding manufacturing process window and requires that the semiconductor companies design more mechanically rigid bonding pads to prevent cratering to both the bond pad and underlying chip structure. Furthermore, copper is significantly more prone to corrosion issues. The semiconductor packaging industry has responded to this corrosion concern by creating a palladium coated copper bonding wire, which is more corrosion resistant than pure copper bonding wire. Also, the selection of the device molding compound is critical because use of environmentally friendly green compounds can result in internal CTE (Coefficient of Thermal Expansion) mismatches with the copper wire bonds that can eventually lead to device failures during thermal cycling. Despite the difficult problems associated with the changeover to copper bonding wire, there are billions of copper wire bonded devices delivered annually to customers. It is noteworthy that Texas Instruments announced in October of 2014 that they are shipping microcircuits containing copper wire bonds for safety critical automotive applications
Adabi, Saba; Pajewski, Lara
2014-05-01
This work deals with the electromagnetic wire-grid modelling of metallic cylindrical objects, buried in the ground or embedded in a structure, for example in a wall or in a concrete slab. Wire-grid modelling of conducting objects was introduced by Richmond in 1966 [1] and, since then, this method has been extensively used over the years to simulate arbitrarily-shaped objects and compute radiation patterns of antennas, as well as the electromagnetic field scattered by targets. For any wire-grid model, a fundamental question is the choice of the optimum wire radius and grid spacing. The most widely used criterion to fix the wire size is the so-called same-area rule [2], coming from empirical observation: the total surface area of the wires has to be equal to the surface area of the object being modelled. However, just few authors have investigated the validity of this criterion. Ludwig [3] studied the reliability of the rule by examining the canonical radiation problem of a transverse magnetic field by a circular cylinder fed with a uniform surface current, compared with a wire-grid model; he concluded that the same-area rule is optimum and that too thin wires are just as bad as too thick ones. Paknys [4] investigated the accuracy of the same-area rule for the modelling of a circular cylinder with a uniform current on it, continuing the study initiated in [3], or illuminated by a transverse magnetic monochromatic plane wave; he deduced that the same-area rule is optimal and that the field inside the cylinder is most sensitive to the wire radius than the field outside the object, so being a good error indicator. In [5], a circular cylinder was considered, embedded in a dielectric half-space and illuminated by a transverse magnetic monochromatic plane wave; the scattered near field was calculated by using the Cylindrical-Wave Approach and numerical results, obtained for different wire-grid models in the spectral domain, were compared with the exact solution. The
Modeling Sub-500MHz Space-Borne Radar Signal Propagation in Complex Media
National Aeronautics and Space Administration — Space-borne radar platforms are becoming increasingly prevalent in current and planned missions by NASA and partner organizations (e.g. the European Space Agency...
International Nuclear Information System (INIS)
Dickinson, K.E.; Leeb-Lundberg, L.M.; Heald, S.L.; Wikberg, J.E.; DeBernardis, J.F.; Caron, M.G.; Lefkowitz, R.J.
1984-01-01
We have synthesized and characterized a high-affinity alpha 1-adrenergic receptor probe, 4-amino-6,7-dimethoxy-2[4'- [5''(3'''- 125 I-iodo-4'''-aminophenyl)pentanoyl]-1'-piperazinyl] quinazoline ( 125 I-A55453). This ligand binds reversibly to rat hepatic plasma membranes with high affinity (KD . 77 +/- 6 pM), and it labels the same number of specific prazosin-competable sites as the alpha 1-adrenergic receptor-selective radioligand [ 125 I] iodo-2-[beta-(4-hydroxyphenyl)-ethylaminomethyl]tetralone. Specific binding is stereoselective and competed for by alpha-adrenergic agents with an alpha 1-adrenergic receptor specificity. 125 I-A55453 can be covalently photoincorporated into peptides of rat hepatic and splenic membranes using the bifunctional photoactive cross-linker, N-succinimidyl-6- (4'-azido-2'-nitrophenylamino)hexanoate. Following photolysis, sodium dodecyl sulfate-polyacrylamide gel electrophoresis of labeled hepatic membranes reveals a major specifically labeled peptide of Mr . 82,000 (+/- 1,000) with minor peptides at Mr . 50,000 (+/- 500), and 40,000 (+/- 300). Covalent incorporation of 125 I-A55453 into the Mr . 82,000 peptide is inhibited by adrenergic drugs with an alpha 1-adrenergic receptor specificity. Labeled splenic membranes demonstrate a broad band of photoincorporated radioactivity centered at Mr . 82,000, and covalent incorporation into this peptide is also attenuated with an alpha 1-adrenergic receptor specificity. This new high-affinity radioiodinated probe has features which should make it useful for the molecular characterization of alpha 1-adrenergic receptors in tissues
International Nuclear Information System (INIS)
Wang Pengxiang; Chen Junhong
2009-01-01
The effect of electrode configuration on ozone production in the direct-current corona discharge of dry and humid air is studied by a numerical model that combines the electron distribution in the corona plasma, plasma chemistry and transport phenomena. Two electrode configurations are considered: wire-cylinder discharge with air flowing along the wire axis and wire-plate discharge with air flowing transverse to the wire. The ozone distributions in both types of discharges are compared. For both electrode configurations, the ozone production rate is higher in the negative corona than in the positive corona and it decreases with an increase in relative humidity. More importantly, the detailed ozone distribution in the neighbourhood of the discharge wire, together with the ozone kinetics, reveals the possible difference in the ozone production from the two discharges. With the same operating conditions and sufficiently short flow residence time, the ozone production rate is nearly the same for both electrode configurations. When the flow residence time is longer than the characteristic time for homogeneous ozone destruction, the net ozone production is higher in the wire-cylinder discharge than in the wire-plate discharge due to relatively less ozone destruction.
Wang, Pengxiang; Chen, Junhong
2009-02-01
The effect of electrode configuration on ozone production in the direct-current corona discharge of dry and humid air is studied by a numerical model that combines the electron distribution in the corona plasma, plasma chemistry and transport phenomena. Two electrode configurations are considered: wire-cylinder discharge with air flowing along the wire axis and wire-plate discharge with air flowing transverse to the wire. The ozone distributions in both types of discharges are compared. For both electrode configurations, the ozone production rate is higher in the negative corona than in the positive corona and it decreases with an increase in relative humidity. More importantly, the detailed ozone distribution in the neighbourhood of the discharge wire, together with the ozone kinetics, reveals the possible difference in the ozone production from the two discharges. With the same operating conditions and sufficiently short flow residence time, the ozone production rate is nearly the same for both electrode configurations. When the flow residence time is longer than the characteristic time for homogeneous ozone destruction, the net ozone production is higher in the wire-cylinder discharge than in the wire-plate discharge due to relatively less ozone destruction.
2011-03-31
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-01, TAE 125-02-99, and TAE 125-02-114.... Applicability (c) This AD applies to Thielert Aircraft Engines GmbH models TAE 125-01, TAE 125-02-99, and TAE...) For TAE 125-02-99 and TAE 125-02-114 engines, Operation & Maintenance Manual OM-02-02, Version 2...
Fernández Pantoja, M.; Yarovoy, A.G.; Rubio Bretones, A.; González García, S.
2009-01-01
This paper presents a procedure to extend the methods of moments in time domain for the transient analysis of thin-wire antennas to include those cases where the antennas are located over a lossy half-space. This extended technique is based on the reflection coefficient (RC) approach, which
Fabrication of tungsten wire needles
International Nuclear Information System (INIS)
Roder, A.
1983-02-01
Fine point needles for field emissoin are conventionally produced by electrolytically or chemically etching tungsten wire. Points formed in this manner have a typical tip radius of about 0.5 microns and a cone angle of some 30 degrees. The construction of needle matrix detector chambers has created a need for tungsten needles whose specifications are: 20 mil tungsten wire, 1.5 inch total length, 3 mm-long taper (resulting in a cone angle of about 5 degrees), and 25 micron-radius point (similar to that found on sewing needles). In the process described here for producing such needles, tungsten wire, immersed in a NaOH solution and in the presence of an electrode, is connected first to an ac voltage and then to a dc supply, to form a taper and a point on the end of the wire immersed in the solution. The process parameters described here are for needles that will meet the above specifications. Possible variations will be discussed under each approprite heading
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Relationships. 1.25 Section 1.25 Transportation Office of the Secretary of Transportation ORGANIZATION AND DELEGATION OF POWERS AND DUTIES Office of the Secretary § 1.25 Relationships. (a) Normal staff role. Normally, the functions of the Assistant Secretaries...
Horizontal Air-Water Flow Analysis with Wire Mesh Sensor
International Nuclear Information System (INIS)
De Salve, M; Monni, G; Panella, B
2012-01-01
A Wire Mesh Sensor, based on the measurement of the local instantaneous conductivity of the two-phase mixture, has been used to characterize the fluid dynamics of the gas–liquid interface in a horizontal pipe flow. Experiments with a pipe of a nominal diameter of 19.5 mm and total length of 6 m, have been performed with air/water mixtures, at ambient conditions. The flow quality ranges from 0.00016 to 0.22 and the superficial velocities range from 0.1 to 10.5 m/s for air and from 0.02 to 1.7 m/s for water; the flow pattern is stratified, slug/plug and annular. A sensor (WMS200) with an inner diameter of 19.5 mm and a measuring matrix of 16×16 points equally distributed over the cross-section has been chosen for the measurements. From the analysis of the Wire Mesh Sensor digital signals the average and the local void fraction are evaluated and the flow patterns are identified with reference to space, time and flow rate boundary conditions.
Current's Fluctuations through Molecular Wires Composed of Thiophene Rings.
Ojeda Silva, Judith Helena; Cortés Peñaranda, Juan Camilo; Gómez Castaño, Jovanny A; Duque, Carlos Alberto
2018-04-11
We study theoretically the electronic transport and quantum fluctuations in single-molecule systems using thiophene rings as integrated elementary functions, as well as the dependence of these properties with the increase of the coupled rings, i.e., as a quantum wire. In order to analyze the current flow through these molecular systems, the thiophene rings are considered to be connected to metal contacts, which, in general terms, will be related to the application of voltages (bias voltages or gate voltages) to generate non-equilibrium behavior between the contacts. Due to the nonlinear behavior that is generated when said voltages are applied, it is possible to observe quantum fluctuations in the transport properties of these molecular wires. For the calculation of the transport properties, we applied a tight-binding approach using the Landauer-Büttiker formalism and the Fischer-Lee relationship, by means of a semi-analytic Green's function method within a real-space renormalization (decimation procedure). Our results showed an excellent agreement with results using a tight-binding model with a minimal number of parameters reported so far for these molecular systems.
2.45 GHz Rectenna Designed for Wireless Sensors Operating at 500 C
Ponchak, George E.; Schwartz, Zachary D.; Jordan, Jennifer L.; Downey, Alan N.; Neudeck, Philip G.
2004-01-01
High temperature wireless sensors that operate at 500 C are required for aircraft engine monitoring and performance improvement These sensors would replace currently used hard-wired sensors and lead to a substantial reduction in mass. However, even if the sensor output data is transmitted wirelessly to a receiver in the cooler part of the engine, and the associated cables are eliminated, DC power cables are still required to operate the sensors and power the wireless circuits. To solve this problem, NASA is developing a rectenna, a circuit that receives RF power and converts it to DC power. The rectenna would be integrated with the wireless sensor, and the RF transmitter that powers the rectenna would be located in the cooler part of the engine. In this way, no cables to or from the sensors are required. Rectennas haw been demonstrated at ambient room temperature, but to date, no high temperature rectennas haw been reported. In this paper, we report the first rectenna designed for 2.45 GHz operation at 500 C. The circuit consists of a microstrip dipole antenna, a stripline impedance matching circuit, and a stripline low pass filter to prevent transmission of higher harmonics created by the rectifying diode fabricated on an Alumina substrate. The rectifying diode is the gate to source junction of a 6H Sic MESFET and the capacitor and load resistor are chip elements that are each bonded to the Alumina substrate. Each element and the hybrid, rectenna circuit haw been characterized through 500 C.
International Nuclear Information System (INIS)
Feher, Anselmo; Calvo, Wilson A.P.; Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Somessari, Samir L.; Costa, Osvaldo L.; Moura, Joao A.; Moura, Eduardo S.; Souza, Carla D.; Rela, Paulo R.
2011-01-01
The prostate cancer, which is the second cause of death by cancer in men, overcome only by lung cancer is public health problem in Brazil. Brachytherapy is among the possible available treatments for prostate cancer, in which small seeds containing Iodine-125 radioisotope are implanted into the prostate gland. The seed consists of a titanium sealed capsule with 0.8 mm external diameter and 4.5 mm length, containing a central silver wire with adsorbed Iodine-125. The Plasma Arc Welding (PAW) is one of the viable techniques for sealing process. The equipment used in this technique is less costly than in other processes, such as, Laser Beam Welding (LBW). The main purpose of this work was the development of an encapsulation method using PAW. The development of this work has presented the following phases: cutting and cleaning titanium tube, determination of the welding parameters, development of a titanium tube holding device for PAW, sealed sources validation according to ISO 2919 - Sealed Radioactive Sources - General Requirements and Classification, and metallographic assays. The developed procedure to seal Iodine-125 seeds using PAW has shown high efficiency, satisfying all the established requirements of ISO 2919. The results obtained in this work will give the possibility to establish a routine production process according to the orientations presented in resolution RDC 17 - Good Manufacturing Practices to Medical Products defined by the ANVISA - National Agency of Sanitary Surveillance. (author)
Energy Technology Data Exchange (ETDEWEB)
Feher, Anselmo; Calvo, Wilson A.P.; Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Somessari, Samir L.; Costa, Osvaldo L.; Moura, Joao A.; Moura, Eduardo S.; Souza, Carla D.; Rela, Paulo R., E-mail: afeher@ipen.b, E-mail: wapcalvo@ipen.b, E-mail: elisaros@ipen.b, E-mail: somessar@ipen.b, E-mail: olcosta@ipen.b, E-mail: esmoura@ipen.b, E-mail: cdsouza@ipen.b, E-mail: prela@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-07-01
The prostate cancer, which is the second cause of death by cancer in men, overcome only by lung cancer is public health problem in Brazil. Brachytherapy is among the possible available treatments for prostate cancer, in which small seeds containing Iodine-125 radioisotope are implanted into the prostate gland. The seed consists of a titanium sealed capsule with 0.8 mm external diameter and 4.5 mm length, containing a central silver wire with adsorbed Iodine-125. The Plasma Arc Welding (PAW) is one of the viable techniques for sealing process. The equipment used in this technique is less costly than in other processes, such as, Laser Beam Welding (LBW). The main purpose of this work was the development of an encapsulation method using PAW. The development of this work has presented the following phases: cutting and cleaning titanium tube, determination of the welding parameters, development of a titanium tube holding device for PAW, sealed sources validation according to ISO 2919 - Sealed Radioactive Sources - General Requirements and Classification, and metallographic assays. The developed procedure to seal Iodine-125 seeds using PAW has shown high efficiency, satisfying all the established requirements of ISO 2919. The results obtained in this work will give the possibility to establish a routine production process according to the orientations presented in resolution RDC 17 - Good Manufacturing Practices to Medical Products defined by the ANVISA - National Agency of Sanitary Surveillance. (author)
Hardening and softening mechanisms of pearlitic steel wire under torsion
International Nuclear Information System (INIS)
Zhao, Tian-Zhang; Zhang, Shi-Hong; Zhang, Guang-Liang; Song, Hong-Wu; Cheng, Ming
2014-01-01
Highlights: • Mechanical behavior of pearlitic steel wire is studied using torsion. • Work hardening results from refinement lamellar pearlitic structure. • Softening results from recovery, shear bands and lamellar fragmentations. • A microstructure based analytical flow stress model is established. - Abstract: The mechanical behaviors and microstructure evolution of pearlitic steel wires under monotonic shear deformation have been investigated by a torsion test and a number of electron microscopy techniques including scanning electron microscopy (SEM) and transmission electron microscopy (TEM), with an aim to reveal the softening and hardening mechanisms of a randomly oriented pearlitic structure during a monotonic stain path. Significantly different from the remarkable strain hardening in cold wire drawing, the strain hardening rate during torsion drops to zero quickly after a short hardening stage. The microstructure observations indicate that the inter-lamellar spacing (ILS) decreases and the dislocations accumulate with strain, which leads to hardening of the material. Meanwhile, when the strain is larger than 0.154, the enhancement of dynamic recovery, shear bands (SBs) and cementite fragmentations results in the softening and balances the strain hardening. A microstructure based analytical flow stress model with considering the influence of ILS on the mean free path of dislocations and the softening caused by SBs and cementite fragmentations, has been established and the predicted flow shear curve meets well with the measured curve in the torsion test
Huang, Chenyu; Ogawa, Rei; Hyakusoku, Hiko
2014-08-01
The current skin graft fixation methods for digits, including the Kirschner wire insertion technique, can be limited by inadequate or excessive fixation and complications such as infection or secondary injuries. Therefore, the external wire-frame fixation method was invented and used for skin grafting of digits. This study aimed to investigate external wire-frame fixation of digital skin grafts as a non-invasive alternative to the K-wire insertion method. In 2005-2012, 15 patients with burn scar contractures on the hand digits received a skin graft that was then fixed with an external wire frame. The intra-operative time needed to make the wire frame, the postoperative time to frame and suture removal, the graft survival rate, the effect of contracture release and the complications were recorded. In all cases, the contracture release was 100%. The complete graft survival rate was 98.6%. Four patients had epithelial necrosis in wire-frame fixation is simple, minimally invasive and a custom-made technique for skin grafting of the fingers. It was designed for its potential benefits and the decreased risk it poses to patients with scar contractures on their fingers. It can be implemented in three phases of grafting, does not affect the epiphyseal line or subsequent finger growth and is suitable for children with multi-digit involvement. Copyright © 2013 Elsevier Ltd and ISBI. All rights reserved.
