WorldWideScience

Sample records for wire carrying ac

  1. Intra-wire resistance and AC loss in multi-filamentary MgB2 wires

    NARCIS (Netherlands)

    Zhou, Chao; Offringa, Wietse; Bergen, Anne-Henriette; Wessel, Wilhelm A.J.; Krooshoop, Hendrikus J.G.; Dhalle, Marc M.J.; Sumption, M.D.; Collings, E.W.; Rindfleisch, M.; Tomsic, M.; ten Kate, Herman H.J.; Nijhuis, Arend

    2013-01-01

    Intra-wire resistance and AC loss of various multi-filamentary MgB2 wires with filaments surrounded by Nb barriers have been measured and analyzed. The intra-wire resistance is measured with a direct four-probe voltage–current method at various temperatures. The AC loss is acquired by both vibrating

  2. Charges and Fields in a Current-Carrying Wire

    Science.gov (United States)

    Redzic, Dragan V.

    2012-01-01

    Charges and fields in a straight, infinite, cylindrical wire carrying a steady current are determined in the rest frames of ions and electrons, starting from the standard assumption that the net charge per unit length is zero in the lattice frame and taking into account a self-induced pinch effect. The analysis presented illustrates the mutual…

  3. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  4. AC loss properties of MgB{sub 2} multifilament wires

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, Kazuhide; Funaki, Kazuo; Sueyoshi, Takahiro; Sasashige, Yushi; Kajikawa, Kazuhiro; Iwakuma, Masataka [Kyushu University Graduate School of Information Science and Electrical Engineering, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Okada, Michiya [HRL Hitachi, Ltd, 7-1-1 Oomika, Hitachi 319-1292 (Japan); Kumakura, Hiroaki [National Institute for Materials Science, 1-2-1 Sengen, Tsukuba 305-0047 (Japan); Hayashi, Hidemi [Kyushu Electric Power Co., Incorporated, 2-1-47 Shiobaru, Minami-ku, Fukuoka 815-8520 (Japan)], E-mail: kazuhide.tanaka.je@hitachi.com

    2008-09-15

    We designed and fabricated two types of composite wires with 6 MgB{sub 2} filaments. One is a Cu-sheathed Nb-barrier wire and the other is a CuNi-sheathed Ta-barrier wire. The transverse-field losses of the trial wires were measured with a standardized pickup coil system in liquid helium. We evaluated the observed AC losses using two structural models, a multifilament conductor model and a hollow-cylindrical one. For the CuNi-sheathed Ta-barrier wire, the AC loss property can be explained by the usual model of multifilament conductors. Further reductions in AC loss can be expected by making the filaments thinner. For the Cu-sheathed Nb-barrier wire, theoretical considerations suggest the multifilament structure behaves as a hollow-cylindrical superconductor in the AC loss property. Thus, we need to pay particular attention to designing the barrier material for reduction in the AC loss.

  5. Two-light circuit continuously monitors ac ground, phase, and neutral wires

    Science.gov (United States)

    Mee, R. W.

    1966-01-01

    Two-transformer, two-lamp circuit monitors the continuity of ac ground, neutral, and phase wires. The circuit gives different visual indications if any one of the three lines should become open circuited.

  6. Reduction of AC losses in ultra-fine multifilamentary NbTi wires

    International Nuclear Information System (INIS)

    Cave, J.R.; Fevrier, A.; Verhaege, T.; Lacaze, A.; Laumond, Y.

    1989-01-01

    The use of superconducting multifilamentary wires in 50/60 Hz AC applications is now possible due to advances in the new technology of ultra-fine filamentary wires (filaments 100 nm). While previous wires have shown very low losses, 1.5 10/sup -5/ W/(Am) and 5 10/sup -5/ W/(Am) at peak 50 Hz inductions of 0.5 T and 1 T respectively, (the unity W/(Am) = (losses in W/m/sup 3/)/(overall Jc in A/m/sup 2/) being a measure of the wire performance), the authors have shown that such wires are susceptible to proximity effects between neighboring filaments. In this article, they present AC loss measurements for a new series of wires where this proximity effect has been greatly reduced by increasing the distance between the filaments whilst retaining high values of the overall critical current density, typically 3000 A/mm/sup 2/ at 0.5 T. For the most performant wires 50 Hz AC losses in W/(Am) for small test coils are a factor of 10 lower for 0.5 T peak field and a factor of 3 lower at 1 T peak field. For wires with negligible proximity coupling there is a benefit from a reduction of losses at low fields as compared to that calculated by the Bean model, due to the small number of flux lines that thread across the width of each filament (increased entry field, surface currents, and reversible flux line motion)

  7. AC loss in superconducting wires operating in a wind turbine like generator

    DEFF Research Database (Denmark)

    Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad

    2010-01-01

    We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared with the me...... resulted in the same AC loss characteristic. This work was done as a part of the Superwind project which aims to build a series of test coils and a spinning model of a generator to investigate AC loss and stability of the coils in wind turbine like conditions....

  8. Effect of AC electric fields on flame spread over electrical wire

    KAUST Repository

    Kim, Minkuk

    2011-01-01

    The effect of electric fields on the characteristics of flame spread over insulated electrical wire has been investigated experimentally by varying AC voltage and frequency applied to the wire in the normal gravity condition. The polyethylene (PE) insulated electrical wire was placed horizontally on electrically non-conducting posts and one end of the wire was connected to the high voltage terminal. Thus, the electrical system is the single electrode configuration. The wire was ignited at one end and the flame spread rate along the wire has been measured from the images using a video camera. Two distinct regimes existed depending on the applied AC frequency. In the low frequency regime, the flame spread rate decreased with the frequency and voltage. While in the high frequency regime, it decreased initially with voltage and then increased. At high frequency, the spread rate was even over that without applying electric fields. This result implies that fire safety codes developed without considering the effect of electric fields may require modifications. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  9. Low Cost Fabrication of 2G Wires for AC Applications

    Energy Technology Data Exchange (ETDEWEB)

    Kodenkandath, T.; List, F.A., III

    2005-09-15

    Ink-jet printing has been demonstrated as an adaptable technology for printing YBCO filaments using a Metal Organic (MO) YBCO precursor. The technology was demonstrated using AMSC's proprietary metal organic TFA-based YBCO precursor and a commercial piezoelectric print-head on RABiTS templates. Filaments with a width of 100 um and spacing of 200 um were successfully printed, decomposed and processed to YBCO. Critical currents of {approx} 200 A/cm-w were achieved in a series of filaments with a 2 mm width. The single nozzle laboratory printer used in the Phase 1 program is capable of printing {approx} 100 um wide single filaments at a rate of 8-10 cm/sec. The electrical stabilization of filaments with a Ag ink was also evaluated using ink-jet printing. The overall objective of the Phase 1 Project was the evaluation and demonstration of inkjet-printing for depositing YBCO filaments on textured templates (RABiTS, IBAD, ISD, etc. substrates) with properties appropriate for low loss ac conductors. Goals of the Phase 1 program included development of an appropriate precursor ink, demonstration of the printing process, processing and characterization of printed YBCO filaments and evaluation of the process for further development.

  10. Load Carrying Capacity of Shear Wall T-Connections Reinforced with High Strength Wire Ropes

    DEFF Research Database (Denmark)

    Jørgensen, Henrik Brøner; Bryndum, Thor; Larsen, Michael

    2017-01-01

    Traditionally, U-bar loop connections with keyed joints have been used in vertical shear connections between precast concrete wall elements. However, in the recent years, connections with looped high strength wire ropes instead of U-bar loops have proven to be a much more construction-friendly so......Traditionally, U-bar loop connections with keyed joints have been used in vertical shear connections between precast concrete wall elements. However, in the recent years, connections with looped high strength wire ropes instead of U-bar loops have proven to be a much more construction......-friendly solution. The wire ropes have no bending stiffness and therefore allow for an easier vertical installation of the wall elements. During the last 10 – 15 years, a number of shear tests on plane wire rope connections have been carried out. However, to the best knowledge of the authors, tests on wire rope...... connections for assembly of precast elements in different planes, such as T- and L-connections, have not yet been published. This paper presents the results of a large test series recently conducted at the University of Southern Denmark to study the shear behaviour of high strength wire rope T...

  11. Load carrying capacity of shear wall t-connections reinforced with high strength wire ropes

    DEFF Research Database (Denmark)

    Jørgensen, Henrik B.; Bryndom, Thor; Larsen, Michael

    2016-01-01

    Traditionally, U-bar loop connections with keyed joints have been used in vertical shear connections between precast concrete wall elements. However, in the recent years, connections with looped high strength wire ropes instead of U-bar loops have proven to be a much more construction-friendly so......Traditionally, U-bar loop connections with keyed joints have been used in vertical shear connections between precast concrete wall elements. However, in the recent years, connections with looped high strength wire ropes instead of U-bar loops have proven to be a much more construction......-friendly solution. The wire ropes have no bending stiffness and therefore allow for an easier vertical installation of the wall elements. During the last 10 – 15 years, a number of shear tests on plane wire rope connections have been carried out. However, to the best knowledge of the authors, tests on wire rope...... connections for assembly of precast elements in different planes, such as T- and L-connections, have not yet been published. This paper presents the results of a large test series recently conducted at the University of Southern Denmark to study the shear behaviour of high strength wire rope T...

  12. Roebel assembled coated conductor cables (RACC): Ac-Losses and current carrying potential

    International Nuclear Information System (INIS)

    Frank, A; Heller, R; Goldacker, W; Kling, A; Schmidt, C

    2008-01-01

    Low ac-loss HTS cables for transport currents well above 1 kA are required for application in transformers and generators and are taken into consideration for future generations of fusion reactor coils. Coated conductors (CC) are suitable candidates for high field application at an operation temperature in the range 50-77 K. Ac-field applications require cables with low ac-losses and hence twisting of the individual strands. We solved this problem using the Roebel technique. Short lengths of Roebel bar cables were prepared from industrial DyBCO and YBCO-CC. Meander shaped tapes of 4 or 5 mm width with twist pitches of 123 or 127 mm were cut from the 10 or 12 mm wide CC tapes using a specially designed tool. Eleven or twelve of these strands were assembled to a cable. The electrical and mechanical connection of the tapes was achieved using a silver powder filled conductive epoxy resin. Ac-losses of a short sample in an external ac-field were measured as a function of frequency and field amplitude as well as the coupling current decay time constant. We discuss the results in terms of available theories and compare measured time constants in transverse field with measured coupling losses. Finally the potential of this cable type for ac-use is discussed with respect to ac-losses and current carrying capability

  13. AC-loss properties of Bi-2223 multifilamentary taped wires with a central insulation layer

    Energy Technology Data Exchange (ETDEWEB)

    Funaki, K., E-mail: funaki@sc.kyushu-u.ac.jp [Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Nogami, K.; Kawasaki, M.; Iwakuma, M. [Kyushu University, 744 Moto-oka, Nishi-ku, Fukuoka 819-0395 (Japan); Ayai, N.; Kobayashi, S.; Kikuchi, M.; Hayashi, K. [Sumitomo Electric Industries Ltd., 1-1-3, Shimaya, Konohana-ku, Osaka 554-0024 (Japan)

    2011-11-15

    We develop twisted Bi-2223 multifilamentary taped wires with a central insulator layer. We measure the AC losses in a perpendicular magnetic field configuration. The coupling loss will be decreased by effects of twisting and the central insulator layer. The hysteresis loss in filaments will be also decreased by effects of twisting. Further efforts will be expected for increase in the current capacity. We have been developing twisted Bi-2223 multifilamentary taped wires to suppress the AC losses in perpendicular-field configuration for industrial-production process. It is confirmed that the hysteretic losses in the filamentary region can be reduced by twisting in a same manner as in situ Nb{sub 3}Sn multifilamentary ones, while the coupling loss remains in unsatisfactory situation for commercial frequency uses. As one of practical methods for further reduction of the coupling loss, we propose an advanced multifilamentary structure of the taped wires in which an insulation layer is arranged in the central region of the tape to effectively restrict the main part of the coupling current in the perpendicular-field configuration instead of an insulation barrier around each filament that may be not usually suitable to the practical production process. We have designed and fabricated prototype wires with the proposed structure, and measured the AC loss properties in the perpendicular-field configuration. The experimental results suggest that the central insulation barrier has a function to suppress the coupling loss remarkably. We also discuss improvement in the structural design for the further reduction of the AC losses.

  14. Charged Particle Dynamics in the Magnetic Field of a Long Straight Current-Carrying Wire

    Science.gov (United States)

    Prentice, A.; Fatuzzo, M.; Toepker, T.

    2015-01-01

    By describing the motion of a charged particle in the well-known nonuniform field of a current-carrying long straight wire, a variety of teaching/learning opportunities are described: 1) Brief review of a standard problem; 2) Vector analysis; 3) Dimensionless variables; 4) Coupled differential equations; 5) Numerical solutions.

  15. Calibration of magnetic force microscopy tips by using nanoscale current-carrying parallel wires

    International Nuclear Information System (INIS)

    Kebe, Th.; Carl, A.

    2004-01-01

    Experimental results on the characterization of commercially available magnetic force microscopy (MFM) thin film tips as a function of an external magnetic field are presented. Magnetic stray fields with a definitive z-component (perpendicular to the substrate) and a magnetic field strength of up to H z =±45 Oe are produced with current carrying parallel nanowires with a thickness of t=60 nm, which are fabricated by electron-beam lithography. The magnetic fields are generated by electrical dc-currents of up to ±6 mA which are directed antiparallel through the nanowires. The geometry and the dimensions of the nanowires are systematically varied by choosing different wire widths w as well as separations b between the parallel wires for two different sets of samples. On the one hand, the wire width w is varied within 380 nm< w<2460 nm while the separation b≅450 nm between the wires is kept constant. On the other hand the separation b between the parallel wires is varied within 120 nm< b<5100 nm, while the wire width w=960 nm is kept constant. For all the geometrical configurations of parallel wires the resulting magnetic contrast is imaged by MFM at various tip lift-heights. By treating the MFM tip as a point probe, the analysis of the image contrast as a function of both the magnetic field strength and the tip lift height allows one to quantitatively determine the effective magnetic dipole and monopole moments of the tip as well as their imaginary locations within the real physical tip. Our systematic study quantitatively relates the above point-probe parameters to (i) the dimensions of the parallel wires and (ii) to the characteristic decay length of the z-component of the magnetic field of parallel wires. From this the effective tip-volume of the real thin film tip is determined which is relevant in MFM-imaging. Our results confirm the reliability of earlier tip calibration schemes for which nanofabricated current carrying rings were used instead of parallel

  16. Experimental study on the effects of AC electric fields on flame spreading over polyethylene-insulated electric-wire

    KAUST Repository

    Jin, Young Kyu

    2010-11-01

    In this present study, we experimentally investigated the effects of electric fields on the characteristics of flames spreading over electric-wires with AC fields. The dependence of the rate at which a flame spreads over polyethylene-insulated wires on the frequency and amplitude of the applied AC electric field was examined. The spreading of the flame can be categorized into linear spreading and non-linearly accelerated spreading of flame. This categorization is based on the axial distribution of the field strength of the applied electric field. The rate at which the flame spreads is highly dependent on the inclined direction of the wire fire. It could be possible to explain the spreading of the flame on the basis of thermal balance. © 2010 The Korean Society of Mechanical Engineers.

  17. Experimental Study on Downwardly Spreading Flame over Inclined Polyethylene-insulated Electrical Wire with Applied AC Electric Fields

    KAUST Repository

    Lim, Seung Jae

    2014-12-30

    An experimental study on downwardly spreading flame over slanted electrical wire, which is insulated by Polyethylene (PE), was conducted with applied AC electric fields. The result showed that the flame spread rate decreased initially with increase in inclination angle of wire and then became nearly constant. The flame shape was modified significantly with applied AC electric field due to the effect of ionic wind. Such a variation in flame spread rate could be explained by a thermal balance mechanism, depending on flame shape and slanted direction of flame. Extinction of the spreading flame was not related to angle of inclination, and was described well by a functional dependency upon the frequency and voltage at extinction.

  18. Load Carrying Capacity of Keyed Joints Reinforced with High Strength Wire Rope Loops

    DEFF Research Database (Denmark)

    Jørgensen, Henrik Brøner; Hoang, Linh Cao

    Vertical shear connections between precast concrete wall elements are usually made as keyed joints reinforced with overlapping U-bars. The overlapping U-bars form a cylindrical core in which the locking bar is placed and the connection is subsequently grouted with mortar. A more construction...... friendly shear connection can be obtained by replacing the U-bars with high strength looped wire ropes. The wire ropes have the advantage of being flexible (they have virtually no bending stiffness) which makes installation of wall elements much easier. The looped wire ropes are usually pre-installed in so...

  19. Carry

    DEFF Research Database (Denmark)

    Koijen, Ralph S.J.; Moskowitz, Tobias J.; Heje Pedersen, Lasse

    that include global equities, global bonds, currencies, commodities, US Treasuries, credit, and equity index options. This predictability underlies the strong returns to "carry trades" that go long high-carry and short low-carry securities, applied almost exclusively to currencies, but shown here...

  20. Load carrying capacity of keyed joints reinforced with high strength wire rope loops

    DEFF Research Database (Denmark)

    Jørgensen, Henrik B.; Hoang, Linh Cao

    2015-01-01

    -called wire boxes which are embedded in the precast wall elements. Once the joint is grouted with mortar, the boxes will function as shear keys and the overlapping wire loops will function as transverse reinforcement that replaces the U-bars. This paper presents a rigid-plastic upper bound model to determine......, so-called multi-body mechanisms have to be considered. It is shown that calculations based on multi-body mechanisms lead to results that agree well with experiments....

  1. On the possibility of a relativistic correction to the E and B fields around a current-carrying wire

    International Nuclear Information System (INIS)

    Folman, Ron

    2013-01-01

    It is well known that electric and magnetic fields may change when they are observed from different frames of reference. For example, the motion of a charged probe particle moving parallel to a current-carrying wire would be described by utilizing different electric or magnetic fields, depending on from which frame of reference the system is observed and described. To describe the situation in all frames by utilizing the theory of relativity, one has to first describe the situation in one particular frame, and this choice in the case of a current-carrying wire is the topic of this paper. Specifically, I consider the question of in which frame the current carrying wire is neutral. The importance of relaxation processes is emphasized. As an example, I examine a specific alternative to the standard choice, and consider its theoretical and experimental validity. An outcome of alternative approaches is that in the rest frame of a wire, running a current introduces also an electric field by giving rise to a minute charge. Present day experimental sensitivities, specifically those of cold ions, may be able to differentiate between the observable signatures predicted by the different approaches.

  2. Carry

    DEFF Research Database (Denmark)

    Koijen, Ralph S.J.; Moskowitz, Tobias; Pedersen, Lasse Heje

    2018-01-01

    -sectionally and in time series for a host of different asset classes, including global equities, global bonds, commodities, US Treasuries, credit, and options. Carry is not explained by known predictors of returns from these asset classes, and it captures many of these predictors, providing a unifying framework...... for return predictability. We reject a generalized version of Uncovered Interest Parity and the Expectations Hypothesis in favor of models with varying risk premia, in which carry strategies are commonly exposed to global recession, liquidity, and volatility risks, though none fully explains carry’s premium....

  3. Reply to 'Comment on 'Lorentz contraction and current-carrying wires''

    International Nuclear Information System (INIS)

    Van Kampen, Paul

    2010-01-01

    This reply answers the issues raised in the Comment on my paper (van Kampen 2008 Eur. J. Phys. 29 879-83). The error of applying a single Lorentz transformation to a wire segment is discussed in some detail. (letters and comments)

  4. Magnetic Field Due to a Finite Length Current-Carrying Wire Using the Concept of Displacement Current

    Science.gov (United States)

    Buschauer, Robert

    2014-01-01

    In undergraduate E&M courses the magnetic field due to a finite length, current-carrying wire can be calculated using the Biot-Savart law. However, to the author's knowledge, no textbook presents the calculation of this field using the Ampere-Maxwell law: ?B [multiplied by] dl = µ[subscript 0] (I + e[subscript 0] dF/dt) [multiplied by] 1

  5. Numerical modelling of ac limiting properties of a bare MgB2 wire in liquid neon bath

    International Nuclear Information System (INIS)

    Majoros, M; Sumption, M D

    2008-01-01

    MgB 2 material may be used in fault current limiters as a cheaper alternative to high-temperature superconductors. Numerical modeling of ac limiting properties of a bare MgB 2 wire in liquid neon bath has been performed using finite element software. Two 2D ac Poisson equations for electric field and heat transfer were solved simultaneously with input parameters taken from experiment. As a boundary condition the full non-linear curve of the heat flux into liquid neon was used. Influence of different values and durations of fault electric fields has been studied and maximum temperatures, limiting currents and recovery times calculated. Overheating effects on dc current-voltage characteristics were also modeled. Obtained results may be useful for understanding the behaviors of MgB 2 in conditions encountered in fault current limiters

  6. Flux Pinning and AC Loss in Second Generation High Temperature Superconductor Wires

    Energy Technology Data Exchange (ETDEWEB)

    Paranthaman, Mariappan Parans [ORNL; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Major advances have been made in the last 18 years in high-temperature superconductor (HTS) reserach and development, resulting in increased use of HTS materials in commerical and pre-commercial electric-power applications. This new and important book addresses the issues related to flux pinning, AC losses and thick YBCO film growth. Written by top most scientists in the world, it presents the current status and issues related to YBCO coated conductors and the need for further fundamental materials science work in YBCO coated conductor. It will be a useful handbook for years to come.

  7. Influences of the Bi2Sr2CaCu2Ox/Ag interface and interfilamentary bridge connections on AC loss of composite wires

    Science.gov (United States)

    Jiang, Zhao-Fei; Xue, Feng; Gou, Xiao-Fan

    2018-04-01

    The microstructure of Bi2Sr2CaCu2Ox (Bi2212) filamentary composite round wires (RWs) changes to be extremely complicated after heat treatment, with the interface between Bi2212 filaments and Ag matrix being meandering and a lot of bridge connections (BCs) generating between filaments. The influence of such the unique microstructure on the electromagnetic behavior and especially the AC loss has not been far from completely understanding. In this paper, according to the H formulation and on the nonlinear E-J relationship, we developed a finite element model, and further on this model evaluated the current and AC loss of a Bi2212 multifilamentary wire with the rough Bi2212/Ag interface and several BCs between filaments under the alternating magnetic field (Hex(t) = H0sin2πft). Through the comparative study, we found that the penetration magnetic field Hp is a critical turning point and on this base the influences of such the complex microstructure are quite different when the amplitude of applied magnetic field H0 Hp. The rough interface impacts the current distribution and causes the local heat concentrated at the concave locations. For BCs between Bi2212 filaments, it is most significant that they can share the current and make the current redistribute between filaments. Further for the wire with various types of BCs, the current distribution and the AC loss relative to the wire without BCs (Q / QmagnoBCs) were comprehensively investigated.

  8. Flame spread over electrical wire with AC electric fields: Internal circulation, fuel vapor-jet, spread rate acceleration, and molten insulator dripping

    KAUST Repository

    Lim, Seungjae

    2015-04-01

    The effect of electric field on the characteristics of flame spread along a polyethylene (PE) insulated electrical wire was investigated experimentally by varying the AC frequency and voltage applied to the wire. The results showed that the flame spread rate was accelerated due to the convergence of electric flux near the end of wire, having three distinct regimes depending on applied voltage. In each regime, several subregimes could be identified depending on AC frequency. Flame shape (height and width) and slanted direction of the spreading flame were influenced differently. Fuel-vapor jets were ejected from the molten PE surface even for the baseline case without the application of an electric field; this could be attributed to the bursting of fuel vapor bubbles generated from internal boiling at the molten PE surface. An internal circulation of molten-PE was also observed as a result of non-uniform heating by the spreading flame. In the high voltage regime with a high AC frequency, excessive dripping of molten PE led to flame extinction.

  9. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  10. Coupling Current and Hysteresis Losses of Bi2212 Round Wires with Twisted Filaments

    CERN Document Server

    Yang, I; Young, EA; Falorio, I; Ballarino, A; Bottura, L; Miao, H; Huang, Y

    2015-01-01

    AC loss measurements have been carried out on Bi2212 round wires of different twist pitches. With systematical variation of sample temperature (5 K – 70 K) and ac field amplitude (≤0.2 T) as well as frequency (20 Hz – 2 kHz), this work shows (a) the full coupling of the non-twisted wire, (b) the uncoupling of sub-wires by twisting at moderate pitch up to 12 mm, (c) a relatively short time constant of milliseconds for the coupling current due to a high transverse resistivity, and (d) an effective (de)coupling diameter of 0.4mm about 1.6x of sub-wire bundles. The results suggest a promising potential for improving filament decoupling.

  11. Basic Wiring.

    Science.gov (United States)

    Kaltwasser, Stan; And Others

    This module is the first in a series of three wiring publications; it serves as the foundation for students enrolled in a wiring program. It is a prerequisite to either "Residential Wiring" or "Commercial and Industrial Wiring." The module contains 16 instructional units that cover the following topics: occupational…

  12. Photovoltaic system with improved AC connections and method of making same

    Energy Technology Data Exchange (ETDEWEB)

    Cioffi, Philip Michael; Todorovic, Maja Harfman; Herzog, Michael Scott; Korman, Charles Steven; Doherty, Donald M.; Johnson, Neil Anthony

    2018-02-13

    An alternating current (AC) harness for a photovoltaic (PV) system includes a wire assembly having a first end and a second end, the wire assembly having a plurality of lead wires, and at least one AC connection module positioned at a location along a length of the wire assembly between the first end and the second end. Further, the at least one AC connection module includes a first connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a first PV module of the PV system. The at least one AC connection module also includes a second connection terminal electrically coupled to the plurality of lead wires of the wire assembly and constructed to electrically couple the wire assembly with an output of a second PV module of the PV system.

  13. Wire Chamber

    CERN Multimedia

    Magnetoscriptive readout wire chamber. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  14. Wire chamber

    CERN Multimedia

    1967-01-01

    Magnetoscriptive readout wire chamber.Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  15. wire chamber

    CERN Multimedia

    Proportional multi-wire chamber. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle. Proportional wire chambers allow a much quicker reading than the optical or magnetoscriptive readout wire chambers.

  16. wire chamber

    CERN Multimedia

    Was used in ISR (Intersecting Storage Ring) split field magnet experiment. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  17. Wire chamber

    CERN Multimedia

    Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  18. wire chamber

    CERN Multimedia

    Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  19. wire chamber

    CERN Multimedia

    1985-01-01

    Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  20. Superconducting ac cable

    International Nuclear Information System (INIS)

    Schmidt, F.

    1980-01-01

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.) [de

  1. Wiring and lighting

    CERN Document Server

    Kitcher, Chris

    2013-01-01

    Wiring and Lighting provides a comprehensive guide to DIY wiring around the home. It sets out the regulations and legal requirements surrounding electrical installation work, giving clear guidelines that will enable the reader to understand what electrical work they are able to carry out, and what the testing and certification requirements are once the work is completed. Topics covered include: Different types of circuits; Types of cables and cable installation under floors and through joists; Isolating, earthing and bonding; Accessory boxes and fixings; Voltage bands; Detailed advice on safe

  2. Carrying Capacity

    DEFF Research Database (Denmark)

    Schroll, Henning; Andersen, Jan; Kjærgård, Bente

    2012-01-01

    A spatial planning act was introduced inIndonesia 1992 and renewed in 2008. It emphasised the planning role of decentralised authorities. The spatial planning act covers both spatial and environmental issues. It defines the concept of carrying capacity and includes definitions of supportive....../cities. Four different sectors (water, food production, waste, and forests) were selected as core areas for decentralised spatial planning. Indicators for SCC and ACC were identified and assessed with regard to relevance and quantifiability. For each of the indicators selected, a legal threshold or guiding...... was introduced inIndonesia 1992 and renewed in 2008. It emphasised the planning role of decentralised authorities. The spatial planning act covers both spatial and environmental issues. It defines the concept of carrying capacity and includes definitions of supportive carrying capacity (SCC) and assimilative...

  3. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    International Nuclear Information System (INIS)

    Jarvis, P.; Belzile, F.; Page, T.; Dean, C.

    1997-01-01

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  4. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  5. Noncontextual Wirings

    Science.gov (United States)

    Amaral, Barbara; Cabello, Adán; Cunha, Marcelo Terra; Aolita, Leandro

    2018-03-01

    Contextuality is a fundamental feature of quantum theory necessary for certain models of quantum computation and communication. Serious steps have therefore been taken towards a formal framework for contextuality as an operational resource. However, the main ingredient of a resource theory—a concrete, explicit form of free operations of contextuality—was still missing. Here we provide such a component by introducing noncontextual wirings: a class of contextuality-free operations with a clear operational interpretation and a friendly parametrization. We characterize them completely for general black-box measurement devices with arbitrarily many inputs and outputs. As applications, we show that the relative entropy of contextuality is a contextuality monotone and that maximally contextual boxes that serve as contextuality bits exist for a broad class of scenarios. Our results complete a unified resource-theoretic framework for contextuality and Bell nonlocality.

  6. Frequency- and axial-field-dependent circular magnetization reversal in a stress-annealed Fe-based nanocrystalline wire

    International Nuclear Information System (INIS)

    Li, Y.F.; Vazquez, M.; Yin, S.Z.

    2009-01-01

    Absract: After suitable annealing under a tensile stress, Fe 73.5 Cu 1 Nb 3 Si 13.5 B 9 amorphous wire becomes the nano-structured material together with a transverse anisotropy field H k =-3.2 kA/m. Its circular permeability, μ=μ'-jμ'', was determined from the measurements of the impedance, as a function of the frequency (f=333-33,333 Hz) and amplitude (I AC =0.1-100 mA) of AC current and the axially applied DC field (H=0-89 kA/m). We found that the circular technical magnetization of this sample carried out by the spontaneous domain nucleation process. The influences of the AC current frequency and the axial DC field on the circular magnetization have been studied

  7. Development of a Nb 3Sn multifilamentary wire for accelerator magnet applications

    Science.gov (United States)

    Durante, M.; Bredy, P.; Devred, A.; Otmani, R.; Reytier, M.; Schild, T.; Trillaud, F.

    2001-05-01

    CEA/Saclay and Alstom/MSA have carried out a program to develop a Nb 3Sn multifilamentary wire for accelerator magnet applications relying on the internal-tin process. The main wire specifications are: an overall diameter of 0.825 mm, a critical current larger than 405 A at 4.2 K and 7 T, hysteresis losses lower than 450 mJ/cm 3 for a±3 T trapezoidal cycle, and a copper-to-non-copper ratio greater than 1. The last phase of the optimization program was based on four different strands and we present here the results of the characterization tests, including residual resistivity ratio, critical current and AC loss measurements.

  8. Stretched Wire Mechanics

    Energy Technology Data Exchange (ETDEWEB)

    Bowden, Gordon; /SLAC

    2005-09-06

    Stretched wires are beginning to play an important role in the alignment of accelerators and synchrotron light sources. Stretched wires are proposed for the alignment of the 130 meter long LCLS undulator. Wire position technology has reached sub-micron resolution yet analyses of perturbations to wire straightness are hard to find. This paper considers possible deviations of stretched wire from the simple 2-dimensional catenary form.

  9. Development of Lightning-Resistant Overhead Ground Wire for Large-size Transmission Lines

    Science.gov (United States)

    Taniguchi, Sakae; Nagaraki, Yoshimi; Takami, Jun; Okabe, Shigemitsu; Saito, Toshiyuki; Nagano, Koji; Goda, Yutaka

    The overhead ground wire of AC 150mm2 is applied for the large-size transmission lines. According to inspections of transmission lines, melted component wires of AC 150mm2 have been found in some parts of 500kV transmission lines and it is obvious that the damages have been caused by lightning. Hence, the authors have developed lightning-resistant overhead ground wires as well as being evaluated lightning-resistant performance of the conventional AC 150mm2. In the paper, firstly, it is reported on the lightning performance of the conventional AC 150mm2 resulting from a DC arc test which is considered the polarity of currents and injected current waveforms for summer and winter lightning. As a result, the least amount of electric charges which can melt the components of the conventional wire was 180C. Then, the paper outlines the improvement of lightning performance of the overhead ground wire. Some kinds of developed ground wires as a trial piece have been proposed and tested, and here presented the characteristics of two typical developed wires among them. One is coated with conductive ceramic on the outer components and the another is enlarged a diameter of outer components. Both types of the wires show the excellent lightning performance from the DC arc test, comparing with the conventional ground wire of AC 150mm2.

  10. A tentative opinion of modeling plasma formation in metallic wire Z pinch

    International Nuclear Information System (INIS)

    Ding Ning

    2002-01-01

    Numerous experiments in both single wire and in wire arrays have attracted much attention. For the wire array Z-pinch implosions the plasma formation in the metallic wire Z pinches is a key question. By means of analyzing a number of single-wire and multi-wire experiments, two models to describe the behavior of a wire array Z-pinch in initial phase are suggested. In this phase each wire carries a rising current and behaves independently in a way similar to that found in single wire Z-pinch experiments in which a comparable current in one wire is employed. Based on one- or/and two-dimensional magnetohydrodynamics (MHD) theory, one model is used to simulate the electrical explosion stage of the metallic wire, another is used to simulate the wire-plasma formation stage

  11. Wire bonding in microelectronics

    CERN Document Server

    Harman, George G

    2010-01-01

    Wire Bonding in Microelectronics, Third Edition, has been thoroughly revised to help you meet the challenges of today's small-scale and fine-pitch microelectronics. This authoritative guide covers every aspect of designing, manufacturing, and evaluating wire bonds engineered with cutting-edge techniques. In addition to gaining a full grasp of bonding technology, you'll learn how to create reliable bonds at exceedingly high yields, test wire bonds, solve common bonding problems, implement molecular cleaning methods, and much more. Coverage includes: Ultrasonic bonding systems and technologies, including high-frequency systems Bonding wire metallurgy and characteristics, including copper wire Wire bond testing Gold-aluminum intermetallic compounds and other interface reactions Gold and nickel-based bond pad plating materials and problems Cleaning to improve bondability and reliability Mechanical problems in wire bonding High-yield, fine-pitch, specialized-looping, soft-substrate, and extreme-temperature wire bo...

  12. Inverter design for four-wire microgrids

    OpenAIRE

    Heredero Peris, Daniel; Pagès Giménez, Marc; Montesinos Miracle, Daniel

    2015-01-01

    This paper presents a PQ four quadrant four-wire three-phase inverter for microgrids integration. The inverter is based in two full-bridge IGBT modules connected in a three-phase configuration plus a threephase parallelized neutral branch. This topology is galvanically isolated through a single-phase transformer bank. The converter operates as a non-ideal voltage-controlled voltage source inverter under AC droop strategy with hot-swap capability based on a dynamic virtual impedance.

  13. Water Desalination with Wires

    NARCIS (Netherlands)

    Porada, S.; Sales, B.B.; Hamelers, H.V.M.; Biesheuvel, P.M.

    2012-01-01

    We show the significant potential of water desalination using a novel capacitive wire-based technology in which anode/cathode wire pairs are constructed from coating a thin porous carbon electrode layer on top of electrically conducting rods (or wires). By alternately dipping an array of electrode

  14. Low AC-Loss Superconducting Cable Technology for Electric Aircraft Propulsion, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...

  15. Fine-Filament MgB2 Superconductor Wire

    Science.gov (United States)

    Cantu, Sherrie

    2015-01-01

    Hyper Tech Research, Inc., has developed fine-filament magnesium diboride (MgB2) superconductor wire for motors and generators used in turboelectric aircraft propulsion systems. In Phase I of the project, Hyper Tech demonstrated that MgB2 multifilament wires (superconductor and engineering current density and AC losses. Hyper Tech also fabricated MgB2 rotor coil packs for a superconducting generator. The ultimate goal is to enable low-cost, round, lightweight, low-AC-loss superconductors for motor and generator stator coils operating at 25 K in next-generation turboelectric aircraft propulsion systems.

  16. PS wire chamber

    CERN Document Server

    1970-01-01

    A wire chamber used at CERN's Proton Synchrotron accelerator in the 1970s. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  17. Peltier ac calorimeter

    OpenAIRE

    Jung, D. H.; Moon, I. K.; Jeong, Y. H.

    2001-01-01

    A new ac calorimeter, utilizing the Peltier effect of a thermocouple junction as an ac power source, is described. This Peltier ac calorimeter allows to measure the absolute value of heat capacity of small solid samples with sub-milligrams of mass. The calorimeter can also be used as a dynamic one with a dynamic range of several decades at low frequencies.

  18. Heat Transfer Analysis in Wire Bundles for Aerospace Vehicles

    Science.gov (United States)

    Rickman, S. L.; Iamello, C. J.

    2016-01-01

    Design of wiring for aerospace vehicles relies on an understanding of "ampacity" which refers to the current carrying capacity of wires, either, individually or in wire bundles. Designers rely on standards to derate allowable current flow to prevent exceedance of wire temperature limits due to resistive heat dissipation within the wires or wire bundles. These standards often add considerable margin and are based on empirical data. Commercial providers are taking an aggressive approach to wire sizing which challenges the conventional wisdom of the established standards. Thermal modelling of wire bundles may offer significant mass reduction in a system if the technique can be generalized to produce reliable temperature predictions for arbitrary bundle configurations. Thermal analysis has been applied to the problem of wire bundles wherein any or all of the wires within the bundle may carry current. Wire bundles present analytical challenges because the heat transfer path from conductors internal to the bundle is tortuous, relying on internal radiation and thermal interface conductance to move the heat from within the bundle to the external jacket where it can be carried away by convective and radiative heat transfer. The problem is further complicated by the dependence of wire electrical resistivity on temperature. Reduced heat transfer out of the bundle leads to higher conductor temperatures and, hence, increased resistive heat dissipation. Development of a generalized wire bundle thermal model is presented and compared with test data. The steady state heat balance for a single wire is derived and extended to the bundle configuration. The generalized model includes the effects of temperature varying resistance, internal radiation and thermal interface conductance, external radiation and temperature varying convective relief from the free surface. The sensitivity of the response to uncertainties in key model parameters is explored using Monte Carlo analysis.

  19. FINE-FILAMENT MAGNESIUM DIBORIDE SUPERCONDUCTOR WIRE FOR TURBOELECTRIC PROPULSION SYSTEMS, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — The availability of low AC loss magnesium diboride (MgB2) superconducting wires enables much lighter weight superconducting stator coils than with any other metal or...

  20. ACAC Converters for UPS

    Directory of Open Access Journals (Sweden)

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  1. Towards plant wires

    OpenAIRE

    Adamatzky, Andrew

    2014-01-01

    In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self...

  2. Photovoltaic Wire, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project will investigate a new architecture for photovoltaic devices based on nanotechnology: photovoltaic wire. The...

  3. Photovoltaic Wire Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This Small Business Innovation Research Phase I project will investigate a new architecture for photovoltaic devices based on nanotechnology: photovoltaic wire. The...

  4. Charpak hemispherical wire chamber

    CERN Document Server

    1970-01-01

    pieces. Mesures are of the largest one. Multi-wire detectors contain layers of positively and negatively charged wires enclosed in a chamber full of gas. A charged particle passing through the chamber knocks negatively charged electrons out of atoms in the gas, leaving behind positive ions. The electrons are pulled towards the positively charged wires. They collide with other atoms on the way, producing an avalanche of electrons and ions. The movement of these electrons and ions induces an electric pulse in the wires which is collected by fast electronics. The size of the pulse is proportional to the energy loss of the original particle.

  5. 1998 wire development workshop proceedings

    International Nuclear Information System (INIS)

    1998-04-01

    This report consists of vugraphs of the presentations at the conference. The conference was divided into the following sessions: (1) First Generation Wire Development: Status and Issues; (2) First Generation Wire in Pre-Commercial Prototypes; (3) Second Generation Wire Development: Private Sector Progress and Issues; (4) Second Generation Wire Development: Federal Laboratories; and (5) Fundamental Research Issues for HTS Wire Development

  6. Modern trends of aircraft fly-by-wire systems

    Directory of Open Access Journals (Sweden)

    С. С. Юцкевич

    2013-07-01

    Full Text Available Specifics of civil aviation modern transport aircraft fly-by-wire control systems are described. A comparison of the systems-level hardware and software, expressed through modes of guidance, provision of aircraft Airbus A-320, Boeing B-777, Tupolev Tu-214, Sukhoi Superjet SSJ-100 are carried out. The possibility of transition from mechanical control wiring to control through fly-by-wire system in the backup channel is shown.

  7. Wire Array Photovoltaics

    Science.gov (United States)

    Turner-Evans, Dan

    Over the past five years, the cost of solar panels has dropped drastically and, in concert, the number of installed modules has risen exponentially. However, solar electricity is still more than twice as expensive as electricity from a natural gas plant. Fortunately, wire array solar cells have emerged as a promising technology for further lowering the cost of solar. Si wire array solar cells are formed with a unique, low cost growth method and use 100 times less material than conventional Si cells. The wires can be embedded in a transparent, flexible polymer to create a free-standing array that can be rolled up for easy installation in a variety of form factors. Furthermore, by incorporating multijunctions into the wire morphology, higher efficiencies can be achieved while taking advantage of the unique defect relaxation pathways afforded by the 3D wire geometry. The work in this thesis shepherded Si wires from undoped arrays to flexible, functional large area devices and laid the groundwork for multijunction wire array cells. Fabrication techniques were developed to turn intrinsic Si wires into full p-n junctions and the wires were passivated with a-Si:H and a-SiNx:H. Single wire devices yielded open circuit voltages of 600 mV and efficiencies of 9%. The arrays were then embedded in a polymer and contacted with a transparent, flexible, Ni nanoparticle and Ag nanowire top contact. The contact connected >99% of the wires in parallel and yielded flexible, substrate free solar cells featuring hundreds of thousands of wires. Building on the success of the Si wire arrays, GaP was epitaxially grown on the material to create heterostructures for photoelectrochemistry. These cells were limited by low absorption in the GaP due to its indirect bandgap, and poor current collection due to a diffusion length of only 80 nm. However, GaAsP on SiGe offers a superior combination of materials, and wire architectures based on these semiconductors were investigated for multijunction

  8. An MRI-Compatible High Frequency AC Resistive Heating System for Homeothermic Maintenance in Small Animals.

    Science.gov (United States)

    Gilchrist, Stuart; Gomes, Ana L; Kinchesh, Paul; Kersemans, Veerle; Allen, Philip D; Smart, Sean C

    2016-01-01

    To develop an MRI-compatible resistive heater, using high frequency alternating current (AC), for temperature maintenance of anaesthetised animals. An MRI-compatible resistive electrical heater was formed from narrow gauge wire connected to a high frequency (10-100 kHz) AC power source. Multiple gradient echo images covering a range of echo times, and pulse-acquire spectra were acquired with the wire heater powered using high frequency AC or DC power sources and without any current flowing in order to assess the sensitivity of the MRI acquisitions to the presence of current flow through the heater wire. The efficacy of temperature maintenance using the AC heater was assessed by measuring rectal temperature immediately following induction of general anaesthesia for a period of 30 minutes in three different mice. Images and spectra acquired in the presence and absence of 50-100 kHz AC through the wire heater were indistinguishable, whereas DC power created field shifts and lineshape distortions. Temperature lost during induction of anaesthesia was recovered within approximately 20 minutes and a stable temperature was reached as the mouse's temperature approached the set target. The AC-powered wire heater maintains adequate heat input to the animal to maintain body temperature, and does not compromise image quality.