Formation of plasma around wire fragments created by electrically exploded copper wire
International Nuclear Information System (INIS)
Taylor, Michael J.
2002-01-01
The physical processes occurring during the electrical explosion of metallic conductors has attracted interest for many years. Applications include circuit breakers, segmented lightning divertor strips for aircraft radomes, disruption of metallic shaped charge jets, plasma armatures for electromagnetic railguns and plasma generators for electrothermal-chemical guns. Recent work has cited the phenomenology of the fragmentation processes, particularly the development of a plasma around the lower resistance condensed fragments. An understanding of both the fragmentation process and the development of the accompanying formation of plasma is essential for the optimization of devices that utilize either of these phenomena. With the use of x-radiography and fast photography, this paper explores the wire explosion process, in particular the relationship between the fragmentation, plasma development and resistance rise that occurs during this period. A hypothesis is put forward to account for the development of plasma around the condensed wire fragments. Experimental parameters used in this study are defined. Wires studied were typically copper, with a diameter of 1 mm and length in excess of 150 mm. Circuit inductance used were from 26 to 800 μH. This relatively high circuit inductance gave circuit rise times less than 180 MA s -1 , slow with respect to many other exploding wire studies. Discharge duration ranged from 0.8 to 10 ms. (author)
Ferromagnetic artificial pinning centers in multifilamentary superconducting wires
International Nuclear Information System (INIS)
Wang, J.Q.; Rizzo, N.D.; Prober, D.E.
1997-01-01
The authors fabricated multifilamentary NbTi wires with ferromagnetic (FM) artificial pinning centers (APCs) to enhance the critical current density (J c ) in magnetic fields. They used a bundle and draw technique to process the APC wires with either Ni or Fe as the pinning centers. Both wires produced higher J c in the high field range (5-9 T) than previous non-magnetic APC wires similarly processed, even though the authors have not yet optimized pin percentage. Using a magnetometer they found that the pins remained ferromagnetic for the wires with maximum J c . However, they did observe a substantial loss of FM material for the wires where the pin diameter approached 3 nm. Thus, they expect further enhancement of J c with better pin quality
Ultrahigh-strength submicron-sized metallic glass wires
International Nuclear Information System (INIS)
Wang, Y.B.; Lee, C.C.; Yi, J.; An, X.H.; Pan, M.X.; Xie, K.Y.; Liao, X.Z.; Cairney, J.M.; Ringer, S.P.; Wang, W.H.
2014-01-01
In situ deformation experiments were performed in a transmission electron microscope to investigate the mechanical properties of submicron-sized Pd 40 Cu 30 Ni 10 P 20 metallic glass (MG) wires. Results show that the submicron-sized MG wires exhibit intrinsic ultrahigh tensile strength of ∼2.8 GPa, which is nearly twice as high as that in their bulk counterpart, and ∼5% elastic strain approaching the elastic limits. The tensile strength, engineering strain at failure and deformation mode of the submicron-sized MG wires depend on the diameter of the wires
The status of commercial and developmental HTS wires
Energy Technology Data Exchange (ETDEWEB)
Masur, L.J.; Buczek, D.; Harley, E.; Kodenkandath, T.; Li, X.; Lynch, J.; Nguyen, N.; Rupich, M.; Schoop, U.; Scudiere, J.; Siegal, E.; Thieme, C.; Verebelyi, D.; Zhang, W.; Kellers, J
2003-10-15
This paper provides an update on the development, performance and application of first and second generation high temperature superconductor (HTS) wires fabricated at American Superconductor (AMSC). First generation, multifilamentary composite wire is available commercially today in different viable product forms. This conductor carries 140 x the current of copper of the same cross-section, and is robust enough to stand tough industrial requirements. Second generation HTS wires, having a coated conductor composite architecture, are under development today and achieved substantial progress recently. AMSC's first generation wire will continue as the workhorse of the industry for the next 3-4 years while AMSC's second generation coated conductor wire is on track to be reproducible, uniform, scalable, and low cost. This paper provides a product differentiation with a view on the application of HTS wire in the electric power sector. Basic engineering data is reviewed that shall aid the engineer in the selection of the HTS wire product.
Design and performance of a 2-D multi-wire position sensitive X-ray ...
Indian Academy of Sciences (India)
of an anode plane with 10 µm SS wires at 3 mm spacing and a pair of orthogonal cathode read- out planes with 25 µm SS .... The electron multiplication process in high electric field is one of the prominent char- acteristics of .... be tested by irradiating the detector with a beam of X-rays of uniform intensity per unit area, and ...
DEFF Research Database (Denmark)
Jepsen, Kim Sune Karrasch; Bertilsson, Margareta
2017-01-01
dimension of life science through a notion of public politics adopted from the political theory of John Dewey. We show how cochlear implantation engages different social imaginaries on the collective and individual levels and we suggest that users share an imaginary of being “wired to freedom” that involves...... new access to social life, continuous communicative challenges, common practices, and experiences. In looking at their lives as “wired to freedom,” we hope to promote a wider spectrum of civic participation in the benefit of future life science developments within and beyond the field of Cochlear...
Heat Transfer Analysis in Wire Bundles for Aerospace Vehicles
Rickman, S. L.; Iamello, C. J.
2016-01-01
Design of wiring for aerospace vehicles relies on an understanding of "ampacity" which refers to the current carrying capacity of wires, either, individually or in wire bundles. Designers rely on standards to derate allowable current flow to prevent exceedance of wire temperature limits due to resistive heat dissipation within the wires or wire bundles. These standards often add considerable margin and are based on empirical data. Commercial providers are taking an aggressive approach to wire sizing which challenges the conventional wisdom of the established standards. Thermal modelling of wire bundles may offer significant mass reduction in a system if the technique can be generalized to produce reliable temperature predictions for arbitrary bundle configurations. Thermal analysis has been applied to the problem of wire bundles wherein any or all of the wires within the bundle may carry current. Wire bundles present analytical challenges because the heat transfer path from conductors internal to the bundle is tortuous, relying on internal radiation and thermal interface conductance to move the heat from within the bundle to the external jacket where it can be carried away by convective and radiative heat transfer. The problem is further complicated by the dependence of wire electrical resistivity on temperature. Reduced heat transfer out of the bundle leads to higher conductor temperatures and, hence, increased resistive heat dissipation. Development of a generalized wire bundle thermal model is presented and compared with test data. The steady state heat balance for a single wire is derived and extended to the bundle configuration. The generalized model includes the effects of temperature varying resistance, internal radiation and thermal interface conductance, external radiation and temperature varying convective relief from the free surface. The sensitivity of the response to uncertainties in key model parameters is explored using Monte Carlo analysis.
Thermosonic wire bonding of gold wire onto copper pad using the saturated interfacial phenomena
Jeng, Yeau-Ren; Aoh, Jong-Hing; Wang, Chang-Ming
2001-12-01
Copper has been used to replace conventional aluminium interconnection to improve the performance of deep submicron integrated circuits. This study used the saturated interfacial phenomena found in thermosonic ball bonding of gold wire onto aluminium pad to investigate thermosonic ball bonding of gold wire onto copper pad. The effects of preheat temperatures and ultrasonic powers on the bonding force were investigated by using a thermosonic bonding machine and a shear tester. This work shows that under proper preheat temperatures, the bonding force of thermosonic wire bonding can be explained based on interfacial microcontact phenomena such as energy intensity, interfacial temperature and real contact area. It is clearly shown that as the energy intensity is increased, the shear force increases, reaches a maximum, and then decreases. After saturation, i.e. the establishment of maximum atomic bonding, any type of additional energy input will damage the bonding, decreasing the shear force. If the preheat temperature is not within the proper range, the interfacial saturation phenomenon does not exist. For a preload of 0.5 N and a welding time of 15 ms in thermosonic wire bonding of gold wire onto copper pads, a maximum shear force of about 0.33 N is found where the interfacial energy intensity equals 1.8×106 J m-2 for preheat temperatures of 150°C and 170°C. Moreover, the corresponding optimal ultrasonic power is about 110 units.
Huneycutt, Bryan L.
2005-01-01
This document presents an interference mitigation technique using the active spaceborne sensor SAR3 antenna in the Earth Exploration-Satellite Service (active) and Space Research Service (active) for use in a 500 MHz bandwidth near 9.6 GHz. The purpose of the document is present antenna designs which offer lower sidelobes and faster rolloff in the sidelobes which in turn mitigates the interference to other services from the EESS (active) and SRS (active) sensors.
Wire scanner software and firmware issues
International Nuclear Information System (INIS)
Gilpatrick, John Doug
2008-01-01
The Los Alamos Neutron Science Center facility presently has 110 slow wire scanning profile measurement instruments located along its various beam lines. These wire scanners were developed and have been operating for at least 30 years. While the wire scanners solved many problems to operate and have served the facility well they have increasingly suffered from several problems or limitations, such as maintenance and reliability problems, antiquated components, slow data acquisition, and etc. In order to refurbish these devices, these wire scanners will be replaced with newer versions. The replacement will consist of a completely new beam line actuator, new cables, new electronics and brand new software and firmware. This note describes the functions and modes of operation that LabVIEW VI software on the real time controller and FPGA LabVIEW firmware will be required. It will be especially interesting to understand the overall architecture of these LabVIEW VIs. While this note will endeavor to describe all of the requirements and issues for the wire scanners, undoubtedly, there will be missing details that will be added as time progresses.
The intrarenal distribution of 125I-albumin in the syrian hamster
International Nuclear Information System (INIS)
Moeller, P.
1977-01-01
The intrarenal distribution of radioiodinated human serum albumin ( 125 RISA) after intravenous injection was studied in Syrian hamsters by scintillation counting and frozen section autoradiogrpahy. After 15, 30, and 60 min the virtual plasma albumin space in the renal cortex of the hamster represented 6.49, 7.13, and 8.06% respectively of the kidney tissue volume. From the cortex to the renal papilla the albumin space increased to about 30% of the tissue volume. In comparison to this the albumin space in the renal cortex of the rat was about 20%, and in the renal papilla about 33% (11). Frozen section autoradiography indicated that the distribution of radioalbumin in the renal cortex if the Syrian hamster is limited mainly to the kidney vessels, being especially noticeable in the glomerular capillaries. Toward the papilla increasingly greater (mainly extratubular) activity could be observed not only intravascularly but also interstitially. In the cortex of the rat kidney, on the other hand, radioactive albumin was accumulated (probably by filtration and reabsorption) predominantly in the proximal tubular epithelium. Within 30 min the kidneys of the rat excreted more than 10 times as much 125 I than the hamster kidneys. These results (substantially less cortical accumulation and urinary excretion of radioalbumin in the Syrian hamster) indicate that, in contrast to the rat, obviously much less albumin is filtered (and then accumulated by proximal reabsorption) by the Syrian hamster glomeruli. This suggests that the Syrian hamster kidney is more suitable than the rat kidney for determining the interstitial, cortical, albumin space. (orig./AJ) [de
Technical innovation: Wire guided ductography
International Nuclear Information System (INIS)
Aslam, Muhammad Ovais; Ramadan, Salwa; Al-Adwani, Muneera
2012-01-01
To introduce an easy and improved technique for performing ductography using inexpensive easily available intravenous cannula. Guide wire: Prolene/Surgipro 3-0 (Polypropylene mono filament non-absorbable surgical suture). A plastic 26 G intravenous cannula. Disposable syringe 2 ml. Non-ionic contrast (low density like Omnipaque 240 mg I/I). The guide wire (Prolene 3-0) is introduced into the orifice of the duct heaving discharge and 26 G intravenous plastic cannula is then passed over the guide wire. The cannula is advanced in the duct over guide wire by spinning around it. When the cannula is in place the guide wire is removed. Any air bubbles present in the hub of the cannula can be displaced by filling the hub from bottom upwards with needle attached to contrast filled syringe. 0.2–0.4 ml non-ionic contrast is gently injected. Injection is stopped if the patient has pain or burning. Magnified cranio-caudal view is obtained with cannula tapped in place and gentle compression is applied with the patient sitting. If duct filling is satisfactory a 90* lateral view is obtained. A successful adaptation of the technique for performing ductography is presented. The materials required for the technique are easily available in most radiology departments and are inexpensive, thus making the procedure comfortable for the patient and radiologist with considerable cost effectiveness.