  9. An MRI-Compatible High Frequency AC Resistive Heating System for Homeothermic Maintenance in Small Animals.

    Directory of Open Access Journals (Sweden)

    Stuart Gilchrist

    Full Text Available To develop an MRI-compatible resistive heater, using high frequency alternating current (AC, for temperature maintenance of anaesthetised animals.An MRI-compatible resistive electrical heater was formed from narrow gauge wire connected to a high frequency (10-100 kHz AC power source. Multiple gradient echo images covering a range of echo times, and pulse-acquire spectra were acquired with the wire heater powered using high frequency AC or DC power sources and without any current flowing in order to assess the sensitivity of the MRI acquisitions to the presence of current flow through the heater wire. The efficacy of temperature maintenance using the AC heater was assessed by measuring rectal temperature immediately following induction of general anaesthesia for a period of 30 minutes in three different mice.Images and spectra acquired in the presence and absence of 50-100 kHz AC through the wire heater were indistinguishable, whereas DC power created field shifts and lineshape distortions. Temperature lost during induction of anaesthesia was recovered within approximately 20 minutes and a stable temperature was reached as the mouse's temperature approached the set target.The AC-powered wire heater maintains adequate heat input to the animal to maintain body temperature, and does not compromise image quality.

  10. Automating wiring formboard design

    NARCIS (Netherlands)

    Van den Berg, T.

    2013-01-01

    Increase in aircraft wiring complexity call for manufacturing design improvements to reduce cost and lead-time. To achieve such improvements, a joint research project was performed by the Flight Performance and Propulsion (FPP) group and Fokker Elmo BV, the second largest aircraft wiring harness

  11. 46 CFR 120.340 - Cable and wiring requirements.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cable and wiring requirements. 120.340 Section 120.340 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS CARRYING MORE... INSTALLATION Power Sources and Distribution Systems § 120.340 Cable and wiring requirements. (a) If individual...

  12. AC power supply systems

    International Nuclear Information System (INIS)

    Law, H.

    1987-01-01

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  13. ACS Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2005-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes. The reason for this is that the ACS calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS images of the omega Cen standard field with all nine broadband ACS/WFC filters. This will permit the direct determination of the ACS zero points by comparison with excellent ground-based photometry, and should reduce their uncertainties to less than 0.01 magnitudes. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager. Finally, three of the filters will be repeated from my Cycle 12 observations, allowing for a measurement of any change in sensitivity.

  14. Thermosonic wire bonding of IC devices using palladium wire

    International Nuclear Information System (INIS)

    Shze, J.H.; Poh, M.T.; Tan, R.M.

    1996-01-01

    The feasibility of replacing gold wire by palladium wire in thermosonic wire bonding of CMOS and bipolar devices are studied in terms of the manufacturability, physical, electrical and assembly performance. The results that palladium wire is a viable option for bonding the bipolar devices but not the CMOS devices

  15. Towards plant wires.

    Science.gov (United States)

    Adamatzky, Andrew

    2014-08-01

    In experimental laboratory studies we evaluate a possibility of making electrical wires from living plants. In scoping experiments we use lettuce seedlings as a prototype model of a plant wire. We approximate an electrical potential transfer function by applying direct current voltage to the lettuce seedlings and recording output voltage. We analyse oscillation frequencies of the output potential and assess noise immunity of the plant wires. Our findings will be used in future designs of self-growing wetware circuits and devices, and integration of plant-based electronic components into future and emergent bio-hybrid systems. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  16. Investigation of method for Stainless Steel Welding Wire as a Replacement for Arc Wire Comsumables

    Directory of Open Access Journals (Sweden)

    Koiprasert, H.

    2005-01-01

    Full Text Available Arc spraying as a coating method is being employed in various industrial applications as a part of maintenance service, and also as a surface engineering technique for many machine parts and components. The major cost in producing the arc spray coating is, however, based on the cost of the arc wire comsumables. This project was carried out to investigate the use of the commercially-available gas metal arc welding wire (GMAW wire as a cheaper alternative to the special-purpose arc wire comsumables. The wire material chosen for this early study is the 316L stainless steel, due to its popularity in many applications as a built-up coating for worn parts. The physical properties of the coatings produced from the two sets of 316L stainless steel wire were determined to be different in the percentage of porosity and the oxide content. The mechanical properties, including the tensile bond strength and the wear rate of the coatings produced from the two types of sprayed wire, were also different. This will, in turn, result in a slight difference in the performance of thecoatings.

  17. Cryogenic Pressure Seal for Wires

    Science.gov (United States)

    Ciana, J. J.

    1984-01-01

    High-pressure-seal formed by forcing polyurethane into space surrounding wire or cable in special fitting. Wire or cable routed through fitting then through a tightly fitting cap. Wire insulation left intact. Cap filled with sealant and forced onto the fitting: this pushes sealant into fitting so it seals wire or cable in fitting as well as in cap.

  18. Copper wire bonding

    CERN Document Server

    Chauhan, Preeti S; Zhong, ZhaoWei; Pecht, Michael G

    2014-01-01

    This critical volume provides an in-depth presentation of copper wire bonding technologies, processes and equipment, along with the economic benefits and risks.  Due to the increasing cost of materials used to make electronic components, the electronics industry has been rapidly moving from high cost gold to significantly lower cost copper as a wire bonding material.  However, copper wire bonding has several process and reliability concerns due to its material properties.  Copper Wire Bonding book lays out the challenges involved in replacing gold with copper as a wire bond material, and includes the bonding process changes—bond force, electric flame off, current and ultrasonic energy optimization, and bonding tools and equipment changes for first and second bond formation.  In addition, the bond–pad metallurgies and the use of bare and palladium-coated copper wires on aluminum are presented, and gold, nickel and palladium surface finishes are discussed.  The book also discusses best practices and re...

  19. Test and Evaluation of the Magnograph (TM) unit, a nondestructive wire rope tester

    Science.gov (United States)

    Underbakke, L. D.; Haynes, H. H.

    1982-07-01

    The nondestructive wire rope test device, a unitized AC/DC Magnograph, was tested for operational characteristics prior to acquisition by Naval field activities and start of inspection programs. The Magnograph was tested for loss of metallic area (LMA) and local fault (LF) detection accuracy. Wire ropes 1/2, 3/4, 1-1/8, 1-1/2, 2, and 2-1/2 inches in diameter were tested on a wire rope test track to find the accuracy of the unit. Two mining wire ropes, guy wires of a 1,000-ft-tall tower, and wire rope for 400-, 250-, and 30-ton cranes were used to determine operational characteristics of the Magnograph.

  20. Niobium Titanium and Copper wire samples

    CERN Multimedia

    2009-01-01

    Two wire samples, both for carrying 13'000Amperes. I sample is copper. The other is the Niobium Titanium wiring used in the LHC magnets. The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. Magnet coils are made of copper-clad niobium–titanium cables — each wire in the cable consists of 9’000 niobium–titanium filaments ten times finer than a hair. The cables carry up to 12’500 amps and must withstand enormous electromagnetic forces. At full field, the force on one metre of magnet is comparable ...

  1. Wired to freedom

    DEFF Research Database (Denmark)

    Jepsen, Kim Sune Karrasch; Bertilsson, Margareta

    2017-01-01

    dimension of life science through a notion of public politics adopted from the political theory of John Dewey. We show how cochlear implantation engages different social imaginaries on the collective and individual levels and we suggest that users share an imaginary of being “wired to freedom” that involves...... new access to social life, continuous communicative challenges, common practices, and experiences. In looking at their lives as “wired to freedom,” we hope to promote a wider spectrum of civic participation in the benefit of future life science developments within and beyond the field of Cochlear...

  2. Electric wiring domestic

    CERN Document Server

    Coker, A J

    1992-01-01

    Electric Wiring: Domestic, Tenth Edition, is a clear and reliable guide to the practical aspects of domestic electric wiring. Intended for electrical contractors, installation engineers, wiremen and students, its aim is to provide essential up to date information on modern methods and materials in a simple, clear, and concise manner. The main changes in this edition are those necessary to bring the work into line with the 16th Edition of the Regulations for Electrical Installations issued by the Institution of Electrical Engineers. The book begins by introducing the basic features of domestic

  3. Modern wiring practice

    CERN Document Server

    Steward, W E

    2012-01-01

    Continuously in print since 1952, Modern Wiring Practice has now been fully revised to provide an up-to-date source of reference to building services design and installation in the 21st century. This compact and practical guide addresses wiring systems design and electrical installation together in one volume, creating a comprehensive overview of the whole process for contractors and architects, as well as electricians and other installation engineers. Best practice is incorporated throughout, combining theory and practice with clear and accessible explanation, all

  4. Single Wire Detector Performance Over One Year of Operation

    CERN Document Server

    Hervas Aguilar, David Alberto

    2014-01-01

    Abstract When ionizing radiation passes through gas chambers in single wire detectors gas molecules separate into ions and electrons. By applying a strong localized electric field near the single wire an avalanche of electrons is created and it can be collected. The current produced in the wire is then proportional to the energy of the particle detected. Nevertheless, many factors can contribute to detector aging effects which are visible in a loss of gain caused by deposition of contaminants on the collecting wire. This study consists on novel data analysis techniques used to process large amounts of data produced by two simultaneously running single wire detectors. Aging effects are analyzed while environmental fluctuations are corrected for. A series of scripts carry out data filtering, data matching, corrections, and finally trend plotting by using ROOT’s extensive libraries developed at CERN.

  5. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  6. Significance of stainless steel wire reinforcement on the mechanical properties of GFRP composites

    OpenAIRE

    K. Pazhanivel; G.B. Bhaskar; A.Elayaperumal

    2014-01-01

    Investigations on flexural and tensile properties of GFRP laminates influenced by stainless steel wire reinforcement were carried out as a novel approach. Plain GFRP laminates and GFRP laminates reinforced with stainless steel wires at different depth with various pitch distances were fabricated by hand layup method. The composite specimens reinforced with steel wires were exposed to low frequency high amplitude cyclic load by using a cam arrangement. Three point bend test was carried out on ...

  7. Use of static and ac field techniques for measuring mobility and charge lifetimes of radon progeny with a simple device

    International Nuclear Information System (INIS)

    Sapra, B.K.; Mayya, Y.S.

    1998-01-01

    A simple device, based on a modification of the scintillation cell, has been developed for the measurement of radon daughter mobility and charge lifetimes by employing AC and static electric fields. It has a central electrode coated with ZnS and the scintillations are recorded by a PMT unit. The coating is made on the wire, instead of on the inner walls, to improve the relative response of the device with respect to the zero field situation. Radon is drawn into the cell by evacuation techniques. Theoretical formulae, relating the observed count rates to the system parameters and progeny mobilities and charge lifetimes, have been derived under zero field, static and AC field situations. Measurements indicate that the device has very low leak rate (T 1/2 ∼38 days) and the initial environment if maintained for long time. Results of experiments carried out with static and AC fields in most air yielded 218 Po mobilities (1.89 cm 2 /V/s) and charge lifetimes (0.08s) are comparable to those reported in the literature. This demonstrates the feasibility of this technique for future studies with different trace gases. A major advantage of this device as opposed to the conventional spectrometric methods is its simplicity. (author)

  8. Practical wiring in SI units

    CERN Document Server

    Miller, Henry A

    2013-01-01

    Practical Wiring, Volume 1 is a 13-chapter book that first describes some of the common hand tools used in connection with sheathed wiring. Subsequent chapters discuss the safety in wiring, cables, conductor terminations, insulating sheathed wiring, conductor sizes, and consumer's control equipments. Other chapters center on socket outlets, plugs, lighting subcircuits, lighting accessories, bells, and primary and secondary cells. This book will be very valuable to students involved in this field of interest.

  9. Wire EDM for Refractory Materials

    Science.gov (United States)

    Zellars, G. R.; Harris, F. E.; Lowell, C. E.; Pollman, W. M.; Rys, V. J.; Wills, R. J.

    1982-01-01

    In an attempt to reduce fabrication time and costs, Wire Electrical Discharge Machine (Wire EDM) method was investigated as tool for fabricating matched blade roots and disk slots. Eight high-strength nickel-base superalloys were used. Computer-controlled Wire EDM technique provided high quality surfaces with excellent dimensional tolerances. Wire EDM method offers potential for substantial reductions in fabrication costs for "hard to machine" alloys and electrically conductive materials in specific high-precision applications.

  10. Wire chambers: Trends and alternatives

    International Nuclear Information System (INIS)

    Regler, Meinhard

    1992-01-01

    The subtitle of this year's Vienna Wire Chamber Conference - 'Recent Trends and Alternative Techniques' - signalled that it covered a wide range of science and technology. While an opening Vienna talk by wire chamber pioneer Georges Charpak many years ago began 'Les funerailles des chambres a fils (the burial of wire chambers)', the contrary feeling this year was that wire chambers are very much alive!

  11. Command Wire Sensor Measurements

    Science.gov (United States)

    2012-09-01

    CFAR Constant False Alarm Rate CWIE Command Wire-Improvised Explosive Device EMI Electromagnetic Induction GPR Ground Penetrating Radar...this, some type of constant false alarm rate ( CFAR ) receiver is required. CFAR automatically raises the threshold level to keep clutter echoes and

  12. Transport in quantum wires

    Indian Academy of Sciences (India)

    Transport in quantum wires. SIDDHARTHA LAL, SUMATHI RAO£ and DIPTIMAN SEN. Centre for Theoretical Studies, Indian Institute of Science, Bangalore 560 012, India. £ Harish-chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, India. Abstract. With a brief introduction to one-dimensional channels ...

  13. Wire chamber conference

    International Nuclear Information System (INIS)

    Bartl, W.; Neuhofer, G.; Regler, M.

    1986-02-01

    This booklet contains program and the abstracts of the papers presented at the conference, most of them dealing with performance testing of various types of wire chambers. The publication of proceedings is planned as a special issue of 'Nuclear instruments and methods' later on. All abstracts are in English. An author index for the book of abstracts is given. (A.N.)

  14. AC loss characteristics of Bi-2223 HTS tapes under bending

    International Nuclear Information System (INIS)

    Kim, Hae-Joon; Kim, J.H.; Cho, J.W.; Sim, K.D.; Kim, S.; Oh, S.S.; Kwag, D.S.; Kim, H.J.; Bae, J.H.; Seong, K.C.

    2006-01-01

    Superconductor is developed for applications in high-power devices such as power-transmission cables, transformers, motors and generators. In such applications, HTS tapes are subjected to various kinds of stress or strain. AC loss is also important consideration for many large-scale superconducting devices. In the fabrication of the devices, the critical current (I c ) of the high temperature superconductor degrades due to many reasons including the tension applied by bending and thermal contraction. These mechanical loads reduce the I c of superconducting wire and the I c degradation affects the AC loss of the wire. The I c degradation and AC loss of Bi-2223 HTS tape were measured under tension and bending conditions at 77 K and self-field. Moreover, the frequency characteristics of AC loss was measured at the 30-480 Hz. As a result, self-field penetrates the deeper into the conductor at the lower frequency, which means higher self-field losses per cycle

  15. Hot wire TIG temper bead welding for nuclear repairs

    International Nuclear Information System (INIS)

    Lambert, J.A.; Gilston, P.F.

    1989-08-01

    A preliminary assessment has been carried out to determine the suitability of the hot wire tungsten inert gas (TIG) welding process for the repair of thick section, ferritic steel nuclear pressure vessels. The objective has been to identify a hot wire TIG temper bead procedure, suitable for repairs without post weld heat treatment. This procedure involves depositing two weld layers with carefully selected welding parameters such that overlapping thermal cycles produce a refined and tempered heat affected zone, HAZ, microstructure. (author)

  16. Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/Ag tapes with AC and DC transport currents at different temperature

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Qi [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China); Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Zhang, Guomin, E-mail: gmzhang@mail.iee.ac.cn [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yang, Hua [Institute of Science, Information Engineering University, Zhengzhou 450001 (China); Li, Zhenming; Liu, Wei [China Electric Power Research Institute, Beijing 100192 (China); Jing, Liwei [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); Yu, Hui; Liu, Guole [Key Laboratory of Applied Superconductivity, Chinese Academy of Sciences, Beijing 100190 (China); Institute of Electrical Engineering, Chinese Academy of Sciences, Beijing 100190 (China); University of the Chinese Academy of Sciences, Beijing 100049 (China)

    2016-09-15

    Highlights: • Quench behavior of Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2}/ Ag tape with AC transport current was reported for the first time. • The measurement are performed as a function of different temperature (20 K–30 K), transport current (AC and DC) and operating frequency (50 Hz–250 Hz). • The study is concentrated on the research of quench development, and the discussions of NZPV and MQE values. - Abstract: In applications, superconducting wires may carry AC or DC transport current. Thus, it is important to understand the behavior of normal zone propagation in conductors and magnets under different current conditions in order to develop an effective quench protection system. In this paper, quench behavior of Ag sheathed Sr{sub 0.6}K{sub 0.4}Fe{sub 2}As{sub 2} (Sr-122 in the family of iron-based superconductor) tapes with AC and DC transport current is reported. The measurements are performed as a function of different temperature (20 K–30 K), varying transport current and operating frequency (50 Hz–250 Hz). The focus of the research is the minimum quench energy (MQE), the normal zone propagation velocity (NZPV) and the comparison of the related results with AC and DC transport current.

  17. Dental Arch Wire

    Science.gov (United States)

    1979-01-01

    Straightening teeth is an arduous process requiring months, often years, of applying corrective pressure by means of arch wires-better known as brace-which may have to be changed several times in the course of treatment. A new method has been developed by Dr. George Andreasen, orthodontist and dental scientist at the University of Iowa. The key is a new type of arch wire material, called Nitinol, with exceptional elasticity which helps reduce the required number of brace changes. An alloy of nickel and titanium, Nitinol was originally developed for aerospace applications by the Naval Ordnance Laboratory, now the Naval Surface Weapons Laboratory, White Oaks, Maryland. NASA subsequently conducted additional research on the properties of Nitinol and on procedures for processing the metal.

  18. Wire chamber gases

    International Nuclear Information System (INIS)

    Va'vra, J.

    1992-04-01

    In this paper, we describe new developments in gas mixtures which have occurred during the last 3--4 years. In particular, we discuss new results on the measurement and modeling of electron drift parameters, the modeling of drift chamber resolution, measurements of primary ionization and the choice of gas for applications such as tracking, single electron detection, X-ray detection and visual imaging. In addition, new results are presented on photon feedback, breakdown and wire aging

  19. Vienna Wire Chamber Conference

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    After those of 1978 and 1980, a third Wire Chamber Conference was held from 15-18 February in the Technical University of Vienna. Eight invited speakers covered the field from sophisticated applications in biology and medicine, via software, to the state of the art of gaseous detectors. In some forty other talks the speakers tackled in more detail the topics of gaseous detectors, calorimetry and associated electronics and software

  20. Dual wire welding torch and method

    Science.gov (United States)

    Diez, Fernando Martinez; Stump, Kevin S.; Ludewig, Howard W.; Kilty, Alan L.; Robinson, Matthew M.; Egland, Keith M.

    2009-04-28

    A welding torch includes a nozzle with a first welding wire guide configured to orient a first welding wire in a first welding wire orientation, and a second welding wire guide configured to orient a second welding wire in a second welding wire orientation that is non-coplanar and divergent with respect to the first welding wire orientation. A method of welding includes moving a welding torch with respect to a workpiece joint to be welded. During moving the welding torch, a first welding wire is fed through a first welding wire guide defining a first welding wire orientation and a second welding wire is fed through a second welding wire guide defining a second welding wire orientation that is divergent and non-coplanar with respect to the first welding wire orientation.

  1. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Communication and wiring in the cortical connectome.

    Science.gov (United States)

    Budd, Julian M L; Kisvárday, Zoltán F

    2012-01-01

    In cerebral cortex, the huge mass of axonal wiring that carries information between near and distant neurons is thought to provide the neural substrate for cognitive and perceptual function. The goal of mapping the connectivity of cortical axons at different spatial scales, the cortical connectome, is to trace the paths of information flow in cerebral cortex. To appreciate the relationship between the connectome and cortical function, we need to discover the nature and purpose of the wiring principles underlying cortical connectivity. A popular explanation has been that axonal length is strictly minimized both within and between cortical regions. In contrast, we have hypothesized the existence of a multi-scale principle of cortical wiring where to optimize communication there is a trade-off between spatial (construction) and temporal (routing) costs. Here, using recent evidence concerning cortical spatial networks we critically evaluate this hypothesis at neuron, local circuit, and pathway scales. We report three main conclusions. First, the axonal and dendritic arbor morphology of single neocortical neurons may be governed by a similar wiring principle, one that balances the conservation of cellular material and conduction delay. Second, the same principle may be observed for fiber tracts connecting cortical regions. Third, the absence of sufficient local circuit data currently prohibits any meaningful assessment of the hypothesis at this scale of cortical organization. To avoid neglecting neuron and microcircuit levels of cortical organization, the connectome framework should incorporate more morphological description. In addition, structural analyses of temporal cost for cortical circuits should take account of both axonal conduction and neuronal integration delays, which appear mostly of the same order of magnitude. We conclude the hypothesized trade-off between spatial and temporal costs may potentially offer a powerful explanation for cortical wiring patterns.

  3. Metering Wheel-Wire Track Wire Boom Deployment Mechanism

    Science.gov (United States)

    Granoff, Mark S.

    2014-01-01

    The NASA MMS Spin Plane Double Probe (SDP) Deployer utilizes a helical path, rotating Metering Wheel and a spring loaded Wire "Holding" Track to pay out a "fixed end" 57 meter x 1.5 mm diameter Wire Boom stored between concentric storage cylinders. Unlike rotating spool type storage devices, the storage cylinders remain stationary, and the boom wire is uncoiled along the length of the cylinder via the rotation of the Metering Wheel. This uncoiling action avoids the need for slip-ring contacts since the ends of the wire can remain stationary. Conventional fixed electrical connectors (Micro-D type) are used to terminate to operational electronics.

  4. The status of commercial and developmental HTS wires

    Energy Technology Data Exchange (ETDEWEB)

    Masur, L.J.; Buczek, D.; Harley, E.; Kodenkandath, T.; Li, X.; Lynch, J.; Nguyen, N.; Rupich, M.; Schoop, U.; Scudiere, J.; Siegal, E.; Thieme, C.; Verebelyi, D.; Zhang, W.; Kellers, J

    2003-10-15

    This paper provides an update on the development, performance and application of first and second generation high temperature superconductor (HTS) wires fabricated at American Superconductor (AMSC). First generation, multifilamentary composite wire is available commercially today in different viable product forms. This conductor carries 140 x the current of copper of the same cross-section, and is robust enough to stand tough industrial requirements. Second generation HTS wires, having a coated conductor composite architecture, are under development today and achieved substantial progress recently. AMSC's first generation wire will continue as the workhorse of the industry for the next 3-4 years while AMSC's second generation coated conductor wire is on track to be reproducible, uniform, scalable, and low cost. This paper provides a product differentiation with a view on the application of HTS wire in the electric power sector. Basic engineering data is reviewed that shall aid the engineer in the selection of the HTS wire product.

  5. AC resistance measuring instrument

    Science.gov (United States)

    Hof, P.J.

    1983-10-04

    An auto-ranging AC resistance measuring instrument for remote measurement of the resistance of an electrical device or circuit connected to the instrument includes a signal generator which generates an AC excitation signal for application to a load, including the device and the transmission line, a monitoring circuit which provides a digitally encoded signal representing the voltage across the load, and a microprocessor which operates under program control to provide an auto-ranging function by which range resistance is connected in circuit with the load to limit the load voltage to an acceptable range for the instrument, and an auto-compensating function by which compensating capacitance is connected in shunt with the range resistance to compensate for the effects of line capacitance. After the auto-ranging and auto-compensation functions are complete, the microprocessor calculates the resistance of the load from the selected range resistance, the excitation signal, and the load voltage signal, and displays of the measured resistance on a digital display of the instrument. 8 figs.

  6. Corrosion resistance of premodeled wires made of stainless steel used for heart electrotherapy leaders

    Science.gov (United States)

    Przondziono, J.; Walke, W.; Młynarski, R.; Szatka, W.

    2012-05-01

    The purpose of the study is to evaluate resistance to electrochemical corrosion of wire made of X10CrNi18-8 stainless steel designed for use in cardiology treatment. The influence of strain formed in the premodeling process and methods of wire surface preparation to corrosive resistance in artificial plasma solution were analysed. Wire corrosion tests were carried out in the solution of artificial plasma. Resistance to electrochemical corrosion was evaluated on the ground of recorded curves of anodic polarization by means of potentiodynamic method. Potentiodynamic tests carried out enabled to determine how the resistance to pitting corrosion of wire changes, depending on strain formed in the premodeling process as well as on the method of wire surface preparation. For evaluation of phenomena occurring on the surface of tested steel, electrochemical impedance spectroscopy (EIS) was applied. Deterioration of corrosive properties of wire along with the increase in the formed strain hardening was observed.

  7. Inductor Design Comparison of Three-wire and Four-wire Three-phase Voltage Source Converters in Power Factor Correction Applications

    DEFF Research Database (Denmark)

    Kouchaki, Alireza; Nymand, Morten

    2015-01-01

    This paper studies the inductor design for three-wire and four-wire power factor correction converter (PFC). Designing the efficient inductor for this converter (regardless of connecting the midpoint to the ground) requires a comprehensive knowledge of the inductor current and voltage behavior....... This paper investigates how changing three-wire PFC to four-wire counterpart influences the inductor design in terms of size, losses, and overall efficiency of the converter. Therefore, the inductor current and voltage waveforms are analyzed and generalized in both cases for one switching cycle to build...... a foundation for comparison. Accordingly, the analyses are able to interpret the differences between both configurations and explain the core losses and the copper losses of inductors, especially those caused by the high frequency ac current ripple. Finally, two inductors are designed for a 5 kW PFC...

  8. Wire communication engineering

    International Nuclear Information System (INIS)

    Son, Byeong Tae

    1997-02-01

    This book describes wire telecommunication engineering/ It is divided into eleven chapter, which deal with Introduction with development of telecommunication, voice and sound wave and communication network, Telegraphy with summary of telegraphy, code of telegraphy, communication speed, morse and telex, Telephone on structure, circuit and image telephone, Traffic on telecommunication traffic, transmission of line about theory, cable line and loaded cable, carrier communication with carrier telegraphy and carrier telephone, optical communication with types, structure, specialty, laser and equipment, DATA, Mobile telecommunication on summary, mobile telephone, radio paging and digital mobile telecommunication, ISDN with channel of ISDN, and service of ISDN, and design of telecommunication.

  9. Wiring regulations in brief

    CERN Document Server

    Tricker, Ray

    2012-01-01

    Tired of trawling through the Wiring Regs?Perplexed by Part P?Confused by cables, conductors and circuits?Then look no further! This handy guide provides an on-the-job reference source for Electricians, Designers, Service Engineers, Inspectors, Builders, Students, DIY enthusiastsTopic-based chapters link areas of working practice - such as cables, installations, testing and inspection, special locations - with the specifics of the Regulations themselves. This allows quick and easy identification of the official requirements relating to the situati

  10. The Micro Wire Detector

    Energy Technology Data Exchange (ETDEWEB)

    Adeva, B.; Gomez, F.; Pazos, A.; Pfau, R.; Plo, M. E-mail: maximo.plo@cern.ch; Rodriguez, J.M.; Vazquez, P.; Labbe, J.C

    1999-10-11

    We present the performance of a new proportional gas detector. Its geometry consists of a cathode plane with 70x70 {mu}m{sup 2} apertures, crossed by 25 {mu}m anode strips to which it is attached by 50 {mu}m kapton spacers. In the region where the avalanche takes place, the anode strips are suspended in the gas mixture as in a standard wire chamber. This detector exhibits high rate capability and large gains, introducing very little material. (author)

  11. Epitaxial semiconductor quantum wires.

    Science.gov (United States)

    Wu, J; Chen, Y H; Wang, Z G

    2008-07-01

    The investigation on the direct epitaxial quantum wires (QWR) using MBE or MOCVD has been persuited for more than two decades, more lengthy in history as compared with its quantum dot counterpart. Up to now, QWRs with various structural configurations have been produced with different growth methods. This is a reviewing article consisting mainly of two parts. The first part discusses QWRs of various configurations, together with laser devices based on them, in terms of the two growth mechanisms, self-ordering and self-assembling. The second part gives a brief review of the electrical and optical properties of QWRs.

  12. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  13. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  14. 46 CFR 111.60-11 - Wire.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Wire. 111.60-11 Section 111.60-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Wiring Materials and Methods § 111.60-11 Wire. (a) Wire must be in an enclosure. (b) Wire must be...

  15. Nano-/micro metallic wire synthesis on Si substrate and their characterization

    International Nuclear Information System (INIS)

    Kaur, Jaskiran; Kaur, Harmanmeet; Singh, Surinder; Kanjilal, Dinakar; Chakarvarti, Shiv Kumar

    2014-01-01

    Nano-/micro wires of copper are grown on semiconducting Si substrate using the template method. It involves the irradiation of 8 um thick polymeric layer coated on Si with150 MeV Ni ion beam at a fluence of 2E8. Later, by using the simple technique of electrodeposition, copper nano-/micro wires were grown via template synthesis. Synthesized wires were morphologically characterized using SEM and electrical characterization was carried out by finding I-V plot

  16. Effect of electrical spot welding on load deflection rate of orthodontic wires.

    Science.gov (United States)

    Alavi, Shiva; Abrishami, Arezoo

    2015-01-01

    One of the methods used for joining metals together is welding, which can be carried out using different techniques such as electric spot welding. This study evaluated the effect of electric spot welding on the load deflection rate of stainless steel and chromium-cobalt orthodontic wires. In this experimental-laboratory study, load deflection rate of 0.016 × 0.022 inch stainless steel and chromium cobalt wires were evaluated in five groups (n =18): group one: Stainless steel wires, group two: chromium-cobalt wires, group three: stainless steel wires welded to stainless steel wires, group four: Stainless steel wires welded to chromium-cobalt wires, group five: chromium-cobalt wire welded to chromium-cobalt wires. Afterward, the forces induced by the samples in 0.5 mm, 1 mm, 1.5 mm deflection were measured using a universal testing machine. Then mean force measured for each group was compared with other groups. The data were analyzed using repeated measure analysis of variance (ANOVA), one-way ANOVA, and paired t-test by the SPSS software. The significance level was set as 0.05. The Tukey test showed that there were significant differences between the load deflection rates of welded groups compared to control ones (P wires increased their load deflection rates.

  17. Corrosion of Wires on Wooden Wire-Bound Packaging Crates

    Science.gov (United States)

    Samuel L. Zelinka; Stan Lebow

    2015-01-01

    Wire-bound packaging crates are used by the US Army to transport materials. Because these crates may be exposed to harsh environments, they are dip-treated with a wood preservative (biocide treatment). For many years, zinc-naphthenate was the most commonly used preservative for these packaging crates and few corrosion problems with the wires were observed. Recently,...

  18. ACS Postflash Characterization

    Science.gov (United States)

    Smith, Linda

    2011-10-01

    This program will evaluate the in-flight performance of the ACS/WFC post-flash lamp. A series of observations of Omega Cen will be taken using short and long exposures. The short exposures will be post-flashed using pre-determined exposure times to produce backgrounds from 0 to 125 e-. The data will be used to {1} make an empirical study of the effectiveness in preserving counts for faint stars on various post-flash backgrounds; {2} validate that our current mechanisms for formula-based and pixel-based corrections provide good fixes for whatever CTE remains; and {3} probe a fine enough range of backgrounds that users will be able to pick the level that optimizes their science, which will be a straightforward compromise between the noise added and the signal preserved.

  19. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Energy Technology Data Exchange (ETDEWEB)

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

    2009-10-01

    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  20. Improved superconducting magnet wire

    Science.gov (United States)

    Schuller, I.K.; Ketterson, J.B.

    1983-08-16

    This invention is directed to a superconducting tape or wire composed of alternating layers of copper and a niobium-containing superconductor such as niobium of NbTi, Nb/sub 3/Sn or Nb/sub 3/Ge. In general, each layer of the niobium-containing superconductor has a thickness in the range of about 0.05 to 1.5 times its coherence length (which for Nb/sub 3/Si is 41 A) with each copper layer having a thickness in the range of about 170 to 600 A. With the use of very thin layers of the niobium composition having a thickness within the desired range, the critical field (H/sub c/) may be increased by factors of 2 to 4. Also, the thin layers of the superconductor permit the resulting tape or wire to exhibit suitable ductility for winding on a magnet core. These compositions are also characterized by relatively high values of critical temperature and therefore will exhibit a combination of useful properties as superconductors.

  1. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  2. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    Prakash

    Therefore, these glycoproteins appear to be potential candidates for a vector- directed transmission-blocking vaccine (TBV). [Chugh M, Gulati B R and Gakhar S K 2010 Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae); J.

  3. Wire and Packing Tape Sandwiches

    Science.gov (United States)

    Rabinowitz, Sandy

    2009-01-01

    In this article, the author describes how students can combine craft wire with clear packing tape to create a two-dimensional design that can be bent and twisted to create a three-dimensional form. Students sandwich wire designs between two layers of tape. (Contains 1 online resource.)

  4. Wire metamaterials: physics and applications.

    Science.gov (United States)

    Simovski, Constantin R; Belov, Pavel A; Atrashchenko, Alexander V; Kivshar, Yuri S

    2012-08-16

    The physics and applications of a broad class of artificial electromagnetic materials composed of lattices of aligned metal rods embedded in a dielectric matrix are reviewed. Such structures are here termed wire metamaterials. They appear in various settings and can operate from microwaves to THz and optical frequencies. An important group of these metamaterials is a wire medium possessing extreme optical anisotropy. The study of wire metamaterials has a long history, however, most of their important and useful properties have been revealed and understood only recently, especially in the THz and optical frequency ranges where the wire media correspond to the lattices of microwires and nanowires, respectively. Another group of wire metamaterials are arrays and lattices of nanorods of noble metals whose unusual properties are driven by plasmonic resonances. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. A finite element model for independent wire rope core with double ...

    Indian Academy of Sciences (India)

    to model and analyse independent wire rope core accurately (IWRC). In this paper, ... Although considerable research studies have been carried out about the analytical solutions of IWRCs by Costello & Sinha ... straight strand as being the main component for modelling IWRC and more complex wire ropes by using IWRC.

  6. Load-deflection characteristics of superelastic and thermal nickel-titanium wires.

    Science.gov (United States)

    Gatto, Elda; Matarese, Giovanni; Di Bella, Guido; Nucera, Riccardo; Borsellino, Chiara; Cordasco, Giancarlo

    2013-02-01

    The aim of this study was to investigate the mechanical properties of superelastic and thermal nickel-titanium (NiTi) archwires for correct selection of orthodontic wires. Seven different NiTi wires of two different sizes (0.014 and 0.016 inches), commonly used during the alignment phase, were tested. A three-point bending test was carried out to evaluate the load-deflection characteristics. The archwires were subjected to bending at a constant temperature of 37°C and deflections of 2 and 4 mm. Analysis of variance showed that thermal NiTi wires exerted significantly lower working forces than superelastic wires of the same size in all experimental tests (P Wire size had a significant effect on the forces produced: with an increase in archwire dimension, the released strength increased for both thermal and superelastic wires. Superelastic wires showed, at a deflection of 2 mm, narrow and steep hysteresis curves in comparison with the corresponding thermal wires, which presented a wide interval between loading and unloading forces. During unloading at 4 mm of deflection, all wires showed curves with a wider plateau when compared with 2 mm deflection. Such a difference for the superelastic wires was caused by the martensite stress induced at higher deformation levels. A comprehensive understanding of mechanical characteristics of orthodontic wires is essential and selection should be undertaken in accordance with the behaviour of the different wires. It is also necessary to take into account the biomechanics used. In low-friction mechanics, thermal NiTi wires are to be preferred to superelastic wires, during the alignment phase due to their lower working forces. In conventional straightwire mechanics, a low force archwire would be unable to overcome the resistance to sliding.

  7. 3D Wire 2015

    DEFF Research Database (Denmark)

    Jordi, Moréton; F, Escribano; J. L., Farias

    , therefore, we’ve drawn conclusions and recommendations for future editions of the event, also generalizable to other experiences of gamification especially in events. This report details the methodology and working elements from the design phase, human resources and organization of production......This document is a general report on the implementation of gamification in 3D Wire 2015 event. As the second gamification experience in this event, we have delved deeply in the previous objectives (attracting public areas less frequented exhibition in previous years and enhance networking) and have...... proposed new ones (viralization of the event on social networks and improvement of the integration of international attendees). On the other hand we defined a set of research objectives related to the study of gamification in an eminently social place like an event. Most of the goals have been met and...

  8. ACS Photometric Zero Point Verification

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The uncertainties in the photometric zero points create a fundamental limit to the accuracy of photometry. The current state of the ACS calibration is surprisingly poor, with zero point uncertainties of 0.03 magnitudes in the Johnson filters. The reason for this is that ACS observations of excellent ground-based standard fields, such as the omega Cen field used for WFPC2 calibrations, have not been obtained. Instead, the ACS photometric calibrations are based primarily on semi-emprical synthetic zero points and observations of fields too crowded for accurate ground-based photometry. I propose to remedy this problem by obtaining ACS broadband images of the omega Cen standard field with both the WFC and HRC. This will permit the direct determination of the ACS transformations, and is expected to double the accuracy to which the ACS zero points are known. A second benefit is that it will facilitate the comparison of the WFPC2 and ACS photometric systems, which will be important as WFPC2 is phased out and ACS becomes HST's primary imager.

  9. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  10. Development and manufacture of ultra-fine NbTi filament wires at ALSTHOM

    International Nuclear Information System (INIS)

    Hoang, G.K.; Laumond, Y.; Sabrie, J.L.; Dubots, P.

    1986-01-01

    Ultra-fine NbTi filament wires have been developed and manufactured by ALSTHOM. It is now possible to produce industrial copper -copper-nickel matrix wires with 0.6 mu m NbTi filaments for use in 50 / 60 Hz machines. Smaller filaments with diameters down to 0.08 mu m have been obtained with 254 100 filament wire samples. Studies are now being carried out on copper matrix conductors to reduce the filament diameter. The first results show that it is possible to obtain submicron filaments even in copper matrix wires

  11. Forces generated in guide-wires when drilling human bone.

    Science.gov (United States)

    Shuaib, I; Hillery, M

    1995-01-01

    In orthopaedic surgery guide-wires are extensively used for the drilling of pilot holes in human bones to allow further drilling, reaming and screw-tapping to take place in the repair and reconstruction of fractures. The guide-wires are generally 1.5 to 2.5 mm in diameter and have a three-faceted point with or without a screw thread. This paper describes drilling tests carried out using both types of guide-wire and these are compared with results obtained from a two-faceted geometry developed during this research. Tests were performed on the heads of femurs which had been removed during hip arthroplasty. A variable speed drilling machine together with a very sensitive drilling dynamometer were used for measuring the torque and thrust during the experimental stage of the research. This equipment was developed as part of an overall research programme into the mechanics of drilling of human bone. The indications are, firstly, that little advantage is gained by using a threaded-point guide-wire. In fact using a thread on the guide-wire can be a disadvantage. Secondly, the thrust cutting force is dependent on the spindle speed and feed. An optimum set of speeds of between 800 and 1400 r/min is recommended for 2.5 mm diameter guide-wires.

  12. Modelling of drawing and rolling of high carbon flat wires

    International Nuclear Information System (INIS)

    Bobadilla, C.; Persem, N.; Foissey, S.

    2007-01-01

    In order to meet customer requirements, it is necessary to develop new flat wires with a high tensile strength and a high width/thickness ratio. These products are manufactured from wire rod. The first step is to draw the wire until we have the required mechanical properties and required surface area of the section. After this, the wire is rolled from a round to a rectangular section. During the flat rolling process it can be reduced by more than 50%. Then the wire is exposed to a high level of stress during this process. Modelling allows us to predetermine this stress level, taking into account the final dimensions and the mechanical properties, thus optimising both rolling and drawing process. Forge2005 was used in order to simulate these processes. The aim of this study is to determine the value of residual stresses after drawing and so to optimise rolling. Indeed, the highest stress values are reached at this step of the process by changing the section of the wire from a round to a rectangular one. In order to evaluate the stress value accuracy for high strain levels, a behaviour law has been identified. This is a result of tensile tests carried out at each step of the drawing process. Finally, a multi-axial damage criterion was implemented using Forge2005. The optimisation of the rolling is directly linked to the minimisation of this criterion

  13. Oblique incidence type resistance wire proportional position detector

    International Nuclear Information System (INIS)

    Iwatani, Kazuo

    1977-01-01

    A high resistance wire, proportional counter is being developed for the use as the position detector to be installed at the focal plane of the magnet of high resolution, reaction particle analyzer for SF cyclotron. One of the difficulties to attain the target performance is its low positional resolution in case of the oblique incidence of particles with small energy loss in the counter in case of so-called single wire proportional counter. Adopting one of the solutions, proposed by Markham et al. of Michigan State University, that processes signals by ingenious cathode read-out and makes the detector into an equivalent ''thin'' counter, a high resistance wire detector still having simple read-out has been devised. The oblique incidence effect seems to be caused by the fluctuation (Landau distribution) of particle energy loss in counter gas. As a result of some discussion on this matter, the detector having increased five resistance wires instead of single wire, and having guard wires so as to make the electric field intensity in the vicinity of the cathode weak, has been manufactured to obtain the ''thin'' counter without considerably changing the overall thickness of the counter. Signal read-out is carried out by charge division method. As a result of the test, the positional resolution of Δx=1.0 mm has been attained when incidence angle was 35 deg and the collimation of particles was about 0.5 mm diameter for protons of 50 meV. (Wakatsuki, Y.)

  14. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  15. Plasma chemistry in wire chambers

    International Nuclear Information System (INIS)

    Wise, J.

    1990-05-01

    The phenomenology of wire chamber aging is discussed and fundamentals of proportional counters are presented. Free-radical polymerization and plasma polymerization are discussed. The chemistry of wire aging is reviewed. Similarities between wire chamber plasma (>1 atm dc-discharge) and low-pressure rf-discharge plasmas, which have been more widely studied, are suggested. Construction and use of a system to allow study of the plasma reactions occurring in wire chambers is reported. A proportional tube irradiated by an 55 Fe source is used as a model wire chamber. Condensable species in the proportional tube effluent are concentrated in a cryotrap and analyzed by gas chromatography/mass spectrometry. Several different wire chamber gases (methane, argon/methane, ethane, argon/ethane, propane, argon/isobutane) are tested and their reaction products qualitatively identified. For all gases tested except those containing methane, use of hygroscopic filters to remove trace water and oxygen contaminants from the gas resulted in an increase in the average molecular weight of the products, consistent with results from low-pressure rf-discharge plasmas. It is suggested that because water and oxygen inhibit polymer growth in the gas phase that they may also reduce polymer deposition in proportional tubes and therefore retard wire aging processes. Mechanistic implications of the plasma reactions of hydrocarbons with oxygen are suggested. Unresolved issues in this work and proposals for further study are discussed

  16. Adhesion strength study of IBAD-MOCVD-based 2G HTS wire using a peel test

    International Nuclear Information System (INIS)

    Zhang, Y.; Hazelton, D.W.; Knoll, A.R.; Duval, J.M.; Brownsey, P.; Repnoy, S.; Soloveichik, S.; Sundaram, A.; McClure, R.B.; Majkic, G.; Selvamanickam, V.

    2012-01-01

    A peel test was used to study the adhesion strength of a commercial grade 2G HTS wire which features a characteristic multilayer structure with the rare earth-based MOCVD superconducting film deposited on an IBAD-MgO template. The peel test could be carried out at various peeling angles (from 90° to 180°) and the peel strength of a wire was defined as the steady-state peeling load determined from a load-displacement curve. The test results had good reproducibility and accuracy, making the test a reliable and useful method for studying the adhesion strength of the wire. By characterizing the peeled surfaces the weakest interface in a wire could be identified. The peel strength data of the wire was analyzed together with the performance of the experimental magnet coils fabricated using the wire. The effect of the silver contact layer annealing on the peel strength is discussed.