Metallurgical investigation of wire breakage of tyre bead grade
Directory of Open Access Journals (Sweden)
Piyas Palit
2015-10-01
Full Text Available Tyre bead grade wire is used for tyre making application. The wire is used as reinforcement inside the polymer of tyre. The wire is available in different size/section such as 1.6–0.80 mm thin Cu coated wire. During tyre making operation at tyre manufacturer company, wire failed frequently. In this present study, different broken/defective wire samples were collected from wire mill for detailed investigation of the defect. The natures of the defects were localized and similar in nature. The fracture surface was of finger nail type. Crow feet like defects including button like surface abnormalities were also observed on the broken wire samples. The defect was studied at different directions under microscope. Different advanced metallographic techniques have been used for detail investigation. The analysis revealed that, white layer of surface martensite was formed and it caused the final breakage of wire. In this present study we have also discussed about the possible reason for the formation of such kind of surface martensite (hard-phase.
IEE wiring regulations explained and illustrated
Scaddan, Brian
2013-01-01
The IEE Wiring Regulations Explained and Illustrated, Second Edition discusses the recommendations of the IEE Regulations for the Electrical Equipment of Buildings for the safe selection or erection of wiring installations. The book emphasizes earthing, bonding, protection, and circuit design of electrical wirings. The text reviews the fundamental requirements for safety, earthing systems, the earth fault loop impedance, and supplementary bonding. The book also describes the different types of protection, such as protection against mechanical damage, overcurrent, under voltage (which prevents
International Nuclear Information System (INIS)
Zhu Huanxing; Yang Yongqing
2003-01-01
Objective: To investigate the diagnostic value of determination of serum and ascitic fluid AFP, CEA and CA125 contents for differentiating benign from malignant ascites. Methods: Serum and ascitic fluid contents of the three tumor markers were measured with RIA in 86 patients with ascites due to various causes. Results: The serum and ascitic fluid AFP, CEA and CA125 levels in patients with malignant ascites were very significantly higher than those in patients with benign ascites (p<0.01). For differentiation of benign (mainly T.B and liver cirrhosis) from malignant ascites, CA125≥500 IU/ml and AFP≥300 ng/ml could be taken as the critical value with high specificity and accuracy. Conclusion: Determinations of the three tumor markers levels in serum and ascitic fluid were of high value for differential diagnosis of the etiology of ascites
Papadimitropoulos, G; Davazoglou, D
2011-09-01
In this work we study the hot-wire chemical vapor deposition (HWCVD) of copper films on blanket and patterned substrates at high filament temperatures. A vertical chemical vapor deposition reactor was used in which the chemical reactions were assisted by a tungsten filament heated at 650 degrees C. Hexafluoroacetylacetonate Cu(I) trimethylvinylsilane (CupraSelect) vapors were used, directly injected into the reactor with the aid of a liquid injection system using N2 as carrier gas. Copper thin films grown also by thermal and hot-wire CVD. The substrates used were oxidized silicon wafers on which trenches with dimensions of the order of 500 nm were formed and subsequently covered with LPCVD W. HWCVD copper thin films grown at filament temperature of 650 degrees C showed higher growth rates compared to the thermally ones. They also exhibited higher resistivities than thermal and HWCVD films grown at lower filament temperatures. Thermally grown Cu films have very uniform deposition leading to full coverage of the patterned substrates while the HWCVD films exhibited a tendency to vertical growth, thereby creating gaps and incomplete step coverage.
Kudtarkar, Santosh Anil
Microelectronics technology has been undergoing continuous scaling to accommodate customer driven demand for smaller, faster and cheaper products. This demand has been satisfied by using novel materials, design techniques and processes. This results in challenges for the chip connection technology and also the package technology. The focus of this research endeavor was restricted to wire bond interconnect technology using gold bonding wires. Wire bond technology is often regarded as a simple first level interconnection technique. In reality, however, this is a complex process that requires a thorough understanding of the interactions between the design, material and process variables, and their impact on the reliability of the bond formed during this process. This research endeavor primarily focused on low diameter, 0.8 mil thick (20 mum) diameter gold bonding wire. Within the scope of this research, the integrity of the ball bond formed by 1.0 mil (25 mum) and 0.8 mil (20 mum) diameter wires was compared. This was followed by the evaluation of bonds formed on bond pads having doped SiO2 (low k) as underlying structures. In addition, the effect of varying the percentage of the wire dopant, palladium and bonding process parameters (bonding force, bond time, ultrasonic energy) for 0.8 mil (20 mum) bonding wire was also evaluated. Finally, a degradation empirical model was developed to understand the decrease in the wire strength. This research effort helped to develop a fundamental understanding of the various factors affecting the reliability of a ball bond from a design (low diameter bonding wire), material (low k and bonding wire dopants), and process (wire bonding process parameters) perspective for a first level interconnection technique, namely wire bonding. The significance of this research endeavor was the systematic investigation of the ball bonds formed using 0.8 mil (20 microm) gold bonding wire within the wire bonding arena. This research addressed low k
Pretinning Nickel-Plated Wire Shields
Igawa, J. A.
1985-01-01
Nickel-plated copper shielding for wires pretinned for subsequent soldering with help of activated rosin flux. Shield cut at point 0.25 to 0.375 in. (6 to 10 mm) from cut end of outer jacket. Loosened end of shield straightened and pulled toward cut end. Insulation of inner wires kept intact during pretinning.
Supplemental Analysis Survey of C&P Telephone Inside Wiring.
1986-10-01
telephone company facilities in 1984. In 1985, among other actions favorable to deregulation and detariffing of inside wiring, the FCC proposed to detariff ...installation of inside wiring, detariff the maintenance of all inside wiring, treat all inside wiring as customer premise equipment and pass ownership...85-148, 50 Fed. let. 13991 (April 9, 1985), pToposing to detariff the installation of simple inside wiring and also to detariff the maintenance of all
Nano-powder production by electrical explosion of wires
International Nuclear Information System (INIS)
Mao Zhiguo; Zou Xiaobing; Wang Xinxin; Jiang Weihua
2010-01-01
A device for nano-powder production by electrical explosion of wires was designed and built. Eight wires housed in the discharge chamber are exploded one by one before opening the chamber for the collection of the produced nano-powder. To increase the rate of energy deposition into a wire, the electrical behavior of the discharge circuit including the exploding wire was simulated. The results showed that both reducing the circuit inductance and reducing the capacitance of the energy-storage capacitor (keeping the storage energy constant) can increase the energy deposition rate. To better understand the physical processes of the nano-powder formation by the wire vapor, a Mach-Zehnder interferometer was used to record the time evolution of the wire vapor as well as the plasma. A thermal expansion lag of the dense vapor core as well as more than one times of the vapor burst was observed for the first time. Finally, nano-powders of titanium nitride, titanium dioxide, copper oxides and zinc oxide were produced by electrical explosion of wires. (authors)
Energy Technology Data Exchange (ETDEWEB)
Sakai, Yukio
1987-12-25
The rate of combustion of the mixture of methane and air under a constant atmospheric pressure was determined using a soap bubble and a hot-wire anemometer. The flame propagation velocity, Ss, of the specified ratio of mixed gas confined in a soap bubble regarded as a transparent vessel was recorded using the multi-exposurement schlieren method by igniting the gas at the centre of bubble. The velocity of mixed gas, Sg, in front of the flame was measured by the hot-wire anemometer installed in the soap bubble to obtain the rate of combustion Su (Ss-Sg). The maximum Su was 45 cm/s obtained at the ratio of equivalent amounts of 1.08, which agreed with the theoretical value of one-dimensional flame. This is because the measuring method accords with the definition of rate of combustion. Su was 12.5 and 11.0 cm/s at the ratio of equivalent amounts of 0.6 and 1.6, respectively. The measurements by this method considerably agreed with those by conventional similar methods and other high-accuracy methods. The method is applicable accurately to various combustible mixed gas. (6 figs, 1 tab, 18 refs)
International Nuclear Information System (INIS)
Srinivasan, G.; Arivazhagan, B.; Albert, S.K.; Bhaduri, A.K.
2010-01-01
Indigenous development of reduced activation ferritic-martensitic (RAFM) steel has become necessary for India as a participant in the International Thermo-nuclear Experimental Reactor (ITER) programme. Optimisation of RAFM steel is in an advanced stage for the fabrication of test blanket module (TBM) components. Simultaneously, development of RAFM steel filler wires has been undertaken since there is no commercial filler wires are available for fabrication of components using RAFM steel. The purpose of this study is to develop filler wires that can be directly used for both gas tungsten arc welding (GTAW) and for narrow-gap gas tungsten arc welding (NG-GTAW) that reduces the deposited weld metal volume and heat affected zone (HAZ) width. Further, the filler wires would also be used for hybrid laser-MIG welding for thick section joints. In view of meeting all the requirements, a detailed specification was prepared for the development of filler wires for welding of RAFM steel. Meanwhile, welding trials have been carried out on 2.5 mm thick plates of the RAFM steel using GTAW process at various heat inputs with a preheat temperature of 250 C followed by various post weld heat treatments (PWHT). The microstructure of the weld metal in most of the cases showed the presence of some amount of delta-ferrite. Filler wires as per specifications have also been developed with minor variations on the chemistry against the specified values. Welding parameters and PWHT parameters were optimized to qualify the filler wires without the presence of delta-ferrite in the weld metal and with optimized mechanical properties. Results showed that the weld metals are free from delta-ferrite. Tensile properties at ambient temperature and at 500 C are well above the specified values, and are much higher than the base metal values. Ductile Brittle Transition Temperature (DBTT) has been evaluated as -81 C based on the 68 J criteria. The present study highlights the basis and methodology
Wire-rope emplacement of diagnostics systems
International Nuclear Information System (INIS)
Burden, W.L.
1982-01-01
The study reported here was initiated to determine if, with the Cable Downhole System (CDS) currently under development, there is an advantage to using continuous wire rope to lower the emplacement package to the bottom of the hole. A baseline design using two wire ropes as well as several alternatives are discussed in this report. It was concluded that the advantages of the wire-rope emplacement system do not justify the cost of converting to such a system, especially for LLNL's maximum emplacement package weights
Processing of flexible high-Tc superconducting wires
International Nuclear Information System (INIS)
Lee, B.I.; Modi, V.
1989-01-01
Wires superconducting at temperatures above 77 K are produced by using YBa 2 Cu 3 O 7 materials. Flexibility was obtained by support from prefabricated fibers or a metallic coating on the extruded YBa 2 Cu 3 O 7 wires. The microstructure, the T c and the critical current densities of the wires were determined. Processing variables and steps are described
Experimental investigation of industrial copper deformed by wire ...
African Journals Online (AJOL)
drawing on microstructure and physical properties of industrial copper wires. Copper wires were provided by E.N.I.CA.Biskra (Algeria). We investigated some wires with different strain levels (as received, 1.20, 2.10, and ε = 3.35).
Magnetic anisotropy and anisotropic ballistic conductance of thin magnetic wires
International Nuclear Information System (INIS)
Sabirianov, R.
2006-01-01
The magnetocrystalline anisotropy of thin magnetic wires of iron and cobalt is quite different from the bulk phases. The spin moment of monatomic Fe wire may be as high as 3.4 μ B , while the orbital moment as high as 0.5 μ B . The magnetocrystalline anisotropy energy (MAE) was calculated for wires up to 0.6 nm in diameter starting from monatomic wire and adding consecutive shells for thicker wires. I observe that Fe wires exhibit the change sign with the stress applied along the wire. It means that easy axis may change from the direction along the wire to perpendicular to the wire. We find that ballistic conductance of the wire depends on the direction of the applied magnetic field, i.e. shows anisotropic ballistic magnetoresistance. This effect occurs due to the symmetry dependence of the splitting of degenerate bands in the applied field which changes the number of bands crossing the Fermi level. We find that the ballistic conductance changes with applied stress. Even for thicker wires the ballistic conductance changes by factor 2 on moderate tensile stain in our 5x4 model wire. Thus, the ballistic conductance of magnetic wires changes in the applied field due to the magnetostriction. This effect can be observed as large anisotropic BMR in the experiment
Induced Voltage in an Open Wire
Morawetz, K.; Gilbert, M.; Trupp, A.
2017-07-01
A puzzle arising from Faraday's law has been considered and solved concerning the question which voltage will be induced in an open wire with a time-varying homogeneous magnetic field. In contrast to closed wires where the voltage is determined by the time variance of the magnetic field and the enclosed area, in an open wire we have to integrate the electric field along the wire. It is found that the longitudinal electric field with respect to the wave vector contributes with 1/3 and the transverse field with 2/3 to the induced voltage. In order to find the electric fields the sources of the magnetic fields are necessary to know. The representation of a spatially homogeneous and time-varying magnetic field implies unavoidably a certain symmetry point or symmetry line which depend on the geometry of the source. As a consequence the induced voltage of an open wire is found to be the area covered with respect to this symmetry line or point perpendicular to the magnetic field. This in turn allows to find the symmetry points of a magnetic field source by measuring the voltage of an open wire placed with different angles in the magnetic field. We present exactly solvable models of the Maxwell equations for a symmetry point and for a symmetry line, respectively. The results are applicable to open circuit problems like corrosion and for astrophysical applications.
Energy Technology Data Exchange (ETDEWEB)
None
2012-01-01
REACT Project: The University of Houston will develop a low-cost, high-current superconducting wire that could be used in high-power wind generators. Superconducting wire currently transports 600 times more electric current than a similarly sized copper wire, but is significantly more expensive. The University of Houston’s innovation is based on engineering nanoscale defects in the superconducting film. This could quadruple the current relative to today’s superconducting wires, supporting the same amount of current using 25% of the material. This would make wind generators lighter, more powerful and more efficient. The design could result in a several-fold reduction in wire costs and enable their commercial viability of high-power wind generators for use in offshore applications.
EVALUATION OF INDUCTANCE WITH ELECTRICAL WIRES
Directory of Open Access Journals (Sweden)
V. Kudry
2016-08-01
Full Text Available In this paper proved the possibility of developing passive electronic inductive elements based replace metal wire that is wound inductor, the wire is made of electret. The relative permeability of the electret S 10 000, several orders of magnitude greater than the permeability of conventional insulation materials, i < 10, resulting current in the wire acquires properties bias current. The essence of innovation is to replace the source of of magnetic induction flow that pervades the core of the coil. According to the theory of electrodynamics, current bias, in contrast to conduction current, generated no movement of charge along the wire, but the change of the charge in the local volume.Equivalence bias current and conduction current is manifested in the possibility of forming a magnetic field. The flow through magnetic induction coil core regardless of the current it generates, creates voltage at its ends.The paper also shows the numeric characteristics that determine the effective frequency range, specified the reason why electric a wire with і < 10 can not generate magnetic flux through the core and serve as a passive reactive component.
Development of environmental-friendly wire and cable
International Nuclear Information System (INIS)
Ueno, Keiji
1996-01-01
The electron beam technology has been used in many industrial fields as a method of conventional polymer modification or optimum processability. The main industrial fields of radiation crosslinking are wire and cable, heat shrinkable tubings, plastic foams, precuring of tires, floppy disk curing, foods packaging films, and so on. The radiation crosslinking of wire and cable was started in 1961 in Japan and 15 wire and cable companies are now using electron beam accelerators for production or R and D. The dominant characteristics of crosslinking of insulation materials are application at high temperature, good oil and chemical resistibility and high mechanical properties. These radiation crosslinking wire and cable are applied widely in electronics equipments and automobiles. Recently, electronics manufacturers have indicated deep concern over the effects on the environment. Wire and cable also are required to be applicable for environmental preservation. (J.P.N.)
t matrix of metallic wire structures
International Nuclear Information System (INIS)
Zhan, T. R.; Chui, S. T.