  17. Adhesion strength study of IBAD-MOCVD-based 2G HTS wire using a peel test

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y., E-mail: yzhang@superpower-inc.com [SuperPower Inc., 450 Duane Avenue, Schenectady, NY 12304 (United States); Hazelton, D.W.; Knoll, A.R.; Duval, J.M.; Brownsey, P.; Repnoy, S.; Soloveichik, S.; Sundaram, A.; McClure, R.B. [SuperPower Inc., 450 Duane Avenue, Schenectady, NY 12304 (United States); Majkic, G.; Selvamanickam, V. [University of Houston, 4800 Calhoun Road, Houston, TX 77204 (United States)

    2012-02-15

    A peel test was used to study the adhesion strength of a commercial grade 2G HTS wire which features a characteristic multilayer structure with the rare earth-based MOCVD superconducting film deposited on an IBAD-MgO template. The peel test could be carried out at various peeling angles (from 90 Degree-Sign to 180 Degree-Sign) and the peel strength of a wire was defined as the steady-state peeling load determined from a load-displacement curve. The test results had good reproducibility and accuracy, making the test a reliable and useful method for studying the adhesion strength of the wire. By characterizing the peeled surfaces the weakest interface in a wire could be identified. The peel strength data of the wire was analyzed together with the performance of the experimental magnet coils fabricated using the wire. The effect of the silver contact layer annealing on the peel strength is discussed.

  18. Aislamiento acústico

    Directory of Open Access Journals (Sweden)

    Tobío, J. M.

    1970-07-01

    Full Text Available This is a very specific subject in the field of architectural acoustics, namely, insulation'. Emphasis is placed on the theoretical foundations of this phenomenon, and the most simple formula are developed to calculate easily the transmission losses of a material or the constructional insulating arrangements. The practical aspect of insulation can be considered by means of several graphs and charts, without the use of mathematics, and utilising common materials, that will not substantially increase the cost of the project. Finally this papers offers a critical discussion of building codes, and their reference to the acoustical insulation of dwellings, and data is included on the new regulations of the Madrid Municipality.Se trata un tema muy concreto de la Acústica Arquitectónica, el aislamiento, haciendo hincapié en los fundamentos teóricos del fenómeno y estableciendo las fórmulas más sencillas que permiten calcular fácilmente las pérdidas de transmisión de un material o disposición constructiva aislante. Varias gráficas y abacos permiten abordar, sin ningún tratamiento matemático, el problema práctico del aislamiento, aprovechando los materiales comunes y sin ocasionar gastos que graven sustancialmente el importe del proyecto. Por último, se hace un estudio crítico de las normas y su incidencia en los problemas del aislamiento de viviendas, incluyendo datos referentes a la nueva Ordenanza del Ayuntamiento de Madrid.

  19. Fabrication details for wire wrapped fuel assembly components

    International Nuclear Information System (INIS)

    Bosy, B.J.

    1978-09-01

    Extensive hydraulic testing of simulated LMFBR blanket and fuel assemblies is being carried out under this MIT program. The fabrication of these test assemblies has involved development of manufacturing procedures involving the wire wrapped pins and the flow housing. The procedures are described in detail in the report

  20. AcEST: DK945159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  1. AcEST: DK945724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available id J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  2. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax ...

    Indian Academy of Sciences (India)

    The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 ...

  3. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  4. Eliminating a Major Cause of Wire Drawing Breakage in A-15 High-Field Superconductors

    International Nuclear Information System (INIS)

    Austen, Alfred R.

    2003-01-01

    Eliminating a Major Cause of Wire Drawing Breakage in A-15 High-Field Superconductors Phase 1 Summary Purpose of the research: The Phase 1 goal was to make a significant improvement in the wire drawing technology used for difficult to draw superconductor precursor composites. Many ductile Nb-Al and Nb-Sn precursor wire composites have experienced the onset of wire drawing breakage at about 1.5 mm diameter. Phase 1 focused on evaluating the role that precision rigid guidance of the wire into the drawing die and the hydrostatic stress state at the die entrance played in preventing wire breakage. Research carried out: The research performed depended upon the construction of both a mechanical wire guide and a hydrostatic pressure stiffened wire guidance system. Innovare constructed the two wire guidance systems and tested them for their ability to reduce wire drawing breakage. One set of hardware provided rigid alignment of the wires to their wire drawing die axes within 0.35 degrees using ''hydrostatic pressure stiffening'' to enable the precision guidance strategy to be implemented for these highly flexible small diameter wires. This apparatus was compared to a guide arrangement that used short span mechanical guide alignment with a misalignment limit of about 0.75 degrees. Four A-15 composite wires with breakage histories were drawn to evaluate the use of these wire guiding systems to reduce and/or eliminate wire breakage. Research findings and results: In Phase 1, a breakthrough in wire drawing technology for A-15 superconductor composites was achieved by dramatically limiting or eliminating breakage in four different A-15 composite precursor wire designs during the drawing of these very desirable composites that previously could not be drawn to near final size. Research results showed that the proposed Phase 1 mechanical wire guides were sufficiently effective and successful in eliminating breakage when used along with other advanced wire drawing technology to

  5. 49 CFR 393.28 - Wiring systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Wiring systems. 393.28 Section 393.28... NECESSARY FOR SAFE OPERATION Lamps, Reflective Devices, and Electrical Wiring § 393.28 Wiring systems. Electrical wiring shall be installed and maintained to conform to SAE J1292—Automobile, Truck, Truck-Tractor...

  6. Modeling birds on wires.

    Science.gov (United States)

    Aydoğdu, A; Frasca, P; D'Apice, C; Manzo, R; Thornton, J M; Gachomo, B; Wilson, T; Cheung, B; Tariq, U; Saidel, W; Piccoli, B

    2017-02-21

    In this paper we introduce a mathematical model to study the group dynamics of birds resting on wires. The model is agent-based and postulates attraction-repulsion forces between the interacting birds: the interactions are "topological", in the sense that they involve a given number of neighbors irrespective of their distance. The model is first mathematically analyzed and then simulated to study its main properties: we observe that the model predicts birds to be more widely spaced near the borders of each group. We compare the results from the model with experimental data, derived from the analysis of pictures of pigeons and starlings taken in New Jersey: two different image elaboration protocols allow us to establish a good agreement with the model and to quantify its main parameters. We also discuss the potential handedness of the birds, by analyzing the group organization features and the group dynamics at the arrival of new birds. Finally, we propose a more refined mathematical model that describes landing and departing birds by suitable stochastic processes. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. Topology Optimized Photonic Wire Splitters

    DEFF Research Database (Denmark)

    Frandsen, Lars Hagedorn; Borel, Peter Ingo; Jensen, Jakob Søndergaard

    2006-01-01

    Photonic wire splitters have been designed using topology optimization. The splitters have been fabricated in silicon-on-insulator material and display broadband low-loss 3dB splitting in a bandwidth larger than 100 nm.......Photonic wire splitters have been designed using topology optimization. The splitters have been fabricated in silicon-on-insulator material and display broadband low-loss 3dB splitting in a bandwidth larger than 100 nm....

  8. Composite conductor containing superconductive wires

    Energy Technology Data Exchange (ETDEWEB)

    Larson, W.L.; Wong, J.

    1974-03-26

    A superconductor cable substitute made by coworking multiple rods of superconductive niobium--titanium or niobium--zirconium alloy with a common copper matrix to extend the copper and rods to form a final elongated product which has superconductive wires distributed in a reduced cross-section copper conductor with a complete metallurgical bond between the normal-conductive copper and the superconductor wires contained therein is described. The superconductor cable can be in the form of a tube.

  9. 30 CFR 75.701-4 - Grounding wires; capacity of wires.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Grounding wires; capacity of wires. 75.701-4... SAFETY AND HEALTH MANDATORY SAFETY STANDARDS-UNDERGROUND COAL MINES Grounding § 75.701-4 Grounding wires; capacity of wires. Where grounding wires are used to ground metallic sheaths, armors, conduits, frames...

  10. 1 mil gold bond wire study.

    Energy Technology Data Exchange (ETDEWEB)

    Huff, Johnathon; McLean, Michael B.; Jenkins, Mark W.; Rutherford, Brian Milne

    2013-05-01

    In microcircuit fabrication, the diameter and length of a bond wire have been shown to both affect the current versus fusing time ratio of a bond wire as well as the gap length of the fused wire. This study investigated the impact of current level on the time-to-open and gap length of 1 mil by 60 mil gold bond wires. During the experiments, constant current was provided for a control set of bond wires for 250ms, 410ms and until the wire fused; non-destructively pull-tested wires for 250ms; and notched wires. The key findings were that as the current increases, the gap length increases and 73% of the bond wires will fuse at 1.8A, and 100% of the wires fuse at 1.9A within 60ms. Due to the limited scope of experiments and limited data analyzed, further investigation is encouraged to confirm these observations.

  11. HTS Wire Development Workshop: Proceedings

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    The 1994 High-Temperature Superconducting Wire Development Workshop was held on February 16--17 at the St. Petersburg Hilton and Towers in St. Petersburg, Florida. The meeting was hosted by Florida Power Corporation and sponsored by the US Department of Energy`s Superconductivity Program for Electric Power Systems. The meeting focused on recent high-temperature superconducting wire development activities in the Department of Energy`s Superconductivity Systems program. The meeting opened with a general discussion on the needs and benefits of superconductivity from a utility perspective, the US global competitiveness position, and an outlook on the overall prospects of wire development. The meeting then focused on four important technology areas: Wire characterization: issues and needs; technology for overcoming barriers: weak links and flux pinning; manufacturing issues for long wire lengths; and physical properties of HTS coils. Following in-depth presentations, working groups were formed in each technology area to discuss the most important current research and development issues. The working groups identified research areas that have the potential for greatly enhancing the wire development effort. These areas are discussed in the summary reports from each of the working groups. This document is a compilation of the workshop proceedings including all general session presentations and summary reports from the working groups.

  12. Iris pigmentation and AC thresholds.

    Science.gov (United States)

    Roche, A F; Mukherjee, D; Chumlea, W C; Siervogel, R M

    1983-03-01

    Data from 160 White children were used to analyze possible associations between iris pigmentation and AC pure-tone thresholds. Iris pigmentation was graded from iris color using glass models of eyes, and AC thresholds were obtained under carefully controlled conditions. Analyses of variance using two groupings of iris color grades showed no evidence of an association between iris color grade and AC thresholds. Furthermore, inspection of arrays of the actual glass eye models, in conjunction with the order of mean thresholds at each test frequency, did not indicate the presence of an association between iris color grades and thresholds. It was concluded that while iris pigmentation may be related to some aspects of hearing ability, it does not appear to be related to AC thresholds in children.

  13. Investigation and comparison of AC losses on stabilizer-free and copper stabilizer HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Coombs, T. A.

    2017-10-01

    This paper presents the measurement and simulation of Alternating Current (AC) losses on the Stabilizer-free and Copper Stabilizer High Temperature Superconducting (HTS) Tapes: SuperPower SF12100 and SCS12050. The AC loss measurement utilised electrical method to obtain overall losses with AC transport currents. The 2D H-formulation by COMSOL Multiphysics has been used to simulate the real geometry and multi-layer HTS tapes. Ferromagnetic AC losses of substrate have been assumed to be ignored as the substrates of SF12100 and SCS12050 are non-magnetic. Hysteresis AC losses in the superconducting layer, and eddy-current AC losses in copper stabilizer, silver overlayer and substrate were concerned in this investigation. The measured AC losses were compared to the AC losses from simulation, with 3 cases of different AC frequency 10, 100, and 1000 Hz. The eddy-current AC losses of copper stabilizer at frequency 1000 Hz were determined from both experiment and simulation. The estimation of AC losses with frequency at 10,000 Hz was also carried out using simulation method. Finally, the frequency dependence of AC losses from Stabilizer-free Tape and Copper Stabilizer Tape were compared and analysed.

  14. A study on MFL based wire rope damage detection

    Science.gov (United States)

    Park, J.; Kim, J.-W.; Kim, J.; Park, S.

    2017-04-01

    Non-destructive testing on wire rope is in great demand to prevent safety accidents at sites where many heavy equipment using ropes are installed. In this paper, a research on quantification of magnetic flux leakage (MFL) signals were carried out to detect damages on wire rope. First, a simulation study was performed with a steel rod model using a finite element analysis (FEA) program. The leakage signals from the simulation study were obtained and it was compared for parameter: depth of defect. Then, an experiment on same conditions was conducted to verify the results of the simulation. Throughout the results, the MFL signal was quantified and a wire rope damage detection was then confirmed to be feasible. In further study, it is expected that the damage characterization of an entire specimen will be visualized as well.

  15. Characteristics of the electrical explosion of fine metallic wires in vacuum

    Science.gov (United States)

    Wang, Kun; Shi, Zongqian; Shi, Yuanjie; Zhao, Zhigang

    2017-09-01

    The experimental investigations on the electrical explosion of aluminum, silver, tungsten and platinum wires are carried out. The dependence of the parameters related to the specific energy deposition on the primary material properties is investigated. The polyimide coatings are applied to enhance the energy deposition for the exploding wires with percent of vaporized energy less than unit. The characteristics of the exploding wires of different materials with and without insulating coatings are studied. The effect of wire length on the percent of vaporization energy for exploding coated wires is presented. A laser probe is employed to construct the shadowgraphy, schlieren and interferometry diagnostics. The optical diagnostics demonstrate the morphology of the exploding products and structure of the energy deposition. The influence of insulating coatings on different wire materials is analyzed. The expansion trajectories of the exploding wires without and with insulating coatings are estimated from the shadowgram. More specific energy is deposited into the coated wires of shorter wire length, leading to faster expanding velocity of the high-density products.

  16. Characteristics of the electrical explosion of fine metallic wires in vacuum

    Directory of Open Access Journals (Sweden)

    Kun Wang

    2017-09-01

    Full Text Available The experimental investigations on the electrical explosion of aluminum, silver, tungsten and platinum wires are carried out. The dependence of the parameters related to the specific energy deposition on the primary material properties is investigated. The polyimide coatings are applied to enhance the energy deposition for the exploding wires with percent of vaporized energy less than unit. The characteristics of the exploding wires of different materials with and without insulating coatings are studied. The effect of wire length on the percent of vaporization energy for exploding coated wires is presented. A laser probe is employed to construct the shadowgraphy, schlieren and interferometry diagnostics. The optical diagnostics demonstrate the morphology of the exploding products and structure of the energy deposition. The influence of insulating coatings on different wire materials is analyzed. The expansion trajectories of the exploding wires without and with insulating coatings are estimated from the shadowgram. More specific energy is deposited into the coated wires of shorter wire length, leading to faster expanding velocity of the high-density products.

  17. Direct Measurement of the Electron Energy Relaxation Dynamics in Metallic Wires

    Science.gov (United States)

    Pinsolle, Edouard; Rousseau, Alexandre; Lupien, Christian; Reulet, Bertrand

    2016-06-01

    We present measurements of the dynamical response of thermal noise to an ac excitation in conductors at low temperature. From the frequency dependence of this response function—the (noise) thermal impedance—in the range 1 kHz-1 GHz we obtain direct determinations of the inelastic relaxation times relevant in metallic wires at low temperature: the electron-phonon scattering time and the diffusion time of electrons along the wires. Combining these results with that of resistivity provides a measurement of heat capacity of samples made of thin film. The simplicity and reliability of this technique makes it very promising for future applications in other systems.

  18. Optimization of electron beam crosslinking of wire and cable insulation

    International Nuclear Information System (INIS)

    Zimek, Z.; Przybytniak, G.; Nowicki, A.

    2011-01-01

    Complete text of publication follows. The computer simulations based on Monte Carlo method and the ModeCEB software program were carried out in connection with EB radiation set-up for crosslinking of electrical wire and cable insulation, located at the Center for Radiation Research and Technology of the Institute of Nuclear Chemistry and Technology. The theoretical predictions for absorbed dose distribution in irradiated electrical wire and cable insulation caused by scanned EB were compared to the experimental results of irradiation which were carried out in the experimental set-up based on ILU 6 electron accelerator, which is characterized by the following parameters: Electron energy 0.5-2.0 MeV; Average beam current 40-10 mA, pulse duration 400 μs; Width of scanning up to 80 cm; Scan frequency up to 50 Hz. The computer simulation of the dose distributions in two-sided irradiation system by a scanned electron beam in multilayer circular objects was performed for different process parameters; electrical wire and cable geometry (thickness of insulation layers and cupper wire diameter), type of polymer isolation, electron energy, energy spread, geometry of electron beam and electrical wire and cable distribution at irradiation zone. The geometry of electron beam distribution in irradiation zone was measured using TVA and PVC foil dosimeters for electron energy range available in ILU 6 accelerator. The temperature rise of irradiated electrical wire and irradiation homogeneity were evaluated for different experimental conditions to optimize process parameters. The obtained results of computer simulation were supported by experimental data of dose distribution based on gel-fraction measurements. Such agreement indicates that computer simulation ModeCEB is correct and sufficient for modelling of absorbed dose distribution in multi-layer circular objects irradiated with scanned electron beams. Acknowledgement: The R and D activities are supported by the European

  19. Optimization of electron beam crosslinking of wire and cable insulation

    International Nuclear Information System (INIS)

    Zimek, Zbigniew; Przybytniak, Grażyna; Nowicki, Andrzej

    2012-01-01

    The computer simulations based on Monte Carlo (MC) method and the ModeCEB software were carried out in connection with electron beam (EB) radiation set-up for crosslinking of electric wire and cable insulation. The theoretical predictions for absorbed dose distribution in irradiated electric insulation induced by scanned EB were compared to the experimental results of irradiation that was carried out in the experimental set-up based on ILU 6 electron accelerator with electron energy 0.5–2.0 MeV. The computer simulation of the dose distributions in two-sided irradiation system by a scanned electron beam in multilayer circular objects was performed for various process parameters, namely electric wire and cable geometry (thickness of insulation layers and copper wire diameter), type of polymer insulation, electron energy, energy spread and geometry of electron beam, electric wire and cable layout in irradiation zone. The geometry of electron beam distribution in the irradiation zone was measured using CTA and PVC foil dosimeters for available electron energy range. The temperature rise of the irradiated electric wire and irradiation homogeneity were evaluated for different experimental conditions to optimize technological process parameters. The results of computer simulation are consistent with the experimental data of dose distribution evaluated by gel-fraction measurements. Such conformity indicates that ModeCEB computer simulation is reliable and sufficient for optimization absorbed dose distribution in the multi-layer circular objects irradiated with scanned electron beams. - Highlights: ► We model wire and cables irradiation process by Monte Carlo simulations. ► We optimize irradiation configuration for various process parameters. ► Temperature rise and irradiation homogeneity were evaluated. ► Calculation (dose) and experimental (gel-fraction) results were compared. ► Computer simulation was found reliable and sufficient for process optimization.

  20. Understanding the mechanism of nanoparticle formation in wire explosion process

    International Nuclear Information System (INIS)

    Bora, B.; Wong, C.S.; Bhuyan, H.; Lee, Y.S.; Yap, S.L.; Favre, M.

    2013-01-01

    The mechanism of nanoparticle formation by wire explosion process has been investigated by optical emission spectroscopy in Antony et al. 2010 [2] [J Quant Spectrosc Radiat Transfer 2010; 111:2509]. It was reported that the size of the nanoparticles formed in Ar ambience increases with increasing pressure, while an opposite trend was observed for the nanoparticles produced in N 2 and He ambiences. However, the physics behind this opposite trend seems unclear. In this work, we have investigated the probable mechanism behind the opposite trend in particle size with pressure of different gases and understand the mechanism of nanoparticle formation in wire explosion process. The experiment was carried out to investigate the effect of ambient gas species (Ar and N 2 ) and pressure on arc plasma formation and its corresponding effects on the characteristics of the produced nanoparticles in wire explosion process. Our results show that the arc plasma formation is probably the mechanism that may account for the opposite trend of particle size with pressure of different gases. -- Highlights: ► Cu nanoparticles have been synthesized by wire explosion technique. ► Investigate the effect of the ambient gas species and pressure. ► Arc plasma formation in wire explosion process is investigated. ► Arc plasma formation plays a crucial role in characteristic of the nanoparticles

  1. Modeling of electric and heat processes in spot resistance welding of cross-wire steel bars

    Science.gov (United States)

    Iatcheva, Ilona; Darzhanova, Denitsa; Manilova, Marina

    2018-03-01

    The aim of this work is the modeling of coupled electric and heat processes in a system for spot resistance welding of cross-wire reinforced steel bars. The real system geometry, dependences of material properties on the temperature, and changes of contact resistance and released power during the welding process have been taken into account in the study. The 3D analysis of the coupled AC electric and transient thermal field distributions is carried out using the finite element method. The novel feature is that the processes are modeled for several successive time stages, corresponding to the change of contact area, related contact resistance, and reduction of the released power, occurring simultaneously with the creation of contact between the workpieces. The values of contact resistance and power changes have been determined on the basis of preliminary experimental and theoretical investigations. The obtained results present the electric and temperature field distributions in the system. Special attention has been paid to the temperature evolution at specified observation points and lines in the contact area. The obtained information could be useful for clarification of the complicated nature of interrelated electric, thermal, mechanical, and physicochemical welding processes. Adequate modeling is also an opportunity for proper control and improvement of the system.

  2. AC losses in superconductors: a multi-scale approach for the design of high current cables

    International Nuclear Information System (INIS)

    Escamez, Guillaume

    2016-01-01

    The work reported in this PhD deals with AC losses in superconducting material for large scale applications such as cables or magnets. Numerical models involving FEM or integral methods have been developed to solve the time transient electromagnetic distributions of field and current densities with the peculiarity of the superconducting constitutive E-J equation. Two main conductors have been investigated. First, REBCO superconductors for applications operating at 77 K are studied and a new architecture of conductor (round wires) for 3 kA cables. Secondly, for very high current cables, 3-D simulations on MgB 2 wires are built and solved using FEM modeling. The following chapter introduced new development used for the calculation of AC losses in DC cables with ripples. The thesis ends with the use of the developed numerical model on a practical example in the european BEST-PATHS project: a 10 kA MgB 2 demonstrator [fr

  3. Investigations on gradient a.c. conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Unknown

    Electrical measurements were carried out in the temperature range 24–120°C and in the frequency range 4–100 kHz. It was observed that the a.c. conductivity increased initially and then decreased with increase of temperature and frequencies. The increase of distance from outer surface to the inner surface side increased ...

  4. AC Loss Reduction in Filamentized YBCO Coated Conductors with Virtual Transverse Cross-cuts

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yifei [ORNL; Duckworth, Robert C [ORNL; Ha, Tam T [ORNL; List III, Frederick Alyious [ORNL; Gouge, Michael J [ORNL; Chen, Y [SuperPower Incorporated, Schenectady, New York; X, Xiong, [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2011-01-01

    While the performance of YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO)-based coated conductors under dc currents has improved significantly in recent years, filamentization is being investigated as a technique to reduce ac loss so that the 2nd generation (2G) high temperature superconducting (HTS) wires can also be utilized in various ac power applications such as cables, transformers and fault current limiters. Experimental studies have shown that simply filamentizing the superconducting layer is not effective enough to reduce ac loss because of incomplete flux penetration in between the filaments as the length of the tape increases. To introduce flux penetration in between the filaments more uniformly and further reduce the ac loss, virtual transverse cross-cuts were made in superconducting filaments of the coated conductors fabricated using the metal organic chemical vapor deposition (MOCVD) method. The virtual transverse cross-cuts were formed by making cross-cuts (17 - 120 {micro}m wide) on the IBAD (ion beam assisted deposition)-MgO templates using laser scribing followed by depositing the superconducting layer ({approx} 0.6 {micro}m thick). AC losses were measured and compared for filamentized conductors with and without the cross-cuts under applied peak ac fields up to 100 mT. The results were analyzed to evaluate the efficacy of filament decoupling and the feasibility of using this method to achieve ac loss reduction.

  5. Mid-term outcome comparing temporary K-wire fixation versus PDS augmentation of Rockwood grade III acromioclavicular joint separations

    Directory of Open Access Journals (Sweden)

    Pilotto Susann

    2009-05-01

    Full Text Available Abstract Backround The treatment of acute acromioclavicular (AC joint injuries depends mainly on the type of the dislocation and patient demands. This study compares the mid term outcome of two frequently performed surgical concepts of Rockwood grade III AC joint separations: The temporary articular fixation with K-wires (TKW and the refixation with an absorbable polydioxansulfate (PDS sling. Findings Retrospective observational study of 86 patients with a mean age of 37 years underwent either TKW (n = 70 or PDS treatment (n = 16 of Rockwood grade III AC joint injuries. Mid term outcome with a mean follow up of 3 years was measured using a standardized functional patient questionnaire including Constant score, ASES rating scale, SPADI, XSMFA-D and a pain score. K-wire therapy resulted in significantly better functional results expressed by Constant score (88 ± 10 vs. 73 ± 18, ASES rating scale (29 ± 3 vs. 25 ± 5, SPADI (3 ± 9 vs. 9 ± 13, XSMFA-D function (13 ± 2 vs. 14 ± 3, XSMFA-D impairment (4 ± 1 vs. 6 ± 2 and pain score (1 ± 1 vs. 2 ± 2. Conclusion Either temporary K-wire fixation and PDS sling enable good or satisfying functional results in the treatment of Rockwood grade III AC separations. However functional outcome parameters indicate a significant advantage for the K-wire technique.

  6. Wire Rupture Optimization in Wire Electrical Discharge Machining using Taguchi Approach

    Directory of Open Access Journals (Sweden)

    Maher Ibrahem

    2017-01-01

    Full Text Available Wire electrical discharge machining (WEDM is one of the most important nontraditional machining process that is well-known for cutting difficult to machine materials. The wire electrode along with machining parameters control the WEDM process. This research work focuses on optimizing WEDM parameters using Taguchi technique to minimize wire rupture. Experiments have been done using the L18 orthogonal array. Each experiment is repeated three times to ensure accurate readings of the wire rupture. The statistical methods of signal to noise ratio (S/N ratio is applied to study effects of peak current, pulse width, charging time, wire speed, and wire tension on wire rupture. As a results, the peak current, pulse width, and wire tension have the most significant effect on wire rupture followed by charging time and wire speed. The developed analysis can be used in the metal cutting field to identify the optimum machining parameters for less wire rupture.

  7. AcEST: DK963222 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sp|P81919|OR46A_DROME Odorant receptor 46a, isoform A OS=Drosoph... 32 2.8 sp|Q5MJ68|SPDYC_HUMAN Speed...FCFKA 181 CS +T + AV S L + +YV + AC Q FI C+ A Sbjct: 262 CSVLVLTANFYAIAVLSDERLELFKYVTYQACMLIQIFILCYYA 305 >sp|Q5MJ68|SPDYC_HUMAN Spee

  8. AcEST: BP913556 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N Ubiquitin-protein ligase E3B OS=Homo sapie... 31 3.5 sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/F/G/H O...SVPALVTHLSTVTPERLTVLESHDMLRKF 287 >sp|Q9VDW6|DMDA_DROME Dystrophin, isoforms A/C/

  9. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  10. Sample of superconducting wiring from the LHC

    CERN Multimedia

    The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. Magnet coils are made of copper-clad niobium–titanium cables — each wire in the cable consists of 9’000 niobium–titanium filaments ten times finer than a hair. The cables carry up to 12’500 amps and must withstand enormous electromagnetic forces. At full field, the force on one metre of magnet is comparable to the weight of a jumbo jet. Coil winding requires great care to prevent movements as the field changes. Friction can create hot spots wh...

  11. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  12. Nuclear structure of 231Ac

    International Nuclear Information System (INIS)

    Boutami, R.; Borge, M.J.G.; Mach, H.; Kurcewicz, W.; Fraile, L.M.; Gulda, K.; Aas, A.J.; Garcia-Raffi, L.M.; Lovhoiden, G.; Martinez, T.; Rubio, B.; Tain, J.L.; Tengblad, O.

    2008-01-01

    The low-energy structure of 231 Ac has been investigated by means of γ ray spectroscopy following the β - decay of 231 Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of 231 Ra → 231 Ac has been constructed for the first time. The Advanced Time Delayed βγγ(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus

  13. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA...

  14. Enhancing wire-composite bond strength of bonded retainers with wire surface treatment.

    Science.gov (United States)

    Oesterle, L J; Shellhart, W C; Henderson, S

    2001-06-01

    Bonded orthodontic retainers with wires embedded in composite resin are commonly used for orthodontic retention. The purpose of this study was to test, in vitro, various wire surface treatments to determine the optimal method of enhancing the wire-composite bond strength. Coaxial wires and stainless steel wires with different surface treatments were bonded to bovine enamel and then pulled along their long axes with an Instron universal testing machine. Wire surface treatments included placing a right-angle bend in the wire, microetching the wire, and treating the wire with adhesion promoters; combinations of treatments were also examined. The results demonstrated a 24-fold increase in the wire-composite bond strength of wire that was microetched (sandblasted), compared with that of untreated straight wire. The difference between the amount of force required to break the bond produced by microetching alone (246.1 +/- 46.0 MPa) and that required for the bonds produced by the retentive bend (87.8 +/- 16.3 MPa), the adhesion promoters (silane, 11.0 +/- 3.1 MPa; Metal Primer, 28.5 +/- 15.8 MPa), or for any combination of surface treatments, was statistically significant. Microetching a stainless steel wire produced a higher wire-composite bond strength than that obtained from a coaxial wire (113.5 +/- 27.5 MPa). The results of this study indicate that microetching or sandblasting a stainless steel wire significantly increases the strength of the wire-composite bond.

  15. Ac hopping conduction at extreme disorder takes place on the percolating cluster

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, J. C.

    2008-01-01

    Simulations of the random barrier model show that ac currents at extreme disorder are carried almost entirely by the percolating cluster slightly above threshold; thus contributions from isolated low activation-energy clusters are negligible. The effective medium approximation in conjunction...... with the Alexander-Orbach conjecture lead to an excellent analytical fit to the universal ac conductivity with no nontrivial fitting parameters....

  16. Proportional counters aged anode wire recovering using an 80%CF4 + 20%CO2 gas mixture

    CERN Document Server

    Gavrilov, Gennady; Conti, Richard; Fetisov, Andrey; Maysuzenko, Dmitry; Shvecova, Natalia; Vakhtel, Victor

    2011-01-01

    A technique to recover a gas proportional counter having an aged anode wire using a glow discharge in an 80%CF4 + 20%CO2 gas mixture has been developed and tested. Studies of aging effects were carried out under sustained irradiation by an intense 90Sr -source of the straw proportional counters operated with a 60%Ar + 30%CO2 + 10%CF4 gas mixture. Special attention was paid to the aging mechanism of the anode wires. Our experience showed that using a given gas mixture the swelling of the anode wires is a typical mode of aging that leads to degradation of the gas gain. The proposed method of recovery provided a complete restoration of the gas gain and the signal amplitude in the damaged zone of the wire. SEM/XEM analysis confirmed successful cleaning WOx deposits from the wire surface. The application of this method to recover the aged gaseous detectors in real experimental conditions is discussed.

  17. Imperfection analysis of flexible pipe armor wires in compression and bending

    DEFF Research Database (Denmark)

    Østergaard, Niels Højen; Lyckegaard, Anders; Andreasen, Jens H.

    2012-01-01

    The work presented in this paper is motivated by a specific failure mode known as lateral wire buckling occurring in the tensile armor layers of flexible pipes. The tensile armor is usually constituted by two layers of initially helically wound steel wires with opposite lay directions. During pipe...... laying in ultra deep waters, a flexible pipe experiences repeated bending cycles and longitudinal compression. These loading conditions are known to impose a danger to the structural integrity of the armoring layers, if the compressive load on the pipe exceeds the total maximum compressive load carrying...... ability of the wires. This may cause the wires to buckle in the circumferential pipe direction, when these are restrained against radial deformations by adjacent layers. In the present paper, a single armoring wire modeled as a long and slender curved beam embedded in a frictionless cylinder bent...

  18. Influence of working gas properties on MWPC anode wire modulation effect

    Science.gov (United States)

    Wang, Xiao-Hu; Chen, Xiao-Qiang

    2015-10-01

    For MWPCs used for X-ray position detection, simulation studies of the anode wire modulation effect of the detector were carried out using the Garfield program. Different gas mixtures were used as the working gas in the simulation, so as to obtain the influence of the X-ray cross section and electron diffusion coefficient of the working gases on the anode wire modulation effect of an MWPC with anode wire spacing of 2 mm. Results show that, though a working gas with higher X-ray cross section implies a larger average drift distance for the ionized electrons, such gas mixtures are of little use in improving the anode wire modulation effect of MWPCs. It is found that the transverse electron diffusion coefficient is the determining factor for the extent of the anode wire modulation effect in the detector. Supported by Scientific Research Fund of Sichuan Provincial Education Department (11ZA140)

  19. On the Behaviour of Current-Carrying Wire-Conductors and Bucking of a Column

    DEFF Research Database (Denmark)

    Ganji, S. S.; Barari, Amin; Fereidoon, A.

    2013-01-01

    -conductors and bucking of a column as well as their comparisons with the exact solutions are presented. Different specific parameters and initial values comprising the mass and stiffness are studied within the current research and excellent accuracy which is the most significant feature of the proposed solutions...

  20. Forces on a current-carrying wire in a magnetic field: the macro-micro connection

    DEFF Research Database (Denmark)

    Avelar Sotomaior Karam, Ricardo; Kneubil, Fabiana; Robilotta, Manoel

    2017-01-01

    distributions, we show that the electrons are subject to both magnetic and electric forces, whereas the ionic lattice of the metal is dragged by an electric force. Furthermore, an analysis of the orders of magnitude involved in the problem gives counterintuitive results with valuable educational potential. We...

  1. DC voltage profile of a 1D pumped wire with two dynamical and one static impurities

    Energy Technology Data Exchange (ETDEWEB)

    Foieri, Federico, E-mail: ffoieri@df.uba.a [Departamento de Fisica ' J.J. Giambiagi' FCEyN, Universidad de Buenos Aires, Ciudad Universitaria Pab. I (1428), Buenos Aires (Argentina); Arrachea, Liliana [Departamento de Fisica ' J.J. Giambiagi' FCEyN, Universidad de Buenos Aires, Ciudad Universitaria Pab. I (1428), Buenos Aires (Argentina); Jose Sanchez, Maria [Centro Atomico Bariloche and Instituto Balseiro, Bustillo 9500 (8400), Bariloche (Argentina)

    2009-10-01

    In this work we study the behavior of the voltage profile of a 1D quantum wire with an impurity when transport is induced by two ac voltages that oscillating with a phase lag define a quantum pump. The voltage profile sensed along the wire by the voltage probe, that we assume weakly coupled to the system, exhibits a Friedel's oscillations structure inside the region delimited by the position of the two ac voltages that induce transport. On the other hand, outside this region the oscillations are suppressed. Using perturbation theory in the coupling constant of the voltage probe we derived analytical expressions for the DC current valid for the adiabatic regime. We also compare our analytical results with the exact numerical calculations using Keldysh non-equilibrium Green's functions formalism.

  2. DC voltage profile of a 1D pumped wire with two dynamical and one static impurities

    Science.gov (United States)

    Foieri, Federico; Arrachea, Liliana; José Sánchez, María

    2009-10-01

    In this work we study the behavior of the voltage profile of a 1D quantum wire with an impurity when transport is induced by two ac voltages that oscillating with a phase lag define a quantum pump. The voltage profile sensed along the wire by the voltage probe, that we assume weakly coupled to the system, exhibits a Friedel's oscillations structure inside the region delimited by the position of the two ac voltages that induce transport. On the other hand, outside this region the oscillations are suppressed. Using perturbation theory in the coupling constant of the voltage probe we derived analytical expressions for the DC current valid for the adiabatic regime. We also compare our analytical results with the exact numerical calculations using Keldysh non-equilibrium Green's functions formalism.

  3. The minimization of ac phase noise in interferometric systems

    DEFF Research Database (Denmark)

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using...

  4. Put Your Cable Wiring to the Test.

    Science.gov (United States)

    Day, C. William

    2001-01-01

    Discusses why schools and universities should use testing procedures in any wire bid specification for cable wiring and also know how experienced the installers are in testing and installing structured cabling systems. Key cabling terms are included. (GR)

  5. Evaluation of Microbial Contamination of Different Orthodontic as Received Arch Wires from Manufacturers

    Directory of Open Access Journals (Sweden)

    Hassan Suha Saad

    2017-12-01

    Full Text Available Aims of study: The present study was carried out to assess whether as received arch wires from manufactures are free of microbial contamination as well as to identify the bacterial count and types attached to arch wires. Materials and Methods: Eighty samples were included in this study consisting of two types of arch wires (nitinol and stainlesssteel; they were from four companies (3 M, Ortho-Technology, Jiscop and G&H. The wires were inserted into plane tubes that contain 10 ml of BHI broth and tris-EDTA. Further 0.1 ml was withdrawn from plane tube and spread on agar plates. Moreover 16 plane tubes (8 tubes with brain heart infusion broth and 8 with tris-EDTA without arch wires were considered as controls group. Results: Microbial sampling yielded growth from 7 of the 80 arch wires studied, the predominant bacteria isolated were staphylococci spp. No growth was recovered from 73 of the samples and from controls. The total viable count of bacteria in BHI reagent is more than that in Tris-EDTA reagent with statistically significant difference (P0.05. In regard to the presence and distribution of bacteria according to types of wires, the stainless-steel wires have more viable count (49.58 than that in nitinol (47.42 but statistically not significant (P0.05. Conclusion: The arch wires received from manufacturer are often contaminated and therefore there is a need for routine disinfection of such items. This study found that the BHI more is effective in dislodging the bacteria from orthodontic arch wires than tris- EDTA. However, the stainless-steel arch wires were more contaminated than nitinol and most common contaminant were Staphylococci spp

  6. Wire Position Monitoring with FPGA based Electronics

    International Nuclear Information System (INIS)

    Eddy, N.; Lysenko, O.

    2009-01-01

    This fall the first Tesla-style cryomodule cooldown test is being performed at Fermilab. Instrumentation department is preparing the electronics to handle the data from a set of wire position monitors (WPMs). For simulation purposes a prototype pipe with a WMP has been developed and built. The system is based on the measurement of signals induced in pickups by 320 MHz signal carried by a wire through the WPM. The wire is stretched along the pipe with a tensioning load of 9.07 kg. The WPM consists of four 50 (Omega) striplines spaced 90 o apart. FPGA based digitizer scans the WPM and transmits the data to a PC via VME interface. The data acquisition is based on the PC running LabView. In order to increase the accuracy and convenience of the measurements some modifications were required. The first is implementation of an average and decimation filter algorithm in the integrator operation in the FPGA. The second is the development of alternative tool for WPM measurements in the PC. The paper describes how these modifications were performed and test results of a new design. The last cryomodule generation has a single chain of seven WPMs (placed in critical positions: at each end, at the three posts and between the posts) to monitor a cold mass displacement during cooldown. The system was developed in Italy in collaboration with DESY. Similar developments have taken place at Fermilab in the frame of cryomodules construction for SCRF research. This fall preliminary cryomodule cooldown test is being performed. In order to prepare an appropriate electronic system for the test a prototype pipe with a WMP has been developed and built, figure 1. The system is based on the measurement of signals induced in pickups by 320 MHz signal carried by a wire through the WPM. The 0.5 mm diameter Cu wire is stretched along the pipe with a tensioning load of 9.07 kg and has a length of 1.1 m. The WPM consists of four 50 (Omega) striplines spaced 90 o apart. An FPGA based digitizer

  7. Novel Wiring Technologies for Aerospace Applications

    Science.gov (United States)

    Gibson, Tracy L.; Parrish, Lewis M.

    2014-01-01

    Because wire failure in aerospace vehicles could be catastrophic, smart wiring capabilities have been critical for NASA. Through the years, researchers at Kennedy Space Center (KSC) have developed technologies, expertise, and research facilities to meet this need. In addition to aerospace applications, NASA has applied its knowledge of smart wiring, including self-healing materials, to serve the aviation industry. This webinar will discuss the development efforts of several wiring technologies at KSC and provide insight into both current and future research objectives.

  8. Clinical bending of nickel titanium wires

    OpenAIRE

    Stephen Chain; Priyank Seth; Namrata Rastogi; Kenneth Tan; Mayank Gupta; Richa Singh

    2015-01-01

    Since the evolution and the involvement of Nickel Titanium wires in the field of Orthodontics. The treatment plan has evolved with the use of low force Nickel Titanium wires. Because of their high springback, low stiffness, they are the key initial wires in leveling and alignment but have poor formability. Since poor formability limits its ability to create variable arch forms thus; limits the form of treatment. We have devised a method to bend the Nickel Titanium wires to help in our invento...

  9. Towards Unconventional Applications of Wire Bonding

    OpenAIRE

    Schröder, Stephan

    2018-01-01

    This thesis presents novel heterogeneous integration approaches of wire materials to fabricated and package MEMS devices by exploring unconventional applications of wire bonding technology. Wire bonding, traditionally endemic in the realm of device packaging to establish electrical die-to-package interconnections, is an attractive back-end technology, offering promising features, such as high throughput, flexibility and placement accuracy. Exploiting the advantages of state-of-the-art wire bo...

  10. Different mechanical properties in Seldinger guide wires

    Directory of Open Access Journals (Sweden)

    Wolfram Schummer

    2015-01-01

    Full Text Available Background and Aims: Most central venous catheters are placed using Seldinger guide wires. EN ISO 11070 is the guideline for testing guide wire flexing performance and tensile strength, and we can safely assume that guide wires in use meet these requirements. Unfortunately, EN ISO 11070 guidelines do not reflect the clinical requirements and we continue to see mechanical failures and their associated complications. Material and Methods: This in vitro study was performed in an accredited laboratory. With regard to flexing, we: (1 Established the minimum flexing performance needed to meet clinical requirements, (2 developed flexing performance tests which mimic clinical requirement, and (3 evaluated the mechanical properties of various guide wires relative to these requirements. With regard to tensile strength, we used the testing method prescribed in ISO 11070, but did not end the test at 5 Newton (N. We continued until the guide wire was damaged, or we reached maximum tractive force. We then did a wire-to-wire comparison. We examined two basic wire constructions, monofil and core and coil. Results: Tensile strength: All wires tested, except one, met EN ISO 11070 requirements for 5 N tensile strength. The mean of the wire types tested ranged from 15.06 N to 257.76 N. Flexing performance: None of the wires kinked. The monofil had no evidence of bending. Two core/coil wires displayed minor bending (angle 1.5°. All other wires displayed bending angles between 22.5° and 43.0°. Conclusion: We recommend that: (1 Clinicians use guide wires with high-end mechanical properties, (2 EN ISO 11070 incorporate our flexing test into their testing method, raise the flexing requirement to kink-proof, (3 and raise the tensile strength requirement to a minimum of 30 N, and (3 all manufacturers and suppliers be required to display mechanical properties of all guide wire, and guide wire kits sold.