2014-01-01
To study the electromagnetic resonance and scattering properties of complex structures of which metallic wire structures are constituents within multiple scattering theory, the t matrix of individual structures is needed. We have recently developed a rigorous and numerically efficient equivalent circuit theory in which retardation effects are taken into account for metallic wire structures. Here, we show how the t matrix can be calculated analytically within this theory. We illustrate our method with the example of split ring resonators. The density of states and cross sections for scattering and absorption are calculated, which are shown to be remarkably enhanced at resonant frequencies. The t matrix serves as the basic building block to evaluate the interaction of wire structures within the framework of multiple scattering theory. This will open the door to efficient design and optimization of assembly of wire structures
Design and Analysis of a Bio-Inspired Wire-Driven Multi-Section Flexible Robot
Directory of Open Access Journals (Sweden)
Zheng Li
2013-04-01
Full Text Available This paper presents a bio-inspired wire-driven multi-section flexible robot. It is inspired by the snake skeleton and octopus arm muscle arrangements. The robot consists of three sections and each section is made up of several identical vertebras, which are articulated by both spherical joints and a flexible backbone. Each section is driven by two groups of wires, controlling the bending motion in X and Y directions. This design integrates the serpentine robots' structure and the continuum robots' actuation. As a result, it is more compact than traditional serpentine robots and has a higher positioning accuracy than typical continuum soft robots, such as OctArm V. A Kinematics model and a workspace model of the robot are developed based on the piece wise constant curvature assumption. To evaluate the design, a prototype is built and experiments are carried out. The average distal end positioning error is less than 4%. Characteristics of the wire-driven robot are also discussed, including the leverage effect and the manipulability under constraint. These features makes the proposed robot well suited to confined spaces, especially for working in minimally invasive surgery, nuclear reactor pipelines, disaster debris, etc.
Welding wires for high-tensile steels
International Nuclear Information System (INIS)
Laz'ko, V.E.; Starova, L.L.; Koval'chuk, V.G.; Maksimovich, T.L.; Labzina, I.E.; Yadrov, V.M.
1993-01-01
Strength of welded joints in arc welding of high-tensile steels of mean and high thickness by welding wires is equal to approximately 1300 MPa in thermohardened state and approximately 600 MPa without heat treatment. Sv-15Kh2NMTsRA-VI (EhK44-VI) -Sv-30Kh2NMTsRA-VI (EkK47-VI) welding wires are suggested for welding of medium-carbon alloyed steels. These wires provide monotonous growth of ultimate strength of weld metal in 1250-1900 MPa range with increase of C content in heat-treated state
Corrosion fatigue behaviors of steel wires used in coalmine
International Nuclear Information System (INIS)
Wang, Songquan; Zhang, Dekun; Chen, Kai; Xu, Linmin; Ge, Shirong
2014-01-01
Highlights: • The CF life of steel wire in acid solution is the shortest. • The fatigue source zone showed dimple morphology when coupled with anode potential. • The area of dimple increases with the increase of the applied anode potential. • The strong cathode potential cannot reduce the CF life of the smooth steel wire. • The hydrogen impacted mainly on the plastic deformation of the wire surface. - Abstract: The corrosion fatigue (CF) behaviors of the mining steel wire in different solutions at different applied polarization potentials were investigated in this paper. The surfaces and fracture morphologies of the steel wire at different applied potentials were observed by scanning electron microscope (SEM). The results showed that the CF life of steel wire in acid solution is the shortest. Moreover, the strong anodic polarization potential greatly reduced the CF life of steel wire, while the strong cathode potential did not reduce the CF life. For the smooth steel wire, the hydrogen impacted mainly on the plastic deformation of the wire surface. There was obvious dimple in the fatigue source zone of the wire when coupled with anode potential, and the area of the dimple increased with the increase of the applied anode potential. Conversely, the fatigue source zone of the fracture was relatively smooth at cathode polarization potential, which indicated that the crack propagation followed the mechanism of hydrogen induced cracking
Homogenous BSCCO-2212 Round Wires for Very High Field Magnets
International Nuclear Information System (INIS)
Campbell, Scott; Holesinger, Terry; Huang, Ybing
2012-01-01
of an extremely high H c2 . For this reason, Bi 2 Sr 2 CaCu 2 O y (Bi-2212, or 2212) in the form of a multifilamentary Ag alloy matrix composite is beginning to attract the interest of the magnet community for future extremely high-field magnets or magnet-insert coils for 4.2K operation. Fig. 1 shows an example of excellent JE (engineering current density) in Bi-2212 round wire at fields up to 45 T, demonstrating the potential for high field applications of this material. For comparison, the Nb 3 Sn wires used in magnets in the 16-18 T range typically perform with J E in the range 200-500 A/mm 2 ; the Bi-2212 wire retains this level of performance to fields at least as high as 45 T, and probably significantly higher. Bi-2212 conductors have in fact been used to generate a 25 T field in a superconducting insert magnet. These two factors- the very high field critical current performance of Bi-2212, and the already demonstrated capability of this material for high field magnets up to 25 T, strongly suggest this material as a leading contender for the next generation high field superconducting (HFS) wire. This potential was recognized by the US Academy of Science's Committee on Opportunities in High Magnetic Field Science. Their report of the same name specifically calls out the high field potential for this material, and suggests that 30 T magnets appear feasible based on the performance of 2212. There are several requirements for HFS conductors. The most obvious is J E (B, T), the engineering current density at the field and temperature of operation. As shown in Fig. 1, Bi-2212 excels in this regard. Stability requirements for magnets dictate that the effective filament diameter should be less than 30 micrometers, something that Bi-2212 multifilamentary wire can uniquely satisfy among the HFS superconducting wire technologies. Additional requirements include mechanical properties that prevent stress limitation of J E at the operating conditions, resistive transition
LANSCE wire scanning diagnostics device mechanical design
International Nuclear Information System (INIS)
Rodriguez Esparza, Sergio
2010-01-01
The Los Alamos Neutron Science Center (LANSCE) is one of the major experimental science facilities at the Los Alamos National Laboratory (LANL). The core of LANSCE's work lies in the operation of a powerful linear accelerator, which accelerates protons up to 84% the speed oflight. These protons are used for a variety of purposes, including materials testing, weapons research and isotopes production. To assist in guiding the proton beam, a series of over one hundred wire scanners are used to measure the beam profile at various locations along the half-mile length of the particle accelerator. A wire scanner is an electro-mechanical device that moves a set of wires through a particle beam and measures the secondary emissions from the resulting beam-wire interaction to obtain beam intensity information. When supplemented with data from a position sensor, this information is used to determine the cross-sectional profile of the beam. This measurement allows beam operators to adjust parameters such as acceleration, beam steering, and focus to ensure that the beam reaches its destination as effectively as possible. Some of the current wire scanners are nearly forty years old and are becoming obsolete. The problem with current wire scanners comes in the difficulty of maintenance and reliability. The designs of these wire scanners vary making it difficult to keep spare parts that would work on all designs. Also many of the components are custom built or out-dated technology and are no longer in production.
LANSCE wire scanning diagnostics device mechanical design
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Esparza, Sergio [Los Alamos National Laboratory
2010-01-01
The Los Alamos Neutron Science Center (LANSCE) is one of the major experimental science facilities at the Los Alamos National Laboratory (LANL). The core of LANSCE's work lies in the operation of a powerful linear accelerator, which accelerates protons up to 84% the speed oflight. These protons are used for a variety of purposes, including materials testing, weapons research and isotopes production. To assist in guiding the proton beam, a series of over one hundred wire scanners are used to measure the beam profile at various locations along the half-mile length of the particle accelerator. A wire scanner is an electro-mechanical device that moves a set of wires through a particle beam and measures the secondary emissions from the resulting beam-wire interaction to obtain beam intensity information. When supplemented with data from a position sensor, this information is used to determine the cross-sectional profile of the beam. This measurement allows beam operators to adjust parameters such as acceleration, beam steering, and focus to ensure that the beam reaches its destination as effectively as possible. Some of the current wire scanners are nearly forty years old and are becoming obsolete. The problem with current wire scanners comes in the difficulty of maintenance and reliability. The designs of these wire scanners vary making it difficult to keep spare parts that would work on all designs. Also many of the components are custom built or out-dated technology and are no longer in production.
New crosslinked polyvinyl chloride insulated wire by electron beam irradiation
International Nuclear Information System (INIS)
Takahata, Norio; Shingyouchi, Kazuo; Sato, Masakatsu; Sasaki, Hidemi; Terunuma, Haruji
1978-01-01
The polyvinyl chloride-coated wires crosslinked by electron beam irradiation have made rapid progress as electric and electronic wiring material and grown to hold a firm position in this field. In response to the requirements for wires with the advance of electronic equipments, Hitachi Cable Ltd. developed a peculiar graft polymer consisting of chlorinated polyethylene and polyvinyl chloride. To this polymer, the characteristics of a very wide range from toughness to flexibility can be given, and the crosslinked polyvinyl chloride wires utilizing these characteristics were put in practical use. Many kinds of the wires were developed as follows; 105 deg. C rating crosslinked vinyl-coated wires authorized by UL and CSA standards, crosslinked vinyl-coated wires with excellent flexibility, high strength crosslinked vinyl-coated wires with thin coating and crosslinked vinyl-coated wires for automobiles. They are expected to be developed into other new fields and applications. (Kobatake, H.)
2011-02-23
... Airworthiness Directives; Thielert Aircraft Engines GmbH Models TAE 125-02-99 and TAE 125-02-114 Reciprocating... TAE 125-02-99 and TAE 125-02-114 reciprocating engines installed in, but not limited to, Cessna 172... occurs later. Repetitive Replacements of Timing Chains for All TAE 125-02-99 and TAE 125-02-114 Engines...
2011-10-18
... Engines GmbH (TAE) Models TAE 125-02-99 and TAE 125-01 Reciprocating Engines AGENCY: Federal Aviation... substance. But we have found it necessary to reduce the initial compliance time for TAE 125-02-99 engines... about 370 TAE 125-01 and TAE 125-02-99 reciprocating engines installed on products of U.S. registry. We...
CSIR Research Space (South Africa)
Lysko, AA
2009-06-01
Full Text Available The paper introduces a method to cover several wire segments with a single basis function, describes related practical algorithms, and gives some results. The process involves three steps: identifying chains of wire segments, splitting the chains...
The magnetoresistance of sub-micron Fe wires
Blundell, S. J.; Shearwood, C.; Gester, M.; Baird, M. J.; Bland, J. A. C.; Ahmed, H.
1994-07-01
A novel combination of electron- and ion-beam lithography has been used to prepare Fe gratings with wire widths of 0.5 μm and wire separations in the range 0.5-4 μm from an Fe/GaAs (001) film of thickness 25 nm. With an in-plane magnetic field applied perpendicular to the length of the wires, a harder magnetisation loop is observed using the magneto-optic Kerr effect (MOKE), compared with that observed in the unprocessed film. We observe a strong effect in the magnetoresistance (MR) when the magnetic field is applied transverse to the wires. It is believed that this effect originates from the highly non-uniform demagnetising field in each wire of the grating. These results demonstrate that the combination of MOKE and MR measurements can provide important information about the magnetisation reversal processes in magnetic gratings and can be used to understand the effect of shape anisotropy on magnetic properties.
Flywheel system using wire-wound rotor
Chiao, Edward Young; Bender, Donald Arthur; Means, Andrew E.; Snyder, Philip K.
2016-06-07
A flywheel is described having a rotor constructed of wire wound onto a central form. The wire is prestressed, thus mitigating stresses that occur during operation. In another aspect, the flywheel incorporates a low-loss motor using electrically non-conducting permanent magnets.
Minimally invasive tension band wiring technique for olecranon fractures.
Takada, Naoya; Kato, Kenji; Fukuta, Makoto; Wada, Ikuo; Otsuka, Takanobu
2013-12-01
Some types of implants, such as plates, screws, wires, and nails, have been used for open reduction and internal fixation of olecranon fractures. A ≥ 10 cm longitudinal incision is used for open reduction and internal fixation of olecranon fractures. According to previous studies, tension band wiring is a popular method that gives good results. However, back out of the wires after the surgery is one of the main postoperative complications. Moreover, if the Kirschner wires are inserted through the anterior ulnar cortex, they may impinge on the radial neck, supinator muscle, or biceps tendon. Herein, we describe the minimally invasive tension band wiring technique using Ring-Pin. This technique can be performed through a 2 cm incision. Small skin incisions are advantageous from an esthetic viewpoint. Ring-Pin was fixed by using a dedicated cable wire that does not back out unless the cable wire breaks or slips out of the dedicated metallic clamp. As the pins are placed in intramedullary canal, this technique does not lead to postoperative complications that may occur after transcortical fixation by conventional tension band wiring. Minimally invasive tension band wiring is one of the useful options for the treatment of olecranon fractures with some advantages.
International Nuclear Information System (INIS)
Chernenko, A.S.; Smirnov, V.P.; Kingsep, A.S.
2004-01-01
On 'S-300' generator (700 kV, 4 MA, 70 ns) at the Kurchatov Institute, the experimental studies with multi-material wire array units are carried on aimed at creating the powerful X-ray source. The development of new diagnostic methods would definitely contribute to attain new data, which could help in explanation of X-ray emission mechanism of imploding multi-wire arrays that has not well understood yet. The experimental study of soft X-ray emission of different wire sets, different in both mass and composition, has been carried on in the same geometry. One of the purposes of these experiments was investigation of the wire array chemical composition influence on the implosion dynamics and stability. Study of the nested (cascade) liner dynamics shows that the minimal liner radius at the stagnation moment of time (2r ∼ 3 - 3.5 mm) recorded in the visible range by the streak camera fairly coincides with the outer diameter of the inner tungsten array of 4 mm. The same size is shown by the integral pinhole pictures obtained in the SXR range, without a filter. Unlike all these pictures, images obtained in the range E > 2 keV demonstrate the resulting state of Z-pinch in the form of a thin (∼ 0.2 mm) twisting filament. In addition, small space scales are typical of the liner pictures taken in the range of He- and H-like aluminum ions by means of a spectrograph. Thus, one may conclude that Al plasma of the outer liner passes into the inner space of the almost immovable W array where becomes trapped and compressed by the magnetic field. (author)
Angular response of hot wire probes
International Nuclear Information System (INIS)
Di Mare, L; Jelly, T O; Day, I J
2017-01-01
A new equation for the convective heat loss from the sensor of a hot-wire probe is derived which accounts for both the potential and the viscous parts of the flow past the prongs. The convective heat loss from the sensor is related to the far-field velocity by an expression containing a term representing the potential flow around the prongs, and a term representing their viscous effect. This latter term is absent in the response equations available in the literature but is essential in representing some features of the observed response of miniature hot-wire probes. The response equation contains only four parameters but it can reproduce, with great accuracy, the behaviour of commonly used single-wire probes. The response equation simplifies the calibration the angular response of rotated slanted hot-wire probes: only standard King’s law parameters and a Reynolds-dependent drag coefficient need to be determined. (paper)
Han, Ruoyu; Zhou, Haibin; Wu, Jiawei; Qiu, Aici; Ding, Weidong; Zhang, Yongmin
2017-09-01
An experimental study of pressure waves generated by an exploding copper wire in a water medium is performed. We examined the effects of energy deposited at different stages on the characteristics of the resulting shock waves. In the experiments, a microsecond time-scale pulsed current source was used to explode a 300-μm-diameter, 4-cm-long copper wire with initial stored energies ranging from 500 to 2700 J. Our experimental results indicated that the peak pressure (4.5-8.1 MPa) and energy (49-287 J) of the shock waves did not follow a simple relationship with any electrical parameters, such as peak voltage or deposited energy. Conversely, the impulse had a quasi-linear relationship with the parameter Π. We also found that the peak pressure was mainly influenced by the energy deposited before separation of the shock wave front and the discharge plasma channel (DPC). The decay time constant of the pressure waveform was affected by the energy injection after the separation. These phenomena clearly demonstrated that the deposited energy influenced the expansion of the DPC and affected the shock wave characteristics.
International Nuclear Information System (INIS)
Sato, Hiroyuki; Kobayashi, Jun; Miyakoshi, Hiroyuki; Kamide, Hideki
2009-01-01
A sodium cooled fast reactor is designed to attain a high burn-up core in a feasibility study on commercialized fast reactor cycle systems. In high burn-up fuel subassemblies, deformation of fuel pin due to the swelling and thermal bowing may decrease local flow velocity via change of flow area in the subassembly and influence the heat removal capability. Therefore, it is of importance to obtain the flow velocity distribution in a wire wrapped pin bundle. A 2.5 times enlarged 7-pin bundle water model was applied to investigate the detailed velocity distribution in an inner subchannel surrounded by 3 pins with wrapping wire. The test section consisted of a hexagonal acrylic duct tube and fluorinated resin pins which had nearly the same refractive index with that of water and a high light transmission rate. The velocity distribution in an inner subchannel with the wrapping wire was measured by PIV (Particle Image Velocimetry) through the front and lateral sides of the duct tube. In the vertical velocity distribution in a narrow space between the pins, the wrapping wire decreased the velocity downstream of the wire and asymmetric flow distribution was formed between the pin and wire. In the horizontal velocity distribution, swirl flow around the wrapping wire was obviously observed. The measured velocity data are useful for code validation of pin bundle thermalhydraulics. (author)
Atom chips in the real world: the effects of wire corrugation
Schumm, T.; Estève, J.; Figl, C.; Trebbia, J.-B.; Aussibal, C.; Nguyen, H.; Mailly, D.; Bouchoule, I.; Westbrook, C. I.; Aspect, A.
2005-02-01
We present a detailed model describing the effects of wire corrugation on the trapping potential experienced by a cloud of atoms above a current carrying micro wire. We calculate the distortion of the current distribution due to corrugation and then derive the corresponding roughness in the magnetic field above the wire. Scaling laws are derived for the roughness as a function of height above a ribbon shaped wire. We also present experimental data on micro wire traps using cold atoms which complement some previously published measurements [CITE] and which demonstrate that wire corrugation can satisfactorily explain our observations of atom cloud fragmentation above electroplated gold wires. Finally, we present measurements of the corrugation of new wires fabricated by electron beam lithography and evaporation of gold. These wires appear to be substantially smoother than electroplated wires.
Thermal Aware Floorplanning Incorporating Temperature Dependent Wire Delay Estimation
DEFF Research Database (Denmark)
Winther, AndreasThor; Liu, Wei; Nannarelli, Alberto
2015-01-01
Temperature has a negative impact on metal resistance and thus wire delay. In state-of-the-art VLSI circuits, large thermal gradients usually exist due to the uneven distribution of heat sources. The difference in wire temperature can lead to performance mismatch because wires of the same length...... can have different delay. Traditional floorplanning algorithms use wirelength to estimate wire performance. In this work, we show that this does not always produce a design with the shortest delay and we propose a floorplanning algorithm taking into account temperature dependent wire delay as one...
Steer-by-wire innovations and demonstrator
Lupker, H.A.; Zuurbier, J.; Verschuren, R.M.A.F.; Jansen, S.T.H.; Willemsen, D.M.C.
2002-01-01
Arguments for 'by-wire' systems include production costs, packaging and traffic safety. Innovations concern both product and development process e.g. combined virtual engineering and Hardware-in-the-loop testing. Three Steer-by-wire systems are discussed: a steering system simulator used as a
Study of corrosion behavior of carbon steel under seawater film using the wire beam electrode method
International Nuclear Information System (INIS)
Liu, Zaijian; Wang, Wei; Wang, Jia; Peng, Xin; Wang, Yanhua; Zhang, Penghui; Wang, Haijie; Gao, Congjie
2014-01-01
Corrosion behavior of carbon steel under seawater film with various thickness was investigated by the wire beam electrode (WBE) method. It was found that the corrosion rate of carbon steel increased significantly under thin seawater film than it was immersed in seawater. The current variation under seawater film indicated that the thickness of diffusion layer of oxygen was about 500 μm, and the maximal current appeared around 40 μm, at which corrosion rate transited from cathodic control to anodic control. The results suggest that WBE method is helpful to study the corrosion process under thin electrolyte film
Optimization of the Single Staggered Wire and Tube Heat Exchanger
Directory of Open Access Journals (Sweden)
Arsana I Made
2016-01-01
Full Text Available Wire and tube heat exchanger consists of a coiled tube, and wire is welded on the two sides of it in normal direction of the tube. Generally,wire and tube heat exchanger uses inline wire arrangement between the two sides, whereas in this study, it used staggered wire arrangement that reduces the restriction of convection heat transfer. This study performed the optimization of single staggered wire and tube heat exchanger to increase the capacity and reduce the mass of the heat exchanger. Optimization was conducted with the Hooke-Jeeves method, which aims to optimize the geometry of the heat exchanger, especially on the diameter (dw and the distance between wires (pw. The model developed to present heat transfer correlations on single staggered wire and tube heat exchanger was valid. The maximum optimization factor obtained when the diameter wire was 0.9 mm and the distance between wires (pw was 11 mm with the fref value = 1.5837. It means that the optimized design only using mass of 59,10 % and could transfer heat about 98,5 % from the basis design.
Radiofrequency Wire Recanalization of Chronically Thrombosed TIPS
Energy Technology Data Exchange (ETDEWEB)
Majdalany, Bill S., E-mail: bmajdala@med.umich.edu [University of Michigan Health System, Division of Interventional Radiology, Department of Radiology (United States); Elliott, Eric D., E-mail: eric.elliott@osumc.edu [The Ohio State University Wexner Medical Center, Division of Interventional Radiology, Department of Radiology (United States); Michaels, Anthony J., E-mail: Anthony.michaels@osumc.edu; Hanje, A. James, E-mail: James.Hanje@osumc.edu [The Ohio State University Wexner Medical Center, Division of Gastroenterology and Hepatology, Department of Medicine (United States); Saad, Wael E. A., E-mail: wsaad@med.umich.edu [University of Michigan Health System, Division of Interventional Radiology, Department of Radiology (United States)
2016-07-15
Radiofrequency (RF) guide wires have been applied to cardiac interventions, recanalization of central venous thromboses, and to cross biliary occlusions. Herein, the use of a RF wire technique to revise chronically occluded transjugular intrahepatic portosystemic shunts (TIPS) is described. In both cases, conventional TIPS revision techniques failed to revise the chronically thrombosed TIPS. RF wire recanalization was successfully performed through each of the chronically thrombosed TIPS, demonstrating initial safety and feasibility in this application.
Directory of Open Access Journals (Sweden)
Ravindranadh Bobbili
2015-12-01
Full Text Available The current work presents a comparative study of wire electrical discharge machining (WEDM of armour materials such as aluminium alloy 7017 and rolled homogeneous armour (RHA steel using buckingham pi theorem to model the input variables and thermo-physical characteristics of WEDM on material removal rate (MRR and surface roughness (Ra of Al 7017 and RHA steel. The parameters of the model such as pulse-on time, flushing pressure, input power, thermal diffusivity and latent heat of vaporization have been determined through design of experiment methodology. Wear rate of brass wire increases with rise in input energy in machining Al 7017. The dependence of thermo-physical properties and machining variables on mechanism of MRR and Ra has been described by performing scanning electron microscope (SEM study. The rise in pulse-on time from 0.85μs to 1.25μs causes improvement in MRR and deterioration of surface finish. The machined surface has revealed that craters are found on the machined surface. The propensity of formation of craters increases during WEDM with a higher current and larger pulse-on time.
Experimental study on underwater electrical explosion of a copper wire
International Nuclear Information System (INIS)
Zhou Qing; Zhang Jun; Tan Xiangyu; Ren Baozhong; Zhang Qiaogen
2010-01-01
Through analyzing the physical process of underwater electrical wire explosion, electrical wire explosions with copper wires were investigated underwater using pulsed voltage in the time scale of a few microseconds. A self-integrating Rogowsky coil and a voltage divider were used for current and voltage at the wire load, respectively. The shock wave pressure is measured with a piezoelectric pressure probe at the same distance. The current rise rate was adjusted by changing the applied voltage, circuit inductance, length and diameter of copper wire. The change of the current rise rate had a great effect on the process of underwater electrical wire explosion with copper wires. At last, the effect of discharge voltage, circuit inductance, length and diameter of copper wire were obtained on the explosion voltage and current as well as shock wave pressure. (authors)
Self-impedances of finite and infinite wires with earth-return
International Nuclear Information System (INIS)
Koglin, H.J.; Meyer, E.P.
1981-01-01
The electromagnetic field for a thin wire of finite length, embedded in a homogeneous earth of infinite extent in all directions, is given. The distribution of the electric field intensity close to the wire is examined. The mathematical model for the finite wire is expanded by substituting a spheroidal earth-electrode at each end. The external self-impedance of the wire between the earth-electrodes is calculated by integrating the electric field intensity along a presupposed radius. Especially in the case of short wires the results show considerable deviations to the known depth of current penetration as compared to that of an infinitely long wire. By considering the approximations used for short wires in this model, one can draw conclusions on the external self-impedance for short wires above, on and under the earth's surface. (orig.) [de
Thyroid measurements of Iodine-125 workers
International Nuclear Information System (INIS)
Burns, P.A.; Peggie, J.R.
1979-02-01
The accumulation of 125 I in the thyroid presents real hazards to workers who use this radionuclide. Recent assessments of the maximum permissible thyroid burden for 125 I have tended to be lower than those previously adopted. Workers using 125 I may receive small doses to a film badge monitor from external radiation while accumulating significant doses to the thyroid from internal contamination. It is therefore necessary to perform some form of thyroid monitoring on such workers. In the past two years the Australian Radiation Laboratory has monitored 125 I workers from six different institutations in the Melbourne area to determine the activity of 125 I in their thyroids. Most of the levels monitored were less than one tenth of the most recently recommended thyroid burden of 400 nanocurie. The highest levels were measured in workers who actually perform iodinations. Workers who handle the iodinate generally had lower levels than those performing the iodinations. Only a very small number of the workers measured were below the detectable limit of the system indicating that even when low activities of 125 I are handled in relatively stable forms it is still possible to accumulate 125 I in the thyroid
International Nuclear Information System (INIS)
Anis, Y.; Zisapel, N.; Nir, I.; Schmidt, U.
1992-01-01
Sham-operated and pinealectomized male rats were maintained at 14 h light: 10 h dark cycles (lights-on 5.00 h) and injected daily, for 14 days, with oxazepam or vehicle. 125 I-melatonin binding was recorded in synaptosomes prepared at 10.00, 18.00, and 24.00 h from the hypothalamus, hippocampus and medulla-pons of the rats. In the sham-operated, vehicle treated rats, specific 125 I-melatonin binding in all brain areas studied was higher at 18.00 h, whereas in the oxazepam-treated animals, binding was higher at 24.00 h than at the other times tested. In the pinealectomized, vehicle-treated rats, the binding recorded at 18.00 h in all three brain areas, was lower than at the other times of day tested. Oxazepam treatment decreased 125 I-melatonin binding at 24.00 h in the hippocampus and medulla-pons of the pinealectomized rats and did not significantly affect the binding in the hypothalamus. These results indicate the ability of oxazepam, pinealectomy and their combination, to manipulate the diurnal variations in 125 I-melatonin binding sites in the rat brain
Interchip link system using an optical wiring method.
Cho, In-Kui; Ryu, Jin-Hwa; Jeong, Myung-Yung
2008-08-15
A chip-scale optical link system is presented with a transmitter/receiver and optical wire link. The interchip link system consists of a metal optical bench, a printed circuit board module, a driver/receiver integrated circuit, a vertical cavity surface-emitting laser/photodiode array, and an optical wire link composed of plastic optical fibers (POFs). We have developed a downsized POF and an optical wiring method that allows on-site installation with a simple annealing as optical wiring technologies for achieving high-density optical interchip interconnection within such devices. Successful data transfer measurements are presented.
WIRED magazine announces rave awards nominees
2002-01-01
WIRED Magazine has anounced the nominees for its fourth annual WIRED Rave Awards, celebrating innovation and the individuals transforming commerce and culture. Jeffrey Hangst of the University of Aarhus has been nominated in the science category, for his work on the ATHENA Experiment, CERN (1/2 page).
LANSCE-R WIRE-SCANNER ANALOG FRONT-END ELECTRONICS
International Nuclear Information System (INIS)
Gruchalla, Michael E.
2011-01-01
A new AFE is being developed for the new LANSCE-R wire-scanner systems. The new AFE is implemented in a National Instruments Compact RIO (cRIO) module installed a BiRa 4U BiRIO cRIO chassis specifically designed to accommodate the cRIO crate and all the wire-scanner interface, control and motor-drive electronics. A single AFE module provides interface to both X and Y wire sensors using true DC coupled transimpedance amplifiers providing collection of the wire charge signals, real-time wire integrity verification using the normal dataacquisition system, and wire bias of 0V to +/-50V. The AFE system is designed to accommodate comparatively long macropulses (>1ms) with high PRF (>120Hz) without the need to provide timing signals. The basic AFE bandwidth is flat from true DC to 50kHz with a true first-order pole at 50kHz. Numeric integration in the cRIO FPGA provides real-time pulse-to-pulse numeric integration of the AFE signal to compute the total charge collected in each macropulse. This method of charge collection eliminates the need to provide synchronization signals to the wire-scanner AFE while providing the capability to accurately record the charge from long macropulses at high PRF.
Kirschner Wires : insertion techniques and bone related consequences
Franssen, B.B.G.M.