  11. Vocational Preparation Curriculum: Electrical Wiring.

    Science.gov (United States)

    Usoro, Hogan

    This document is a curriculum guide for instructors teaching vocational preparation for electrical wiring to special needs students. The purpose of the curriculum guide is to provide minimum skills for disadvantaged and handicapped students entering the mainstream; to supplement vocational skills of those students already in a regular training…

  12. Transparency in nanophotonic quantum wires

    International Nuclear Information System (INIS)

    Singh, Mahi R

    2009-01-01

    We have studied the quantum optics of a photonic quantum nanowire doped with an ensemble of three-level nanoparticles. The wire is made from two photonic crystals A and B. Crystal A is embedded within crystal B and acts as a photonic nanowire. It is considered that the conduction band of crystal A lies below that of crystal B. As a result, photons are confined in crystal A and are reflected from crystal B. The bound states of the confined photons are calculated using the transfer matrix method. It is found that the number of bound states in the wire depends on the size of the wire and the energy difference between the conduction band extrema of crystals A and B. The absorption coefficient of the system has also been calculated using the Schroedinger equation method. It is considered that the nanoparticles interact with the photonic bound states. Numerical simulations show that when one of the resonance energies lies near the bound state, the system becomes transparent. However, when the resonance energy lies away from the bound state the crystal reverts to an absorbing state. Similarly, when the radius of the dielectric spheres is changed the location of the transparency peak is shifted. This means that the present system can be switched between two states by changing the size of the wire and the transition energy. These findings can be used to make new types of optical devices.

  13. Health care's 100 most wired.

    Science.gov (United States)

    Solovy, A; Serb, C

    1999-02-01

    They're wired all right, and America's 100 most techno-savvy hospitals and health systems share one more thing: a commitment to using technology to link with employees, patients, suppliers, and insurers. "We want to be a health care travel agency for our community," says one chief information officer. "And we see Internet technology as a key."

  14. Influences of Corrosive Sulfur on Copper Wires and Oil-Paper Insulation in Transformers

    Directory of Open Access Journals (Sweden)

    Jian Li

    2011-10-01

    Full Text Available Oil-impregnated paper is widely used in power transmission equipment as a reliable insulation. However, copper sulphide deposition on oil-paper insulation can lead to insulation failures in power transformers. This paper presents the influences of copper sulfur corrosion and copper sulphide deposition on copper wires and oil-paper insulation in power transformers. Thermal aging tests of paper-wrapped copper wires and bare copper wires in insulating oil were carried out at 130 °C and 150 °C in laboratory. The corrosive characteristics of paper-wrapped copper wires and bare copper wires were analyzed. Dielectric properties of insulation paper and insulating oil were also analyzed at different stages of the thermal aging tests using a broadband dielectric spectrometer. Experiments and analysis results show that copper sulfide deposition on surfaces of copper wires and insulation paper changes the surface structures of copper wires and insulation paper. Copper sulfur corrosion changes the dielectric properties of oil-paper insulation, and the copper sulfide deposition greatly reduces the electrical breakdown strength of oil-paper insulation. Metal passivator is capable of preventing copper wires from sulfur corrosion. The experimental results are helpful for investigations for fault diagnosis of internal insulation in power transformers.

  15. Multi-anode wire straw tube tracker

    International Nuclear Information System (INIS)

    Oh, S.H.; Ebenstein, W.L.; Wang, C.W.

    2011-01-01

    We report on a test of a straw tube detector design having several anode (sense) wires inside a straw tube. The anode wires form a circle inside the tube and are read out independently. This design could solve several shortcomings of the traditional single wire straw tube design such as double hit capability and stereo configuration.

  16. Home and School Technology: Wired versus Wireless.

    Science.gov (United States)

    Van Horn, Royal

    2001-01-01

    Presents results of informal research on smart homes and appliances, structured home wiring, whole-house audio/video distribution, hybrid cable, and wireless networks. Computer network wiring is tricky to install unless all-in-one jacketed cable is used. Wireless phones help installers avoid pre-wiring problems in homes and schools. (MLH)

  17. On the preparation of superconducting wires

    International Nuclear Information System (INIS)

    Topare, R.J.; Chinchure, A.D.; Shah, S.S.; Hadole, G.B.

    1993-01-01

    The different methods of preparation of superconducting wires have been discussed. The powder-in-tube technique is followed for the preparation of YBCO and BISCCO superconducting wires. The results are discussed. The present status of the industries in preparing the superconducting wires having the maximum J c values is discussed. (author). 30 refs., 6 figs., 2 tabs

  18. Pre-wired systems prove their worth.

    Science.gov (United States)

    2012-03-01

    The 'new generation' of modular wiring systems from Apex Wiring Solutions have been specified for two of the world's foremost teaching hospitals - the Royal London and St Bartholomew's Hospital, as part of a pounds sterling 1 billion redevelopment project, to cut electrical installation times, reduce on-site waste, and provide a pre-wired, factory-tested, power and lighting system. HEJ reports.

  19. 75 FR 4584 - Wire Decking From China

    Science.gov (United States)

    2010-01-28

    ... COMMISSION Wire Decking From China AGENCY: United States International Trade Commission. ACTION: Scheduling... retarded, by reason of subsidized and less-than-fair-value imports from China of wire decking, provided for..., producers, or exporters in China of wire decking, and that such ] products are being sold in the United...

  20. Design of a Probe for Strain Sensitivity Studies of Critical Current Densities in SC Wires and Tapes

    Energy Technology Data Exchange (ETDEWEB)

    Dhanaraj, N.; Barzi, E.; Turrioni, D.; Rusy, A.; Lombardo, V.; /Fermilab

    2011-07-01

    The design of a variable-temperature probe used to perform strain sensitivity measurements on LTS wires and HTS wires and tapes is described. The measurements are intended to be performed at liquid helium temperatures (4.2 K). The wire or tape to be measured is wound and soldered on to a helical spring device, which is fixed at one end and subjected to a torque at the free end. The design goal is to be able to achieve {+-} 0.8 % strain in the wire and tape. The probe is designed to carry a current of 2000A.

  1. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Directory of Open Access Journals (Sweden)

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  2. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  3. Complications and re-operation rate after tension-band wiring of olecranon fractures

    DEFF Research Database (Denmark)

    Romero, J M; Miran, A; Jensen, Claus Hjorth

    2000-01-01

    Tension-band wire fixation of olecranon fractures leads to a high re-operation rate because of the need to remove the metalware. This problem has commonly been thought to be related mainly to the backing-out of the Kirschner wires. A retrospective study was carried out in 55 patients with displaced...... olecranon fractures operated on with the tension-band wiring technique, in whom there was an overall 71.7% re-operation rate. Complications were few and minor in most patients. The main reason for the removal of the metalware was a direct complaint from the patient (in 61.3% of all removals). A literature...

  4. Influence of tensile stress and frequency on the longitudinal magnetic hysteresis of amorphous wires

    International Nuclear Information System (INIS)

    Torres, Carlos; Maria Munoz, Jose; Hernandez-Gomez, Pablo; Francisco, Carlos de

    2010-01-01

    This work studies the longitudinal magnetic hysteresis of amorphous wires with different Fe or Co compositions through an external magnetic field in the axial direction. Measurements have been carried out with the help of a digitally processed system in the 50 Hz-1 kHz frequency range. In addition, the influence of different tensile stresses has been also analyzed. The results show that both parameters change considerably the magnetic hysteresis of the wires but in a different way depending on their composition. This behaviour has been interpreted in terms of the different domain distribution associated with the opposite sign of the magnetostriction for Fe and Co-based wires, respectively.

  5. Design and fuel fabrication processes for the AC-3 mixed-carbide irradiation test

    International Nuclear Information System (INIS)

    Latimer, T.W.; Chidester, K.M.; Stratton, R.W.; Ledergerber, G.; Ingold, F.

    1992-01-01

    The AC-3 test was a cooperative U.S./Swiss irradiation test of 91 wire-wrapped helium-bonded U-20% Pu carbide fuel pins irradiated to 8.3 at % peak burnup in the Fast Flux Test Facility. The test consisted of 25 pins that contained spherepac fuel fabricated by the Paul Scherrer Institute (PSI) and 66 pins that contained pelletized fuel fabricated by the Los Alamos National Laboratory. Design of AC-3 by LANL and PSI was begun in 1981, the fuel pins were fabricated from 1983 to 1985, and the test was irradiated from 1986 to 1988. The principal objective of the AC-3 test was to compare the irradiation performance of mixed-carbide fuel pins that contained either pelletized or sphere-pac fuel at prototypic fluence and burnup levels for a fast breeder reactor

  6. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  7. Clinical bending of nickel titanium wires

    Directory of Open Access Journals (Sweden)

    Stephen Chain

    2015-01-01

    Full Text Available Since the evolution and the involvement of Nickel Titanium wires in the field of Orthodontics. The treatment plan has evolved with the use of low force Nickel Titanium wires. Because of their high springback, low stiffness, they are the key initial wires in leveling and alignment but have poor formability. Since poor formability limits its ability to create variable arch forms thus; limits the form of treatment. We have devised a method to bend the Nickel Titanium wires to help in our inventory but also customized the wire according to the treatment.

  8. Emittance growth due to Tevatron flying wires

    Energy Technology Data Exchange (ETDEWEB)

    Syphers, M; Eddy, Nathan

    2004-06-01

    During Tevatron injection, Flying Wires have been used to measure the transverse beam size after each transfer from the Main Injector in order to deduce the transverse emittances of the proton and antiproton beams. This amounts to 36 + 9 = 45 flies of each of 3 wire systems, with an individual wire passing through each beam bunch twice during a single ''fly''. below they estimate the emittance growth induced by the interaction of the wires with the particles during these measurements. Changes of emittance from Flying Wire measurements conducted during three recent stores are compared with the estimations.

  9. Plasma dynamics in aluminium wire array Z-pinch implosions

    International Nuclear Information System (INIS)

    Bland, S.N.

    2001-01-01

    The wire array Z-pinch is the world's most powerful laboratory X-ray source. An achieved power of ∼280TW has generated great interest in the use of these devices as a source of hohlraum heating for inertial confinement fusion experiments. However, the physics underlying how wire array Z-pinches implode is not well understood. This thesis presents the first detailed measurements of plasma dynamics in wire array experiments. The MAGPIE generator, with currents of up to 1.4MA, 150ns 10-90% rise-time, was used to implode arrays of 16mm diameter typically containing between 8 and 64 15μm aluminium wires. Diagnostics included: end and side-on laser probing with interferometry, schlieren and shadowgraphy channels; radial and axial streak photography; gated X-ray imaging; XUV and hard X-ray spectrometry; filtered XRDs and diamond PCDs; and a novel X-ray backlighting system to probe high density plasma. It was found that the plasma formed from the wires consisted of cold, dense cores, which ablated producing hot, low density coronal plasma. After an initial acceleration around the cores, coronal plasma streams flowed force-free towards the axis, with an instability wavelength determined by the core size. At ∼50% of the implosion time, the streams collided on axis forming a precursor plasma which appeared to be uniform, stable, and inertially confined. The existence of core-corona structure significantly affected implosion dynamics. For arrays with <64 wires, the wire cores remained in their original positions until ∼80% of the implosion time before accelerating rapidly. At 64 wires a transition in implosion trajectories to 0-D like occurred indicating a possible merger of current carrying plasma close to the cores - the cores themselves did not merge. During implosion, the cores initially developed uncorrelated instabilities that then transformed into a longer wavelength global mode of instability. The study of nested arrays (2 concentric arrays, one inside the other

  10. Removal of nitrate ions from water by activated carbons (ACs)—Influence of surface chemistry of ACs and coexisting chloride and sulfate ions

    Science.gov (United States)

    Ota, Kazunari; Amano, Yoshimasa; Aikawa, Masami; Machida, Motoi

    2013-07-01

    Adsorptive removal of nitrate ions in aqueous solution using activated carbons (ACs) was examined. After ash was removed from Filtrasorb 400 AC, oxidation and outgassing and several heat treatments were carried out to modify the textural and surface properties of ACs. AC oxidized with 8 M nitric acid followed by outgassing at 900 °C (Ox-9OG) exhibited the greatest Langmuir adsorption capacity and affinity for nitrate removal among the total 7 ACs examined. Influence of coexisting chloride and sulfate ions was investigated as well to inspect the nitrate adsorption sites. The highest amount of sites which adsorbed nitrate ions exclusively could be observed for Ox-9OG adsorbent even though as great as 250 times greater number of chloride or sulfate ions over nitrate ions were present in the same aqueous system. Some basic oxygen species on carbon were estimated to work as selective adsorption sites for nitrate ions.

  11. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  12. Positioning and joining of organic single-crystalline wires

    Science.gov (United States)

    Wu, Yuchen; Feng, Jiangang; Jiang, Xiangyu; Zhang, Zhen; Wang, Xuedong; Su, Bin; Jiang, Lei

    2015-01-01

    Organic single-crystal, one-dimensional materials can effectively carry charges and/or excitons due to their highly ordered molecule packing, minimized defects and eliminated grain boundaries. Controlling the alignment/position of organic single-crystal one-dimensional architectures would allow on-demand photon/electron transport, which is a prerequisite in waveguides and other optoelectronic applications. Here we report a guided physical vapour transport technique to control the growth, alignment and positioning of organic single-crystal wires with the guidance of pillar-structured substrates. Submicrometre-wide, hundreds of micrometres long, highly aligned, organic single-crystal wire arrays are generated. Furthermore, these organic single-crystal wires can be joined within controlled angles by varying the pillar geometries. Owing to the controllable growth of organic single-crystal one-dimensional architectures, we can present proof-of-principle demonstrations utilizing joined wires to allow optical waveguide through small radii of curvature (internal angles of ~90–120°). Our methodology may open a route to control the growth of organic single-crystal one-dimensional materials with potential applications in optoelectronics. PMID:25814032

  13. Vibrating wire for beam profile scanning

    Directory of Open Access Journals (Sweden)

    S. G. Arutunian

    1999-12-01

    Full Text Available A method that measures the transverse profile (emittance of the bunch by detecting radiation arising at the scattering of the bunch on scanning wire is widely used. In this work information about bunch scattering is obtained by measuring the oscillation frequency of the tightened scanning wire. In such a way, the system of radiation (or secondary particles extraction and measurement can be removed. The entire unit consists of a compact fork with tightened wire and a scanning system. Normal oscillation frequency of a wire depends on wire tension, its geometric parameters, and, in a second approximation, its elastic characteristics. Normal oscillations are generated by interaction of an alternating current through the wire with magnetic field of a permanent magnet. In this case, it is suggested that the magnetic field of the accelerator (field of dipole magnets or quadrupole magnets be used for excitation of oscillations. The dependence of oscillation frequency on beam scattering is determined by several factors, including changes of wire tension caused by transverse force of the beam and influence of beam self-field. Preliminary calculations show that the influence of wire heating will dominate. We have studied strain gauges on the basis of vibrating wire from various materials (tungsten, beryl bronze, and niobium zirconium alloys. A scheme of normal oscillation generation by alternating current in autogeneration circuit with automatic frequency adjustment was selected. A special method of wire fixation and elimination of transverse degrees of freedom allows us to achieve relative stability better than 10^{-5} during several days at a relative resolution of 10^{-6}. Experimental results and estimates of wire heating of existing scanners show that the wire heats up to a few hundred grades, which is enough for measurements. The usage of wire of micrometer thickness diminishes the problem of wire thermalization speed during the scanning of the bunch.

  14. 75 FR 17313 - Temporary Assistance for Needy Families (TANF) Carry-Over Funds

    Science.gov (United States)

    2010-04-06

    ... RIN 0970-AC40 Temporary Assistance for Needy Families (TANF) Carry-Over Funds AGENCY: Administration.... SUMMARY: This final rule implements the statutory change to section 404(e) of the Social Security Act as... Territories to use Temporary Assistance for Needy Families (TANF) program funds carried over from a prior year...

  15. Modifications in straight wire treatment.

    Science.gov (United States)

    Cardona, Alvin

    2010-01-01

    Orthodontic treatments have been modified with each new generation of clinicians. Today the emphasis is on facial esthetics and healthy temporomandibular joints. With orthopedic treatment, we can develop dental arches to get the necessary space to align the teeth and we can reach adequate function and esthetics, all within relatively good stability. By combining two-phase treatment with low friction fixed orthodontics and super elastic wires we produce light but continuous forces and we can provide better treatment than before. These types of forces cause physiological and functional orthopedic orthodontic reactions. The purpose of this article is to demonstrate our fixed orthopedic and orthodontic approach called "Modified Straight Wire" or "Physiologic Arch Technique." This technique is very successful with our patients because it can exert slow and continuous forces with minimal patient cooperation.

  16. Sintered wire cesium dispenser photocathode

    Science.gov (United States)

    Montgomery, Eric J; Ives, R. Lawrence; Falce, Louis R

    2014-03-04

    A photoelectric cathode has a work function lowering material such as cesium placed into an enclosure which couples a thermal energy from a heater to the work function lowering material. The enclosure directs the work function lowering material in vapor form through a low diffusion layer, through a free space layer, and through a uniform porosity layer, one side of which also forms a photoelectric cathode surface. The low diffusion layer may be formed from sintered powdered metal, such as tungsten, and the uniform porosity layer may be formed from wires which are sintered together to form pores between the wires which are continuous from the a back surface to a front surface which is also the photoelectric surface.

  17. Slice of LHC dipole wiring

    CERN Multimedia

    Dipole model slice made in 1994 by Ansaldo. The high magnetic fields needed for guiding particles around the Large Hadron Collider (LHC) ring are created by passing 12’500 amps of current through coils of superconducting wiring. At very low temperatures, superconductors have no electrical resistance and therefore no power loss. The LHC is the largest superconducting installation ever built. The magnetic field must also be extremely uniform. This means the current flowing in the coils has to be very precisely controlled. Indeed, nowhere before has such precision been achieved at such high currents. 50’000 tonnes of steel sheets are used to make the magnet yokes that keep the wiring firmly in place. The yokes constitute approximately 80% of the accelerator's weight and, placed side by side, stretch over 20 km!

  18. Pin Wire Coating Trip Report

    International Nuclear Information System (INIS)

    Spellman, G P

    2004-01-01

    A meeting to discuss the current pin wire coating problems was held at the Reynolds plant in Los Angeles on 2MAR04. The attendance list for Reynolds personnel is attached. there was an initial presentation which gave a brief history and the current status of pin wire coating at Reynolds. There was a presentation by Lori Primus on the requirements and issues for the coating. There was a presentation by Jim Smith of LANL on the chemistry and to some extent process development done to date. There was a long session covering what steps should be taken in the short term and, to a lesser extent, the long term. The coating currently being used is a blend of two polymers, polyethersulfone and polyparabanic acid (PPA) and some TiO2 filler. This system was accepted and put into production when the pin wire coating was outsourced to another company in 1974. When that company no longer was interested, the wire coating was brought in-house to Reynolds. At that time polyparabanic acid was actually a commercial product available from Exxon under the trade name Tradlon. However, it appears that the material used at Reynolds was synthesized locally. Also, it appears that a single large batch was synthesized in that time period and used up to 1997 when the supply ran out. The reason for the inclusion of TiO2 is not known although it does act as a rheological thickener. However, a more controlled thickening can be obtained with materials such as fumed silica. This material would have less likelihood of causing point imperfections in the coatings. Also, the mixing technique being used for all stages of the process is a relatively low shear ball mill process and the author recommends a high shear process such as a three roll paint mill, at least for the final mixing. Since solvent is added to the powder at Reynolds, it may be that they need to have the paint mill there

  19. Properties of Carry Value Transformation

    Directory of Open Access Journals (Sweden)

    Suryakanta Pal

    2012-01-01

    Full Text Available Carry Value Transformation (CVT is a model of discrete deterministic dynamical system. In the present study, it has been proved that (1 the sum of any two nonnegative integers is the same as the sum of their CVT and XOR values. (2 the number of iterations leading to either CVT=0 or XOR=0 does not exceed the maximum of the lengths of the two addenda expressed as binary strings. A similar process of addition of modified Carry Value Transformation (MCVT and XOR requires a maximum of two iterations for MCVT to be zero. (3 an equivalence relation is shown to exist on Z×Z which divides the CV table into disjoint equivalence classes.

  20. Wear of dragline wire ropes

    Energy Technology Data Exchange (ETDEWEB)

    Dayawansa, D.; Kuruppu, M.; Mashiri, F.; Bartosiewicz, H. [Monash University (Caulfield Campus), Caulfield East, Vic. (Australia). Department of Mechanical Engineering,

    2005-07-01

    Wire ropes are one of the most heavily used components in a dragline. Hoist ropes are subjected to fatigue due to the cyclic nature of load handling as well as due to rope bending over the sheaves and the drum under load. This leads to wire breaks due to fatigue. Accumulation of a number of wire breaks close to each other can have a detrimental effect on the rope. Furthermore, to allow for the increasing demand for higher load capacity coupled with the inconvenience of having very large ropes, the factor of safety is often compromised, which increases the wear rate. Drag ropes are also subjected to heavy loads. More importantly, they are allowed to drag along the rough mine surface subjecting them to external physical abrasion. This makes the life of drag ropes one of the lowest among those used in a dragline. Suspension and IBS ropes are relatively uniformly loaded during their regular usage although they need to withstand dynamic load cycles as well as bending. Hence they tend to last for a number of years on average. The paper analyses the wear types and their severity of each of these rope applications, and suggests methods to determine rope wear rates and the resulting rope life. The paper further gives suggestions for good operating and maintenance practice that can extend the rope life and help reduce the large expenditure associated with every major rope change in a dragline. 6 refs., 8 figs., 1 tab.

  1. Effects of filament size on critical current density in overpressure processed Bi-2212 round wire.

    Science.gov (United States)

    Jiang, Jianyi; Francis, Ashleigh; Alicea, Ryan; Matras, Maxime; Kametani, Fumitake; Trociewitz, Ulf P; Hellstrom, Eric E; Larbalestier, David C

    2017-06-01

    Bi 2 Sr 2 CaCu 2 O x (Bi-2212) conductor is the only high temperature superconductor manufactured as a round wire and is a very promising conductor for very high field applications. One of the key design parameters of Bi-2212 wire is its filament size, which has been previously reported to affect the critical current density ( J c ) and ac losses. Work with 1 bar heat treatment showed that the optimal filament diameter was about 15 μm but it was not well understood at that time that gas bubbles were the main current limiting mechanism. Here we investigated a recent Bi-2212 wire with a 121×18 filament architecture with varying wire diameter (1.0 to 1.5 mm) using 50 bar overpressure processing. This wire is part of a 1.2 km piece length of 1.0 mm diameter made by Oxford Superconducting Technology. We found that J c is independent of the filament size in the range from 9 to 14 μm, although the n value increased with increasing filament size. A new record J c (4.2 K, 15 T) of 4200 A/mm 2 and J E (4.2 K, 15 T) of 830 A/mm 2 were achieved.