2010-01-01
The Kirschner (K-) wire was first introduced in 1909 by Martin Kirschner. This is a thin unthreaded wire of surgical steel with a diameter of up to three millimeters and a selection of different tips. The use of K-wires is often promoted as a simple technique because of its easy placement,
Directory of Open Access Journals (Sweden)
Khan I
2016-07-01
Full Text Available Aims: To evaluate the effectiveness and safety of anterior tension band wiring technique using two cannulated cancellous screws in patients with transverse (AO34-C1 or transverse with mildly comminuted (AO34-C2 patellar fractures. Materials and Methods: This is a prospective study of 25 patients with transverse fracture or transverse fracture with mildly comminuted patella fractures. All the patients were treated with open reduction and internal fixation using two parallel cannulated screws and 18G stainless steel wire as per the tension band principle. Results: There were eighteen males (72% and seven females (28%. The age group ranged from 24 to 58 years, with mean age of 38 years. The most common mode of injury was fall (72% followed by road traffic accident (20% and violent quadriceps contraction (8%. Transverse fracture was present in 60% and transverse fracture with mild comminution in 40% of patients. Mean time to achieve union was 10.7 weeks (range 8-12 weeks. Mean ROM at three months was 113.8 degree (90-130 and at final follow up this improved to 125.4 degrees (range 100-140. There was one case of knee stiffness and no case of implant failure was observed. Patients were evaluated using Bostman scoring, the mean score at three months being 26.04 which improved to 27.36 at the end of final follow up at one year. Conclusion: Cannulated cancellous screws with anterior tension band wiring is a safe, reliable and reproducible method in management of transverse patellar fractures, with less chances of implant failure and soft tissue irritation.
Energy transformation in Z-pinch and plasma focus discharges with wire and wire-in-liner loads
International Nuclear Information System (INIS)
Kubes, Pavel; Kravarik, Jozef; Klir, Daniel; Scholz, Marek; Paduch, Marian; Tomaszewski, Krzysztof; Karpinski, Leslaw; Bakshaev, Yury L.; Blinov, Peter I.; Chernenko, Andrey S.; Dan'ko, Sergey A.; Korolev, Valery D.; Shashkov, Andrey Y.; Tumanov, Victor I.
2002-01-01
The results of the study of the Z-pinch and plasma-focus plasmas at presence of the axial C, Al, or Cu wires of sufficient high diameter are discussed in this paper. The wire was positioned on the top of the inner electrode of the PF 1000 plasma focus (1.8 MA, IPPLM Warsaw), or at the axis with or without the tungsten or alumine wire array load at the S-300 facility (3 MA, RRC Kurchatov Institute, Moscow), and at the axis of the small Z-pinch Z-150 (50 kA, CTU Prague). The plasma corona around the wire was generated both by the current going through the wires and by the implosion of the wire array or of the current sheath. The experiments showed interesting results often observed in some shots of Z-pinch type discharges - existence of helical structures, two relatively long and stable pinch phases, oscillation of pinch diameter, and back return of the plasma exploding from the pinch. All these observed phenomena can be evolved by spontaneous self-generation and transformation of the axial magnetic field in the pinch during the plasma implosion and explosion. A configuration of axial and azimuthal magnetic field confines the plasma and later transforms or dissipates during a few tens or hundreds ns. A fast transformation of internal magnetic fields can induce a sufficiently high electric field for generation of keV particles and radiation. Study and usage of Z-pinch discharges is connected with solving of two principal problems, limitation of instability development and a way of generation of high energy particles and radiation. The first problem is partially solved by the faster increase of the current, by better cylindrical symmetry of the load and plasma, by higher density of the plasma or by the presence of a stronger magnetized plasma
Electromagnetic densification of MgB2/Cu wires
International Nuclear Information System (INIS)
Woźniak, M; Glowacki, B A
2014-01-01
Electromagnetic compaction of in situ MgB 2 /Cu wire has been achieved using a custom-built 200 J device. The monofilament core packing density was increased by 8% and up to 31% for unreacted and reacted wires respectively. The higher density of the MgB 2 core resulted in a critical current density increase of up to 75% in comparison to that for cold-drawn-only wire. Applying this treatment to a wire with Cu powder additions to the core and with an optimized heat treatment resulted in one of the highest ever reported values of J c for MgB 2 /Cu wires of 6.83 × 10 3 A cm −2 at 4.2 K and 6 T. (paper)
A New Flying Wire System for the Tevatron
Blokland, Willem; Dey, Joseph; Vogel, Greg
1997-05-01
A new Flying Wires system replaces the old system to enhance the analysis of the beam emittance, improve the reliability, and handle the upcoming upgrades of the Tevatron. New VME data acquisition modules and timing modules allow for more bunches to be sampled more precisely. The programming language LabVIEW, running on a Macintosh computer, controls the VME modules and the nuLogic motion board that flies the wires. LabVIEW also analyzes and stores the data, and handles local and remote commands. The new system flies three wires and fits profiles of 72 bunches to a gaussian function within two seconds. A new console application operates the flying wires from any control console. This paper discusses the hardware and software setup, the capabilities and measurement results of the new Flying Wires system.
Seeded perturbations in wire array z-pinches
International Nuclear Information System (INIS)
Robinson, Allen Conrad; Kantsyrev, Victor Leonidovich; Wunsch, Scott Edward; Oliver, Bryan Velten; Lebedev, Sergey V.; Safronova, Alla S.; Maxwell, J.; McKenney, John Lee; Ampleford, David J.; Rapley, J.; Bott, S.C.; Palmer, J.B.A.; Bland, Simon Nicholas; Jones, Brent Manley; Chittenden, Jeremy Paul; Garasi, Christopher Joseph; Hall, Gareth Neville; Mehlhorn, Thomas Alan; Deeney, Christopher
2004-01-01
The impact of 3D structure on wire array z-pinch dynamics is a topic of current interest, and has been studied by the controlled seeding of wire perturbations. First, Al wires were etched at Sandia, creating 20% radial perturbations with variable axial wavelength. Observations of magnetic bubble formation in the etched regions during experiments on the MAGPIE accelerator are discussed and compared to 3D MHD modeling. Second, thin NaF coatings of 1 mm axial extent were deposited on Al wires and fielded on the Zebra accelerator. Little or no axial transport of the NaF spectroscopic dopant was observed in spatially resolved K-shell spectra, which places constraints on particle diffusivity in dense z-pinch plasmas. Finally, technology development for seeding perturbations is discussed
Josephson junction arrays and superconducting wire networks
International Nuclear Information System (INIS)
Lobb, C.J.
1992-01-01
Techniques used to fabricate integrated circuits make it possible to construct superconducting networks containing as many as 10 6 wires or Josephson junctions. Such networks undergo phase transitions from resistive high-temperature states to ordered low-resistance low-temperature states. The nature of the phase transition depends strongly on controllable parameters such as the strength of the superconductivity in each wire or junction and the external magnetic field. This paper will review the physics of these phase transitions, starting with the simplest zero-magnetic field case. This leads to a Kosterlitz-Thouless transition when the junctions or wires are weak, and a simple mean-field fransition when the junctions or wires are strong. Rich behavior, resulting from frustration, occurs in the presence of a magnetic field. (orig.)
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFF125 (Link to dictyBase) - - - Contig-U16368-1 SFF125P (Link... to Original site) SFF125F 540 SFF125Z 608 SFF125P 1148 - - Show SFF125 Library SF (Link to library) Clone ID SFF125 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...RNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICTIINGHPTCIRGDGYLCNQTRCPHDYQC...ACCVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSCR VIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVNC GPGYICT
A tentative opinion of modeling plasma formation in metallic wire Z pinch
International Nuclear Information System (INIS)
Ding Ning
2002-01-01
Numerous experiments in both single wire and in wire arrays have attracted much attention. For the wire array Z-pinch implosions the plasma formation in the metallic wire Z pinches is a key question. By means of analyzing a number of single-wire and multi-wire experiments, two models to describe the behavior of a wire array Z-pinch in initial phase are suggested. In this phase each wire carries a rising current and behaves independently in a way similar to that found in single wire Z-pinch experiments in which a comparable current in one wire is employed. Based on one- or/and two-dimensional magnetohydrodynamics (MHD) theory, one model is used to simulate the electrical explosion stage of the metallic wire, another is used to simulate the wire-plasma formation stage
34 CFR 303.125 - Fiscal control.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Fiscal control. 303.125 Section 303.125 Education... DISABILITIES State Application for a Grant Statement of Assurances § 303.125 Fiscal control. The statement must provide assurance satisfactory to the Secretary that such fiscal control and fund accounting procedures...
MODIS/Aqua Net Evapotranspiration Yearly L4 Global 500m SIN Grid V006
National Aeronautics and Space Administration — The MYD16A3 Version 6 Evapotranspiration/Latent Heat Flux product is a yearly composite product produced at 500 meter pixel resolution. The improved algorithm is...
''Water bath'' effect during the electrical underwater wire explosion
International Nuclear Information System (INIS)
Oreshkin, V. I.; Chaikovsky, S. A.; Ratakhin, N. A.; Grinenko, A.; Krasik, Ya. E.
2007-01-01
The results of a simulation of underwater electrical wire explosion at a current density >10 9 A/cm 2 , total discharge current of ∼3 MA, and rise time of the current of ∼100 ns are presented. The electrical wire explosion was simulated using a one-dimensional radiation-magnetohydrodynamic model. It is shown that the radiation of the exploded wire produces a thin conducting plasma shell in the water in the vicinity of the exploding wire surface. It was found that this plasma shell catches up to 30% of the discharge current. Nevertheless, it was shown that the pressure and temperature of the wire material remain unchanged as compared with the idealized case of the electrical wire explosion in vacuum. This result is explained by a 'water bath' effect
Aydoğdu, A; Frasca, P; D'Apice, C; Manzo, R; Thornton, J M; Gachomo, B; Wilson, T; Cheung, B; Tariq, U; Saidel, W; Piccoli, B
2017-02-21
In this paper we introduce a mathematical model to study the group dynamics of birds resting on wires. The model is agent-based and postulates attraction-repulsion forces between the interacting birds: the interactions are "topological", in the sense that they involve a given number of neighbors irrespective of their distance. The model is first mathematically analyzed and then simulated to study its main properties: we observe that the model predicts birds to be more widely spaced near the borders of each group. We compare the results from the model with experimental data, derived from the analysis of pictures of pigeons and starlings taken in New Jersey: two different image elaboration protocols allow us to establish a good agreement with the model and to quantify its main parameters. We also discuss the potential handedness of the birds, by analyzing the group organization features and the group dynamics at the arrival of new birds. Finally, we propose a more refined mathematical model that describes landing and departing birds by suitable stochastic processes. Copyright © 2016 Elsevier Ltd. All rights reserved.
Topology Optimized Photonic Wire Splitters
DEFF Research Database (Denmark)
Frandsen, Lars Hagedorn; Borel, Peter Ingo; Jensen, Jakob Søndergaard
2006-01-01
Photonic wire splitters have been designed using topology optimization. The splitters have been fabricated in silicon-on-insulator material and display broadband low-loss 3dB splitting in a bandwidth larger than 100 nm.......Photonic wire splitters have been designed using topology optimization. The splitters have been fabricated in silicon-on-insulator material and display broadband low-loss 3dB splitting in a bandwidth larger than 100 nm....
Josephson junctions of multiple superconducting wires
Deb, Oindrila; Sengupta, K.; Sen, Diptiman
2018-05-01
We study the spectrum of Andreev bound states and Josephson currents across a junction of N superconducting wires which may have s - or p -wave pairing symmetries and develop a scattering matrix based formalism which allows us to address transport across such junctions. For N ≥3 , it is well known that Berry curvature terms contribute to the Josephson currents; we chart out situations where such terms can have relatively large effects. For a system of three s -wave or three p -wave superconductors, we provide analytic expressions for the Andreev bound-state energies and study the Josephson currents in response to a constant voltage applied across one of the wires; we find that the integrated transconductance at zero temperature is quantized to integer multiples of 4 e2/h , where e is the electron charge and h =2 π ℏ is Planck's constant. For a sinusoidal current with frequency ω applied across one of the wires in the junction, we find that Shapiro plateaus appear in the time-averaged voltage across that wire for any rational fractional multiple (in contrast to only integer multiples in junctions of two wires) of 2 e /(ℏ ω ) . We also use our formalism to study junctions of two p -wave and one s -wave wires. We find that the corresponding Andreev bound-state energies depend on the spin of the Bogoliubov quasiparticles; this produces a net magnetic moment in such junctions. The time variation of these magnetic moments may be controlled by an external voltage applied across the junction. We discuss experiments which may test our theory.
46 CFR 111.30-19 - Buses and wiring.
2010-10-01
... control wiring must be— (1) Suitable for installation within in a switchboard enclosure and be rated at 90... 46 Shipping 4 2010-10-01 2010-10-01 false Buses and wiring. 111.30-19 Section 111.30-19 Shipping... REQUIREMENTS Switchboards § 111.30-19 Buses and wiring. (a) General. Each bus must meet the requirements of...
Chemistry of radiation damage to wire chambers
International Nuclear Information System (INIS)
Wise, J.
1992-08-01
Proportional counters are used to study aspects of radiation damage to wire chambers (wire aging). Principles of low-pressure, rf plasma chemistry are used to predict the plasma chemistry in electron avalanches (1 atm, dc). (1) Aging is studied in CF 4 /iC 4 H 10 gas mixtures. Wire deposits are analyzed by Auger electron spectroscopy. An apparent cathode aging process resulting in loss of gain rather than in a self-sustained current is observed in CF 4 -rich gases. A four-part model considering plasma polymerization of the hydrocarbon, etching of wire deposits by CF 4 , acceleration of deposition processes in strongly etching environments, and reactivity of the wire surface is developed to understand anode wire aging in CF 4 /iC 4 H 10 gases. Practical guidelines suggested by the model are discussed. (2) Data are presented to suggest that trace amounts of Freons do not affect aging rates in either dimethyl ether or Ar/C 2 H 6 . Apparent loss of gain is explained by attachment of primary electrons to a continuously increasing concentration of Freon 11 (CCl 3 F) in the counter gas. An increase in the concentration of Freon 11 in dimethyl ether is caused by a distillation process in the gas supply bottle and is a natural consequence of the unequal volatilities of the two compounds
Directory of Open Access Journals (Sweden)
Palanisamy Ramasamy
2017-11-01
Full Text Available A Unified Power Quality Conditioner (UPQC is designed using a Neutral Point Clamped (NPC multilevel inverter to improve the power quality. When designed for high/medium voltage and power applications, the voltage stress across the switches and harmonic content in the output voltage are increased. A 3-phase 4-wire NPC inverter system is developed as Power Quality Conditioner using an effectual three dimensional Space Vector Modulation (3D-SVM technique. The proposed system behaves like a UPQC with shunt and series active filter under balanced and unbalanced loading conditions. In addition to the improvement of the power quality issues, it also balances the neutral point voltage and voltage balancing across the capacitors under unbalanced condition. The hardware and simulation results of proposed system are compared with 2D-SVM and 3D-SVM. The proposed system is stimulated using MATLAB and the hardware is designed using FPGA. From the results it is evident that effectual 3D-SVM technique gives better performance compared to other control methods.
Notched K-wire for low thermal damage bone drilling.
Liu, Yao; Belmont, Barry; Wang, Yiwen; Tai, Bruce; Holmes, James; Shih, Albert
2017-07-01
The Kirschner wire (K-wire) is a common bone drilling tool in orthopedic surgery to affix fractured bone. Significant heat is produced due to both the cutting and the friction between the K-wire and the bone debris during drilling. Such heat can result in high temperatures, leading to osteonecrosis and other secondary injuries. To reduce thermal injury and other high-temperature associated complications, a new K-wire design with three notches along the three-plane trocar tip fabricated using a thin micro-saw tool is studied. These notches evacuate bone debris and reduce the clogging and heat generation during bone drilling. A set of four K-wires, one without notches and three notched, with depths of 0.5, 0.75, and 1mm, are evaluated. Bone drilling experiments conducted on bovine cortical bone show that notched K-wires could effectively decrease the temperature, thrust force, and torque during bone drilling. K-wires with notches 1mm deep reduced the thrust force and torque by approximately 30%, reduced peak temperatures by 43%, and eliminated blackened burn marks in bone. This study demonstrates that a simple modification of the tip of K-wires can effectively reduce bone temperatures during drilling. Copyright © 2017 IPEM. Published by Elsevier Ltd. All rights reserved.
Stress state of main stop valve with 500 mm nominal diameter white thermomechanical loading
International Nuclear Information System (INIS)
Koklyuev, G.A.; Plotnikov, V.P.
1987-01-01
The method of finite elements was applied to calculate the stress-strain state of the main isolation valve case with 500 mm nominal diameter while thermomechanical loading. Maximum stress takes place in the zone of joining nozzles with a spherical case and it attains the value of 138 MPa at working pressure of 12.5 MPa. The stress level in the point of nozzle-case welding is essentially lower than in zones of stres concentration and when excluding water hitting the slot of the lack of fusion in the route of the weld the weld service life is attained during the calculated service life
Surface cleaning of metal wire by atmospheric pressure plasma
International Nuclear Information System (INIS)
Nakamura, T.; Buttapeng, C.; Furuya, S.; Harada, N.
2009-01-01
In this study, the possible application of atmospheric pressure dielectric barrier discharge plasma for the annealing of metallic wire is examined and presented. The main purpose of the current study is to examine the surface cleaning effect for a cylindrical object by atmospheric pressure plasma. The experimental setup consists of a gas tank, plasma reactor, and power supply with control panel. The gas assists in the generation of plasma. Copper wire was used as an experimental cylindrical object. This copper wire was irradiated with the plasma, and the cleaning effect was confirmed. The result showed that it is possible to remove the tarnish which exists on the copper wire surface. The experiment reveals that atmospheric pressure plasma is usable for the surface cleaning of metal wire. However, it is necessary to examine the method for preventing oxidization of the copper wire.
International Nuclear Information System (INIS)
Goodnow, R.A. Jr.; Bukownik, R.; Nakanishi, K.; Usherwood, P.N.; Eldefrawi, A.T.; Anis, N.A.; Eldefrawi, M.E.
1991-01-01
125I2-iodinated philanthotoxin-343 (PhTX-343), [125I2]PhTX-343-arginine, and [125I2]PhTX-343-lysine were synthesized and evaluated as probes for glutamate receptors in rat brain synaptic membranes. It was found that these probes were not specific for the glutamate receptors but may be useful for investigating the polyamine binding site. Filtration assays with Whatman GF/B fiber glass filters were unsuitable because the iodinated PhTX-343 analogues exhibited high nonspecific binding to the filters, thus hindering detection of specific binding to membranes. When binding was measured by a centrifugal assay, [125I2]PhTX-343-lysine bound with low affinity (KD = 11.4 ± 2 microM) to a large number of sites (37.2 ± 9.1 nmol/mg of protein). The binding of [125I2]PhTX-343-lysine was sensitive only to the polyamines spermine and spermidine, which displaced [125I2]PhTX-343-lysine with Ki values of (3.77 ± 1.4) x 10(-5) M and (7.51 ± 0.77) x 10(-5) M, respectively. The binding was insensitive to glutamate receptor agonists and antagonists. Binding results with [125I2]PhTX-343-arginine were similar to those of [125I2]-PhTX-343-lysine. Considering the high number of toxin binding sites (10000-fold more than glutamate) in these membranes and the insensitivity of the binding to almost all drugs that bind to glutamate receptors, it is evident that most of the binding observed is not to glutamate receptors. On the other hand, PhTX analogues with photoaffinity labels may be useful in the isolation/purification of various glutamate and nicotinic acetylcholine receptors; they could also be useful in structural studies of receptors and their binding sites
Laparoscopic extraction of fractured Kirschner wire from the pelvis
Directory of Open Access Journals (Sweden)
Vinaykumar N Thati
2014-01-01
Full Text Available Kirschner wire is a sharp stainless steel guide wire commonly used in fixation of fractured bone segments. There are case reports of migrated K wire from the upper limb into the spine and chest, and from the lower limb in to the abdomen and pelvis. Here, we present a case report of accidental intra-operative fracture of K wire during percutaneous femoral nailing for sub-trochanteric fracture of right femur, which migrated in to the pelvis when the orthopaedician tried to retrieve the broken segment of the K wire. This case highlights the use of laparoscopy as minimally invasive surgical option.
NASA requirements and applications environments for electrical power wiring
International Nuclear Information System (INIS)
Stavnes, M.W.; Hammond, A.N.
1992-01-01
Serious problems can occur from insulation failures in the wiring harnesses of aerospace vehicles. In most recorded incidents, the failures have been identified to be the result of arc tracking, the propagation of an arc along wiring bundles through degradation of insulation. Propagation of the arc can lead to the loss of the entire wiring harness and the functions which it supports. While an extensive database of testing for arc track resistant wire insulations have been developed for aircraft applications, the counterpart requirements for spacecraft are very limited. This paper presents the electrical, thermal, mechanical, chemical, and operational requirements for specification and testing of candidate wiring systems for spacecraft applications
Energy Technology Data Exchange (ETDEWEB)
Srinivasan, G.; Arivazhagan, B.; Albert, S.K.; Bhaduri, A.K. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India)
2010-07-01
Indigenous development of reduced activation ferritic-martensitic (RAFM) steel has become necessary for India as a participant in the International Thermo-nuclear Experimental Reactor (ITER) programme. Optimisation of RAFM steel is in an advanced stage for the fabrication of test blanket module (TBM) components. Simultaneously, development of RAFM steel filler wires has been undertaken since there is no commercial filler wires are available for fabrication of components using RAFM steel. The purpose of this study is to develop filler wires that can be directly used for both gas tungsten arc welding (GTAW) and for narrow-gap gas tungsten arc welding (NG-GTAW) that reduces the deposited weld metal volume and heat affected zone (HAZ) width. Further, the filler wires would also be used for hybrid laser-MIG welding for thick section joints. In view of meeting all the requirements, a detailed specification was prepared for the development of filler wires for welding of RAFM steel. Meanwhile, welding trials have been carried out on 2.5 mm thick plates of the RAFM steel using GTAW process at various heat inputs with a preheat temperature of 250 C followed by various post weld heat treatments (PWHT). The microstructure of the weld metal in most of the cases showed the presence of some amount of delta-ferrite. Filler wires as per specifications have also been developed with minor variations on the chemistry against the specified values. Welding parameters and PWHT parameters were optimized to qualify the filler wires without the presence of delta-ferrite in the weld metal and with optimized mechanical properties. Results showed that the weld metals are free from delta-ferrite. Tensile properties at ambient temperature and at 500 C are well above the specified values, and are much higher than the base metal values. Ductile Brittle Transition Temperature (DBTT) has been evaluated as -81 C based on the 68 J criteria. The present study highlights the basis and methodology
Composite ceramic superconducting wires for electric motor applications
Halloran, John W.
1990-07-01
Several types of HTSC wire have been produced and two types of HTSC motors are being built. Hundreds of meters of Ag- clad wire were fabricated from YBa2Cu3O(7-x) (Y-123) and Bi2Ca2Sr2Cu3O10 (BiSCCO). The dc homopolar motor coils are not yet completed, but multiple turns of wire have been wound on the coil bobbins to characterize the superconducting properties of coiled wire. Multifilamentary conductors were fabricated as cables and coils. The sintered polycrystalline wire has self-field critical current densities (Jc) as high as 2800 A/sq cm, but the Jc falls rapidly with magnetic field. To improve Jc, sintered YBCO wire is melt textured with a continuous process which has produced textures wire up to 0.5 meters long with 77K transport Jc above 11, 770 A/sq cm2 in self field and 2100 A/sq cm2 at 1 telsa. The Emerson Electric dc homopolar HTSC motor has been fabricated and run with conventional copper coils. A novel class of potential very powerful superconducting motors have been designed to use trapped flux in melt textures Y-123 as magnet replicas in an new type of permanent magnet motor. The stator element and part of the rotor of the first prototype machine exist, and the HTSC magnet replica segments are being fabricated.
Beam Position and Phase Monitor - Wire Mapping System
International Nuclear Information System (INIS)
Watkins, Heath A.; Shurter, Robert B.; Gilpatrick, John D.; Kutac, Vincent G.; Martinez, Derwin
2012-01-01
The Los Alamos Neutron Science Center (LANSCE) deploys many cylindrical beam position and phase monitors (BPPM) throughout the linac to measure the beam central position, phase and bunched-beam current. Each monitor is calibrated and qualified prior to installation to insure it meets LANSCE requirements. The BPPM wire mapping system is used to map the BPPM electrode offset, sensitivity and higher order coefficients. This system uses a three-axis motion table to position the wire antenna structure within the cavity, simulating the beam excitation of a BPPM at a fundamental frequency of 201.25 MHz. RF signal strength is measured and recorded for the four electrodes as the antenna position is updated. An effort is underway to extend the systems service to the LANSCE facility by replacing obsolete electronic hardware and taking advantage of software enhancements. This paper describes the upgraded wire positioning system's new hardware and software capabilities including its revised antenna structure, motion control interface, RF measurement equipment and Labview software upgrades. The main purpose of the wire mapping system at LANSCE is to characterize the amplitude response versus beam central position of BPPMs before they are installed in the beam line. The wire mapping system is able to simulate a beam using a thin wire and measure the signal response as the wire position is varied within the BPPM aperture.
Temperature Dependent Wire Delay Estimation in Floorplanning
DEFF Research Database (Denmark)
Winther, Andreas Thor; Liu, Wei; Nannarelli, Alberto
2011-01-01
Due to large variations in temperature in VLSI circuits and the linear relationship between metal resistance and temperature, the delay through wires of the same length can be different. Traditional thermal aware floorplanning algorithms use wirelength to estimate delay and routability. In this w......Due to large variations in temperature in VLSI circuits and the linear relationship between metal resistance and temperature, the delay through wires of the same length can be different. Traditional thermal aware floorplanning algorithms use wirelength to estimate delay and routability....... In this work, we show that using wirelength as the evaluation metric does not always produce a floorplan with the shortest delay. We propose a temperature dependent wire delay estimation method for thermal aware floorplanning algorithms, which takes into account the thermal effect on wire delay. The experiment...
Signals analysis of fluxgate array for wire rope defaults
International Nuclear Information System (INIS)
Gu Wei; Chu Jianxin
2005-01-01
In order to detecting the magnetic leakage fields of the wire rope defaults, a transducer made up of the fluxgate array is designed, and a series of the characteristic values of wire rope defaults signals are defined. By processing the characteristic signals, the LF or LMA of wire rope are distinguished, and the default extent is estimated. The experiment results of the new method for detecting the wire rope faults are introduced
MODIS/Terra Net Evapotranspiration Yearly L4 Global 500m SIN Grid V006
National Aeronautics and Space Administration — The MOD16A3 Version 6 Evapotranspiration/Latent Heat Flux product is a yearly composite product produced at 500 meter pixel resolution. The algorithm is based on the...
Composite conductor containing superconductive wires
Energy Technology Data Exchange (ETDEWEB)
Larson, W.L.; Wong, J.
1974-03-26
A superconductor cable substitute made by coworking multiple rods of superconductive niobium--titanium or niobium--zirconium alloy with a common copper matrix to extend the copper and rods to form a final elongated product which has superconductive wires distributed in a reduced cross-section copper conductor with a complete metallurgical bond between the normal-conductive copper and the superconductor wires contained therein is described. The superconductor cable can be in the form of a tube.
2010-02-23
... Engines GmbH (TAE) Models TAE 125-01 and TAE 125-02-99 Reciprocating Engines Installed in, But Not Limited...-99 engines, initial and repetitive replacements of the PPRV, and installation of a vibration isolator..., we estimate that this proposed AD would affect about 300 TAE 125-01 and TAE 125-02-99 reciprocating...
Directory of Open Access Journals (Sweden)
Zheng Li
2010-12-01
Full Text Available This paper describes the development of a mobile robot capable of clearing such obstacles as counterweights, anchor clamps, and torsion tower. The mobile robot walks on overhead ground wires in 500KV power tower. Its ultimate purpose is to automate to inspect the defect of power transmission line. The robot with 13 motors is composed of two arms, two wheels, two claws, two wrists, etc. Each arm has 4 degree of freedom. Claws are also mounted on the arms. An embedded computer based on PC/104 is chosen as the core of control system. Visible light and thermal infrared cameras are installed to obtain the video and temperature information, and the communication system is based on wireless LAN TCP/IP protocol. A prototype robot was developed with careful considerations of mobility. The new sensor configuration is used for the claw to grasp the overhead ground wires. The bridge is installed in the torsion tower for the robot easy to cross obstacles. The new posture plan is proposed for obstacles cleaning in the torsion tower. Results of experiments demonstrate that the robot can be applied to execute the navigation and inspection tasks.
Directory of Open Access Journals (Sweden)
Zheng Li
2011-01-01
Full Text Available This paper describes the development of a mobile robot capable of clearing such obstacles as counterweights, anchor clamps, and torsion tower. The mobile robot walks on overhead ground wires in 500KV power tower. Its ultimate purpose is to automate to inspect the defect of power transmission line. The robot with 13 motors is composed of two arms, two wheels, two claws, two wrists, etc. Each arm has 4 degree of freedom. Claws are also mounted on the arms. An embedded computer based on PC/104 is chosen as the core of control system. Visible light and thermal infrared cameras are installed to obtain the video and temperature information, and the communication system is based on wireless LAN TCP/IP protocol. A prototype robot was developed with careful considerations of mobility. The new sensor configuration is used for the claw to grasp the overhead ground wires. The bridge is installed in the torsion tower for the robot easy to cross obstacles. The new posture plan is proposed for obstacles cleaning in the torsion tower. Results of experiments demonstrate that the robot can be applied to execute the navigation and inspection tasks.
Modelling aluminium wire bond reliability in high power OMP devices
Kregting, R.; Yuan, C.A.; Xiao, A.; Bruijn, F. de
2011-01-01
In a RF power application such as the OMP, the wires are subjected to high current (because of the high power) and high temperature (because of the heat from IC and joule-heating from the wire itself). Moreover, the wire shape is essential to the RF performance. Hence, the aluminium wire is
Directory of Open Access Journals (Sweden)
A. A. Kurteva
2016-08-01
Full Text Available Beta-decay of the nucleus 125I and spectroscopic characteristics of the daughter nucleus are described within the framework of the dynamic collective model. Quasiparticle and multiphonon states, as well as vacuum fluctuations of quasiparticles are taken into account. The comparison of the results of calculations with the available experimental data is performed.
Towards a wire-mediated coupling of trapped ions
Clark, Robert; Lee, Tony; Daniilidis, Nikos; Sankaranarayanan, S.; Häffner, Hartmut
2008-03-01
Most schemes for ion trap quantum computation rely upon the exchange of information between ion-qubits in the same trap region, mediated by their shared vibrational mode. An alternative way to achieve this coupling is via the image charges induced in a conducting wire that connects different traps. This was shown to be theoretically possible by Heinzen and Wineland in 1990, but some important practical questions have remained unaddressed. Among these are how the presence of such a wire modifies the motional frequencies and heating rates of trapped ions. We thus have realized this system as a 1 mm-scale planar segmented rf ion trap combined with an electrically floating gold wire of 25 microns diameter and length 1 cm. This wire is placed close to trapped ions using a set of piezoelectric nanopositioners. We present here experimental measurements of the motional frequencies and heating rates of a single trapped calcium ion as the wire is moved from 3.0 mm to 0.2 mm away from the ion. We discuss the implications of these results for achieving wire-mediated coupling in the present apparatus, as well as in future improved setups.
Mechanical characterisation of orthodontic superelastic Ni-Ti wires
Energy Technology Data Exchange (ETDEWEB)
Arrigoni, M.; Pietrabissa, R. [Politecnico di Milano, Milano (Italy). Lab. of Biological Structure Mechanics; Auricchio, F.; Petrini, L. [Politecnico di Milano, Milano (Italy). Lab. of Biological Structure Mechanics; Pavia Univ. (Italy). Dept. of Structural Mechanics; Cacciafesta, V. [Politecnico di Milano, Milano (Italy). Lab. of Biological Structure Mechanics; Pavia Univ. (Italy). Dept. of Orthodontia
2001-11-01
Nowadays, the orthodontic treatment is improving thanks to the introduction of Ni-Ti super-elastic alloy wires in the ordinary therapy. Indeed, laboratory tests performed in the last decade have shown that Ni-Ti superelastic wires are able to satisfy the ideal requirements for fixed arch-wire appliance: high flexibility, minimal distortion or plastic deformation, light constant force production over a wide range of displacements. On the other hand, many orthodontic companies produce Ni-Ti arch-wires, without giving detailed specifications on their superelastic characteristics. To improve the knowledge on real properties for these products, an experimental campaign on different commercial arch-wires has been started at the Laboratory of Biological Structure Mechanics (LABS) at the Politecnico di Milano (Italy). This work presents the first step of the research, concerning the comparison between the behaviour of four types of wires (two produced by ORMCO and two produced by 3M/Unitek) under monotonic and cyclic isothermal tensile tests. The results show significant differences between the products in terms of elastic modulus, stress values of the loading-unloading plateau, hysteresis amplitude, spring-back capacity, shape recovery capability, strain rate effect and fatigue behaviour. (orig.)
Simulation study of solar wind push on a charged wire: basis of solar wind electric sail propulsion
Directory of Open Access Journals (Sweden)
P. Janhunen
2007-03-01
Full Text Available One possibility for propellantless propulsion in space is to use the momentum flux of the solar wind. A way to set up a solar wind sail is to have a set of thin long wires which are kept at high positive potential by an onboard electron gun so that the wires repel and deflect incident solar wind protons. The efficiency of this so-called electric sail depends on how large force a given solar wind exerts on a wire segment and how large electron current the wire segment draws from the solar wind plasma when kept at a given potential. We use 1-D and 2-D electrostatic plasma simulations to calculate the force and present a semitheoretical formula which captures the simulation results. We find that under average solar wind conditions at 1 AU the force per unit length is (5±1×10−8 N/m for 15 kV potential and that the electron current is accurately given by the well-known orbital motion limited (OML theory cylindrical Langmuir probe formula. Although the force may appear small, an analysis shows that because of the very low weight of a thin wire per unit length, quite high final speeds (over 50 km/s could be achieved by an electric sailing spacecraft using today's flight-proved components. It is possible that artificial electron heating of the plasma in the interaction region could increase the propulsive effect even further.
Physical-mechanical and electrical properties of aluminium anodic films
Energy Technology Data Exchange (ETDEWEB)
Dima, L. [Research and Design Inst. for Electr. Eng., Bucharest (Romania); Anicai, L. [Research and Design Inst. for Electr. Eng., Bucharest (Romania)
1995-11-01
Mechanical, thermal and electrical properties of aluminium anodic films obtained by continuously anodization of Al wires of 4.5 mm diameter and Al sheets of 40 x 0.2 mm (Al min.99.5% purity), using an electrolyte based on oxalic acid, citric acid, boric acid, isopropilic alcohol, were investigated. The thickness of Al anodic oxide layers was 5 {+-} 1{mu}, 10 {+-} 1{mu}, for Al sheet, respectively 5 {+-} 1{mu}, 10 {+-} 1{mu}, 15 {+-} 1{mu}, for Al wire. To establish the influence of anodic film formation on mechanical parameters, measurements of breaking strength and relative elongation at break for anodized and non-anodized Al conductors, were made. In order to electrically characterize the anodic films, the breakdown voltage for different curvature radii of the conductor, between 50 - 12.5 mm, were measured. The influence of the layer thickness, as well as of the cracking during its bending, was established, too. To test the thermal resistance of the insulating anodic films, the Al conductors were subjected to 1 - 5 cyclic thermal shocks at 500 C. After the experimentals were done, it was found that Al anodic films of 5 {+-} 1{mu} may assure a breakdown voltage of minimum 200 V, for coils having a curvature radius greater than 12.5 mm and operating temperatures up to 500 C. From mechanical point of view, anodic oxide film determines a relatively reinforcing of Al conductor, but it doesn`t influence its functional properties. (orig.)
High-speed autoverifying technology for printed wiring boards
Ando, Moritoshi; Oka, Hiroshi; Okada, Hideo; Sakashita, Yorihiro; Shibutani, Nobumi
1996-10-01
We have developed an automated pattern verification technique. The output of an automated optical inspection system contains many false alarms. Verification is needed to distinguish between minor irregularities and serious defects. In the past, this verification was usually done manually, which led to unsatisfactory product quality. The goal of our new automated verification system is to detect pattern features on surface mount technology boards. In our system, we employ a new illumination method, which uses multiple colors and multiple direction illumination. Images are captured with a CCD camera. We have developed a new algorithm that uses CAD data for both pattern matching and pattern structure determination. This helps to search for patterns around a defect and to examine defect definition rules. These are processed with a high speed workstation and a hard-wired circuits. The system can verify a defect within 1.5 seconds. The verification system was tested in a factory. It verified 1,500 defective samples and detected all significant defects with only a 0.1 percent of error rate (false alarm).
International Nuclear Information System (INIS)
Srinivasan, G.; Arivazhagan, B.; Albert, S.K.; Bhaduri, A.K.
2011-01-01
the weld metal and optimised mechanical properties. Results showed that the weld metals are free from delta ferrite. Tensile properties both at ambient and at 500 deg. C are well above the specified values and much higher than the base metal values. Ductile Brittle Transition Temperature (DBTT) has been evaluated as -81 deg. C based on 68 J criteria. The present study highlights the basis and methodology adopted for the specification of filler wires and its development followed by the optimisation of welding procedures and PWHT adopted on the Indian made RAFM steel to be used for the TBM components of ITER.
Shape memory alloy wire-based smart natural rubber bearing
International Nuclear Information System (INIS)
Hedayati Dezfuli, F; Shahria Alam, M
2013-01-01
In this study, two types of smart elastomeric bearings are presented using shape memory alloy (SMA) wires. Due to the unique characteristics of SMAs, such as the superelastic effect and the recentering capability, the residual deformation in SMA-based natural rubber bearings (SMA-NRBs) is significantly reduced whereas the energy dissipation capacity is increased. Two different configurations of SMA wires incorporated in elastomeric bearings are considered. The effect of several parameters, including the shear strain amplitude, the type of SMA, the aspect ratio of the base isolator, the thickness of SMA wire, and the amount of pre-strain in the wires on the performance of SMA-NRBs is investigated. Rubber bearings are composed of natural rubber layers bonded to steel shims as reinforcement. Results show that ferrous SMA wire, FeNiCuAlTaB, with 13.5% superelastic strain and a very low austenite finish temperature (−62 °C), is the best candidate to be used in SMA-NRBs subjected to high shear strain amplitudes. In terms of the lateral flexibility and wire strain level, the smart rubber bearing with a cross configuration of SMA wires is more efficient. Moreover, the cross configuration can be implemented in high-aspect-ratio elastomeric bearings since the strain induced in the wire does not exceed the superelastic range. When cross SMA wires with 2% pre-strain are used in a smart NRB, the dissipated energy is increased by 74% and the residual deformation is decreased by 15%. (paper)
Self-organization of mesoscopic silver wires by electrochemical deposition
Directory of Open Access Journals (Sweden)
Sheng Zhong
2014-08-01
Full Text Available Long, straight mesoscale silver wires have been fabricated from AgNO3 electrolyte via electrodeposition without the help of templates, additives, and surfactants. Although the wire growth speed is very fast due to growth under non-equilibrium conditions, the wire morphology is regular and uniform in diameter. Structural studies reveal that the wires are single-crystalline, with the [112] direction as the growth direction. A possible growth mechanism is suggested. Auger depth profile measurements show that the wires are stable against oxidation under ambient conditions. This unique system provides a convenient way for the study of self-organization in electrochemical environments as well as for the fabrication of highly-ordered, single-crystalline metal nanowires.
Decaying spectral oscillations in a Majorana wire with finite coherence length
Fleckenstein, C.; Domínguez, F.; Traverso Ziani, N.; Trauzettel, B.
2018-04-01
Motivated by recent experiments, we investigate the excitation energy of a proximitized Rashba wire in the presence of a position dependent pairing. In particular, we focus on the spectroscopic pattern produced by the overlap between two Majorana bound states that appear for values of the Zeeman field smaller than the value necessary for reaching the bulk topological superconducting phase. The two Majorana bound states can arise because locally the wire is in the topological regime. We find three parameter ranges with different spectral properties: crossings, anticrossings, and asymptotic reduction of the energy as a function of the applied Zeeman field. Interestingly, all these cases have already been observed experimentally. Moreover, since an increment of the magnetic field implies the increase of the distance between the Majorana bound states, the amplitude of the energy oscillations, when present, gets reduced. The existence of the different Majorana scenarios crucially relies on the fact that the two Majorana bound states have distinct k -space structures. We develop analytical models that clearly explain the microscopic origin of the predicted behavior.
Failure analysis of the fractured wires in sternal perichronal loops.
Chao, Jesús; Voces, Roberto; Peña, Carmen
2011-10-01
We report failure analysis of sternal wires in two cases in which a perichronal fixation technique was used to close the sternotomy. Various characteristics of the retrieved wires were compared to those of unused wires of the same grade and same manufacturer and with surgical wire specifications. In both cases, wire fracture was un-branched and transgranular and proceeded by a high cycle fatigue process, apparently in the absence of corrosion. However, stress anlysis indicates that the effective stress produced during strong coughing is lower than the yield strength. Our findings suggest that in order to reduce the risk for sternal dehiscence, the diameter of the wire used should be increased. Copyright © 2011 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Govindha Rasu, N.; Velusamy, K.; Sundararajan, T.; Chellapandi, P.
2013-01-01
Highlights: ► We study sodium flow and temperature development in fuel pin bundles. ► Pin diameter, number of pins, wire wrap and ligament gap are varied as parameters. ► Flow development is achieved within ∼30–40 hydraulic diameters. ► Thermal development is attained only for small pin diameter and less number of pins. ► Wire wrap and ligament gap strongly influence Nusselt number. - Abstract: Simultaneous development of liquid sodium flow and temperature fields in the heat generating pin bundles of reactor has been investigated. Development characteristics are seen to be strongly influenced by pin diameter, number of pins, helical wire-wrap, ligament gap between the last row of pins and hexcan wall and Reynolds number. Flow development is achieved within an axial length of ∼125 hydraulic diameters, for all the pin bundle configurations considered. But temperature development is attained only if the pin diameter is small or the number of pins is less. In the case of large pin diameter with more pins, temperature development could not be achieved even after a length of ∼1000 hydraulic diameters. The reason for this behavior is traced to be the weak communication among sub-channels in tightly packed bundles. It is seen that the pin Nusselt number decreases from center to periphery in a bundle. Also, if the ligament gap is narrow, the Nusselt number is large and more uniform. Flow development length is short if the Reynolds number is large and the converse is true for thermal development length. Helical wire-wrap shortens the thermal entry length and significantly enhances the global Nusselt number. But, its influence on hydrodynamic entry length is not significant
Physical analysis for designing nested-wire arrays on Z-pinch implosion
International Nuclear Information System (INIS)
Yang Zhenhua; Liu Quan; Ding Ning; Ning Cheng
2005-01-01
Z-pinch experiments have demonstrated that the X-ray power increases 40% with a nested-wire array compared with that with a single-layered wire array. The design of the nested-wire array on Z accelerator is studied through the implosion dynamics and the growth of RT instabilities. The analysis shows that the nested-wire array does not produce more total X-ray radiation energy than the single-layered wire array, but it obviously increases the X-ray power. The radius of the outer array of the nested-wire array could be determined based on the radius of the optimized single-layered. The masses of the outer and inner arrays could be determined by the implosion time of the nested-wire array, which is roughly the same as that of the single-layered wire array. Some suggestions are put forward which may be helpful in the nested-wire array design for Z-pinch experiments. (authors)
Fast wire scanner for intense electron beams
Directory of Open Access Journals (Sweden)
T. Moore
2014-02-01
Full Text Available We have developed a cost-effective, fast rotating wire scanner for use in accelerators where high beam currents would otherwise melt even carbon wires. This new design uses a simple planetary gear setup to rotate a carbon wire, fixed at one end, through the beam at speeds in excess of 20 m/s. We present results from bench tests, as well as transverse beam profile measurements taken at Cornell’s high-brightness energy recovery linac photoinjector, for beam currents up to 35 mA.
Problems associated with iridium-192 wire implants
International Nuclear Information System (INIS)
Arnott, S.J.; Law, J.; Ash, D.; Flynn, A.; Paine, C.H.; Durrant, K.R.; Barber, C.D.; Dixon-Brown, A.
1985-01-01
Three incidents are reported, from different radiotherapy centres, in which an implanted iridium-192 wire remained in the tissues of a patient after withdrawal of the plastic tubing in which it was contained. In each case the instrument used to cut the wire had probably formed a hook on the end of the wire which caused it to catch in the tissues. Detailed recommendations are made for avoiding such incidents in the future, the most important of which is that the patient should be effectively monitored after the supposed removal of all radioactive sources. (author)
2013-12-11
... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for... issue a finding of regulatory adequacy under Sec. 611 of Public Law 92-574, the ``Noise Control Act of... electronic flight control system that contains fly-by-wire control laws, including envelope protections, for...
Rapid characterization of a nanomaterial structure using X-ray reciprocal-lattice-space imaging
International Nuclear Information System (INIS)
Sakata, Osami; Yoshimoto, Mamoru; Miki, Kazushi
2006-01-01
The X-ray reciprocal-lattice-space imaging method is able to record the reciprocal-lattice-space of nanostructure by sample-and-detector fixed geometry. This method was developed by the surface structure analysis beam line BL13XU of SPring-8. Outline of the X-ray diffraction method and basic principles of the X-ray reciprocal-lattice-space imaging method, and application examples are stated. The method is able to find out the Bragg conditions of nanostructure of surface in the atmosphere. The reciprocal-lattice of the embedded trace atomic wires was observed. The trace atoms of Bi atomic wires embedded in silicone showed the diffraction signal and image by a short exposure time. This method is useful at rapid non-destructive measurement of nanostructure. (S.Y.)