  2. How honey bees carry pollen

    Science.gov (United States)

    Matherne, Marguerite E.; Anyanwu, Gabriel; Leavey, Jennifer K.; Hu, David L.

    2017-11-01

    Honey bees are the tanker of the skies, carrying thirty percent of their weight in pollen per foraging trip using specialized orifices on their body. How do they manage to hang onto those pesky pollen grains? In this experimental study, we investigate the adhesion force of pollen to the honeybee. To affix pollen to themselves, honey bees form a suspension of pollen in nectar, creating a putty-like pollen basket that is skewered by leg hairs. We use tensile tests to show that the viscous force of the pollen basket is more than ten times the honeybee's flight force. This work may provide inspiration for the design of robotic flying pollinators.

  3. Loren Shriver carries Olympic torch

    Science.gov (United States)

    1996-01-01

    KSC Shuttle Operations Manager Loren J. Shriver proudly displays the Olympic torch that he carried to the top of Launch Pad 39A as his contribution to the July 7, 1996 KSC Olympic torch relay effort. Nineteen other KSC runners also participated in the relay effort at the Center. The Olympic torch arrived at KSC at 1:40 p.m. and traveled a 20-mile course to the pad and then out to the KSC visitor Center. The Space Shuttle Atlantis is behind Shriver, poised for the STS-79 mission, which will feature the fourth docking of the Shuttle with the Russian Mir space station.

  4. Why do dolphins carry sponges?

    Science.gov (United States)

    Mann, Janet; Sargeant, Brooke L; Watson-Capps, Jana J; Gibson, Quincy A; Heithaus, Michael R; Connor, Richard C; Patterson, Eric

    2008-01-01

    Tool use is rare in wild animals, but of widespread interest because of its relationship to animal cognition, social learning and culture. Despite such attention, quantifying the costs and benefits of tool use has been difficult, largely because if tool use occurs, all population members typically exhibit the behavior. In Shark Bay, Australia, only a subset of the bottlenose dolphin population uses marine sponges as tools, providing an opportunity to assess both proximate and ultimate costs and benefits and document patterns of transmission. We compared sponge-carrying (sponger) females to non-sponge-carrying (non-sponger) females and show that spongers were more solitary, spent more time in deep water channel habitats, dived for longer durations, and devoted more time to foraging than non-spongers; and, even with these potential proximate costs, calving success of sponger females was not significantly different from non-spongers. We also show a clear female-bias in the ontogeny of sponging. With a solitary lifestyle, specialization, and high foraging demands, spongers used tools more than any non-human animal. We suggest that the ecological, social, and developmental mechanisms involved likely (1) help explain the high intrapopulation variation in female behaviour, (2) indicate tradeoffs (e.g., time allocation) between ecological and social factors and, (3) constrain the spread of this innovation to primarily vertical transmission.

  5. Why do dolphins carry sponges?

    Directory of Open Access Journals (Sweden)

    Janet Mann

    Full Text Available Tool use is rare in wild animals, but of widespread interest because of its relationship to animal cognition, social learning and culture. Despite such attention, quantifying the costs and benefits of tool use has been difficult, largely because if tool use occurs, all population members typically exhibit the behavior. In Shark Bay, Australia, only a subset of the bottlenose dolphin population uses marine sponges as tools, providing an opportunity to assess both proximate and ultimate costs and benefits and document patterns of transmission. We compared sponge-carrying (sponger females to non-sponge-carrying (non-sponger females and show that spongers were more solitary, spent more time in deep water channel habitats, dived for longer durations, and devoted more time to foraging than non-spongers; and, even with these potential proximate costs, calving success of sponger females was not significantly different from non-spongers. We also show a clear female-bias in the ontogeny of sponging. With a solitary lifestyle, specialization, and high foraging demands, spongers used tools more than any non-human animal. We suggest that the ecological, social, and developmental mechanisms involved likely (1 help explain the high intrapopulation variation in female behaviour, (2 indicate tradeoffs (e.g., time allocation between ecological and social factors and, (3 constrain the spread of this innovation to primarily vertical transmission.

  6. Propagation of Ultrasonic Guided Waves in Composite Multi-Wire Ropes

    Directory of Open Access Journals (Sweden)

    Renaldas Raisutis

    2016-06-01

    Full Text Available Multi-wire ropes are widely used as load-carrying constructional elements in bridges, cranes, elevators, etc. Structural integrity of such ropes can be inspected by using non-destructive ultrasonic techniques. The objective of this work was to investigate propagation of ultrasonic guided waves (UGW along composite multi-wire ropes in the cases of various types of acoustic contacts between neighboring wires and the plastic core. The modes of UGW propagating along the multi-wire ropes were identified using modelling, the dispersion curves were calculated using analytical and semi-analytical finite element (SAFE techniques. In order to investigate the effects of UGW propagation, the two types of the acoustic contact between neighboring wires were simulated using the 3D finite element method (FE as well. The key question of investigation was estimation of the actual boundary conditions between neighboring wires (solid or slip and the real depth of penetration of UGW into the overall cross-section of the rope. Therefore, in order to verify the results of FE modelling, the guided wave penetration into strands of multi-wire rope was investigated experimentally. The performed modelling and experimental investigation enabled us to select optimal parameters of UGW to be used for non-destructive testing.

  7. STRENGTHENING OF A REINFORCED CONCRETE BRIDGE WITH PRESTRESSED STEEL WIRE ROPES

    Directory of Open Access Journals (Sweden)

    Kexin Zhang

    2017-10-01

    Full Text Available This paper describes prestressed steel wire ropes as a way to strengthen a 20-year-old RC T-beam bridge. High strength, low relaxation steel wire ropes with minor radius, high tensile strain and good corrosion resistance were used in this reinforcement. The construction process for strengthening with prestressed steel wire ropes—including wire rope measuring, extruding anchor heads making, anchorage installing, tensioning steel wire ropes and pouring mortar was described. Ultimate bearing capacity of the bridge after strengthening was discussed based on the concrete structure theory. The flexural strength of RC T-beam bridges strengthened with prestressed steel wire ropes was governed by the failure of concrete crushing. To investigate effectiveness of the strengthening method, fielding-load tests were carried out before and after strengthening. The results of concrete strain and deflection show that the flexural strength and stiffness of the strengthened beam are improved. The crack width measurement also indicates that this technique could increase the durability of the bridge. Thus, this strengthened way with prestressed steel wire rope is feasible and effective.

  8. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  9. A Vibrating Wire System For Quadrupole Fiducialization

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, Zachary

    2010-12-13

    A vibrating wire system is being developed to fiducialize the quadrupoles between undulator segments in the LCLS. This note provides a detailed analysis of the system. The LCLS will have quadrupoles between the undulator segments to keep the electron beam focused. If the quadrupoles are not centered on the beam axis, the beam will receive transverse kicks, causing it to deviate from the undulator axis. Beam based alignment will be used to move the quadrupoles onto a straight line, but an initial, conventional alignment must place the quadrupole centers on a straight line to 100 {micro}m. In the fiducialization step of the initial alignment, the position of the center of the quadrupole is measured relative to tooling balls on the outside of the quadrupole. The alignment crews then use the tooling balls to place the magnet in the tunnel. The required error on the location of the quadrupole center relative to the tooling balls must be less than 25 {micro}m. In this note, we analyze a system under construction for the quadrupole fiducialization. The system uses the vibrating wire technique to position a wire onto the quadrupole magnetic axis. The wire position is then related to tooling balls using wire position detectors. The tooling balls on the wire position detectors are finally related to tooling balls on the quadrupole to perform the fiducialization. The total 25 {micro}m fiducialization error must be divided between these three steps. The wire must be positioned onto the quadrupole magnetic axis to within 10 {micro}m, the wire position must be measured relative to tooling balls on the wire position detectors to within 15 {micro}m, and tooling balls on the wire position detectors must be related to tooling balls on the quadrupole to within 10 {micro}m. The techniques used in these three steps will be discussed. The note begins by discussing various quadrupole fiducialization techniques used in the past and discusses why the vibrating wire technique is our method

  10. Electro-mechanics of drift tube wires

    International Nuclear Information System (INIS)

    Milburn, R.H.

    1997-01-01

    The position and stability of the sense wires in very long drift tubes are affected by both gravitational and electrostatic forces, as well as by the wire tension. For a tube to be used as an element of a high-resolution detector all these forces and their effects must be understood in appropriately precise detail. In addition, the quality control procedures applied during manufacture and detector installation must be adequate to ensure that the internal wire positions remain within tolerances. It may be instructive to practitioners to review the simple theory of a taut wire in the presence of anisotropic gravitational and electrostatic fields to illustrate the conditions for stability, the equilibrium wire displacement from straightness, and the effect of the fields on the mechanical vibration frequencies. These last may be used to monitor the wire configuration externally. A number of practical formulae result and these are applied to illustrative examples. (orig.)

  11. Electromagnetic Behaviour of Metallic Wire Structures

    CERN Document Server

    Chui, S T

    2013-01-01

    Despite the recent development and interest in the photonics of metallic wire structures, the relatively simple concepts and physics often remain obscured or poorly explained to those who do not specialize in the field. Electromagnetic Behaviour of Metallic Wire Structures provides a clear and coherent guide to understanding these phenomena without excessive numerical calculations.   Including both background material and detailed derivations of the various different formulae applied, Electromagnetic Behaviour of Metallic Wire Structures describes how to extend basic circuit theory relating to voltages, currents, and resistances of metallic wire networks to include situations where the currents are no longer spatially uniform along the wire. This lays a foundation for a deeper understanding of the many new phenomena observed in meta-electromagnetic materials.   Examples of applications are included to support this new approach making Electromagnetic Behaviour of Metallic Wire Structures a comprehensive and ...

  12. Phosphorus in antique iron music wire.

    Science.gov (United States)

    Goodway, M

    1987-05-22

    Harpsichords and other wire-strung musical instruments were made with longer strings about the beginning of the 17th century. This change required stronger music wire. Although these changes coincided with the introduction of the first mass-produced steel (iron alloyed with carbon), carbon was not found in samples of antique iron harpsichord wire. The wire contained an amount of phosphorus sufficient to have impeded its conversion to steel, and may have been drawn from iron rejected for this purpose. The method used to select pig iron for wire drawing ensured the highest possible phosphorus content at a time when its presence in iron was unsuspected. Phosphorus as an alloying element has had the reputation for making steel brittle when worked cold. Nevertheless, in replicating the antique wire, it was found that lowcarbon iron that contained 0.16 percent phosphorus was easily drawn to appropriate gauges and strengths for restringing antique harpsichords.

  13. Stress distribution and lattice distortions in Nb3Sn multifilament wires under uniaxial tensile loading at 4.2 K

    International Nuclear Information System (INIS)

    Scheuerlein, C; Flükiger, R; Kadar, J; Bordini, B; Ballarino, A; Bottura, L; Di Michiel, M; Buta, F; Seeber, B; Senatore, C; Siegrist, T; Besara, T

    2014-01-01

    The lattice parameter changes in three types of Nb 3 Sn superconducting wires during uniaxial stress–strain measurements at 4.2 K have been measured by high-energy synchrotron x-ray diffraction. The nearly-stress-free Nb 3 Sn lattice parameter has been determined using extracted filaments, and the elastic strain in the axial and transverse wire directions in the different wire phases has been calculated. The mechanical properties of the PIT and RRP wire are mainly determined by the properties of Nb 3 Sn and unreacted Nb. This is in contrast to the bronze route wire, where the matrix can carry substantial loads. In straight wires the axial Nb 3 Sn pre-strain is strongest in the bronze route wire, its value being smaller in the PIT and RRP wires. A strong reduction of the non-Cu elastic modulus of about 30% is observed during cool-down from ambient temperature to 4.2 K. The Nb 3 Sn Poisson ratio at 4.2 K measured in the untwisted bronze route wire is 0.35. The present study also shows that the process route has a strong influence on the Nb 3 Sn texture. (paper)

  14. The Way of Reducing Current Values in Optical Ground Wires at Asymmetrical Faults on Overhead Transmission Lines

    Directory of Open Access Journals (Sweden)

    Egamnazarov Georgiy

    2016-12-01

    Full Text Available Given the fact that the installing costs of an optical ground wire on overhead lines directly depend on its cross-section, which in turn depends on the level of fault current it should withstand, in order to reduce these current values in the optical ground wire, I suggested performing its isolated descents from the end towers of the line with its transition to an optical cable. The research was carried out on the example of a 500 kV overhead line in the National Electric Power Grid. The Method of Symmetrical Components for calculating asymmetrical fault currents was not used; therefore, calculations were carried out on the base of presenting the line as a multi-wire system for the considered case as a five-wire system (optical ground wire, steel ground wire, and three phase wires. Such approach allows taking into account the initial asymmetry of the line parameters and modeling any kind of asymmetrical faults. The analyses of calculated results were performed. The conclusive evidence that the optical ground wire isolated descents from the end towers of the line give the possibility of reducing the level of maximal fault current distribution values in it and therefore its cross section, is presented.

  15. Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2017-11-01

    Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

  16. Ti-Al Composite Wires with High Specific Strength

    Directory of Open Access Journals (Sweden)

    Ludwig Schultz

    2011-11-01

    Full Text Available An alternative deformation technique was applied to a composite made of titanium and an aluminium alloy in order to achieve severe plastic deformation. This involves accumulative swaging and bundling. Furthermore, it allows uniform deformation of a composite material while producing a wire which can be further used easily. Detailed analysis concerning the control of the deformation process, mesostructural and microstructural features and tensile testing was carried out on the as produced wires. A strong grain refinement to a grain size of 250–500 nm accompanied by a decrease in 〈111〉 fibre texture component and a change from low angle to high angle grain boundary characteristics is observed in the Al alloy. A strong increase in the mechanical properties in terms of ultimate tensile strength ranging from 600 to 930 MPa being equivalent to a specific strength of up to 223 MPa/g/cm3 was achieved.

  17. Towards a non-wired simulator for reliability analysis

    International Nuclear Information System (INIS)

    Jurvillier, I.; Laviron, A.; Blin, A.

    1991-11-01

    This paper outlines the objectives and preliminary results of a research programme aiming to increase the advantages of electronic simulators used for reliability studies of complex systems. Research work has resulted in the design of a device based on an electronic simulator capable of carrying out all types of simulation without the drawback of wiring, as is currently the case. Its performance levels as regards speed are comparable to those of wired simulators and this is its main advantage over studies made on a computer. In addition, the simulator is connected to a computer which greatly increases system flexibility and user-friendliness. The first results obtained illustrate what characteristics can be expected of such a system, both as regards the anticipated computation time and the extended processing capabilities (such as the study of common cause failures). (author) [fr

  18. High Hydrogen Loading of Thin Palladium Wires Through

    CERN Document Server

    Celani, F; Marini, P; Di Stefano, V; Nakamura, M; Pace, S; Vecchione, A; Mancini, A; Tripodi, P; Di Gioacchino, D

    2000-01-01

    A new protocol for the electrolytic loading of hydrogen (H) in thin palladium (Pd) wires has been developed. In order to increase the cathodic overvoltage, which is known to be the main parameter capable to enhance the electrolytic $9 H loading of Pd, the catalytic action of the Pd surface versus H-H recombination has been strongly reduced by precipitation of a thin layer of alkaline-earth carbonates on the cathode. A set of electrolytes has been employed, $9 containing small amounts of hydrochloric or sulphuric acid and strontium or calcium ions. The H loading has been continuously evaluated through ac measurements of the Pd wire resistance. Uncommonly low resistivity values, leading to $9 an estimate of exceptionally high H loading, have been observed. Evidence of the existence of a new phase in the very high H content region of the Pd-H system has been inferred on the basis of the determination of the temperature $9 coefficient of the electrical resistivity. For this purpose a thin layer of Hg was galvanic...

  19. Radiofrequency Wire Recanalization of Chronically Thrombosed TIPS

    Energy Technology Data Exchange (ETDEWEB)

    Majdalany, Bill S., E-mail: bmajdala@med.umich.edu [University of Michigan Health System, Division of Interventional Radiology, Department of Radiology (United States); Elliott, Eric D., E-mail: eric.elliott@osumc.edu [The Ohio State University Wexner Medical Center, Division of Interventional Radiology, Department of Radiology (United States); Michaels, Anthony J., E-mail: Anthony.michaels@osumc.edu; Hanje, A. James, E-mail: James.Hanje@osumc.edu [The Ohio State University Wexner Medical Center, Division of Gastroenterology and Hepatology, Department of Medicine (United States); Saad, Wael E. A., E-mail: wsaad@med.umich.edu [University of Michigan Health System, Division of Interventional Radiology, Department of Radiology (United States)

    2016-07-15

    Radiofrequency (RF) guide wires have been applied to cardiac interventions, recanalization of central venous thromboses, and to cross biliary occlusions. Herein, the use of a RF wire technique to revise chronically occluded transjugular intrahepatic portosystemic shunts (TIPS) is described. In both cases, conventional TIPS revision techniques failed to revise the chronically thrombosed TIPS. RF wire recanalization was successfully performed through each of the chronically thrombosed TIPS, demonstrating initial safety and feasibility in this application.

  20. IEE wiring regulations explained and illustrated

    CERN Document Server

    Scaddan, Brian

    2013-01-01

    The IEE Wiring Regulations Explained and Illustrated, Second Edition discusses the recommendations of the IEE Regulations for the Electrical Equipment of Buildings for the safe selection or erection of wiring installations. The book emphasizes earthing, bonding, protection, and circuit design of electrical wirings. The text reviews the fundamental requirements for safety, earthing systems, the earth fault loop impedance, and supplementary bonding. The book also describes the different types of protection, such as protection against mechanical damage, overcurrent, under voltage (which prevents

  1. Minimisation of the wire position uncertainties of the new CERN vacuum wire scanner

    CERN Document Server

    AUTHOR|(CDS)2069346; Barjau Condomines, A

    In the next years the luminosity of the LHC will be significantly increased. This will require a much higher accuracy of beam profile measurement than actually achievable by the current wire scanner. The new fast wire scanner is foreseen to measure small emittance beams throughout the LHC injector chain, which demands a wire travelling speed up to 20 ms-1 and position measurement accuracy of the order of a few microns. The vibrations of the mechanical parts of the system, and particularly the vibrations of the thin carbon wire, were identified as the major error sources of wire position uncertainty. Therefore the understanding of the wire vibrations is a high priority for the design and operation of the new device. This document presents the work performed to understand the main causes of the wire vibrations observed in one of the existing wire scanner and the new proposed design.

  2. The role of MgO content in ex situ MgB2 wires

    DEFF Research Database (Denmark)

    Kovac, P.; Hugek, I.; Meligek, T.

    2004-01-01

    An experimental study of the effect of MgO content in the MgB2 powder used for ex situ made composite wires was carried out. Two single-core MgB2/Fe/Cu wires were made using commercial MgB2 powders from Alfa Aesar containing different fraction of MgO. Critical temperature and critical currents...... of as-deformed and heat-treated wires were measured. The differences between the wires are discussed and correlated with the MgO content. It was found that by increasing the amount of MgO, the inter-grain connectivity worsens, but well distributed and low size MgO particles improve flux pinning....

  3. Aircraft Wiring Support Equipment Integration Laboratory (AWSEIL)

    Data.gov (United States)

    Federal Laboratory Consortium — Purpose:The Aircraft Wiring Support Equipment Integration Laboratory (AWSEIL) provides a variety of research, design engineering and prototype fabrication services...

  4. submitter Dynamical Models of a Wire Scanner

    CERN Document Server

    Barjau, Ana; Dehning, Bernd

    2016-01-01

    The accuracy of the beam profile measurements achievable by the current wire scanners at CERN is limited by the vibrations of their mechanical parts. In particular, the vibrations of the carbon wire represent the major source of wire position uncertainty which limits the beam profile measurement accuracy. In the coming years, due to the Large Hadron Collider (LHC) luminosity upgrade, a wire traveling speed up to 20 $m s^{−1}$ and a position measurement accuracy of the order of 1 μm will be required. A new wire scanner design based on the understanding of the wire vibration origin is therefore needed. We present the models developed to understand the main causes of the wire vibrations observed in an existing wire scanner. The development and tuning of those models are based on measurements and tests performed on that CERN proton synchrotron (PS) scanner. The final model for the (wire + fork) system has six degrees-of-freedom (DOF). The wire equations contain three different excitation terms: inertia...

  5. SNS AC Power Distribution and Reliability of AC Power Supply

    CERN Document Server

    Holik, Paul S

    2005-01-01

    The SNS Project has 45MW of installed power. A design description under the Construction Design and Maintenance (CDM) with regard to regulations (OSHA, NFPA, NEC), reliability issues and maintenance of the AC power distribution system are herewith presented. The SNS Project has 45MW of installed power. The Accelerator Systems are Front End (FE)and LINAC KLYSTRON Building (LK), Central Helium Liquefier (CHL), High Energy Beam Transport (HEBT), Accumulator Ring and Ring to Target Beam Transport (RTBT) Support Buildings have 30MW installed power. FELK has 16MW installed, majority of which is klystron and magnet power supply system. CHL, supporting the super conducting portion of the accelerator has 7MW installed power and the RING Systems (HEBT, RING and RTBT) have also 7MW installed power.*

  6. FE modeling of Cu wire bond process and reliability

    NARCIS (Netherlands)

    Yuan, C.A.; Weltevreden, E.R.; Akker, P. van den; Kregting, R.; Vreugd, J. de; Zhang, G.Q.

    2011-01-01

    Copper based wire bonding technology is widely accepted by electronic packaging industry due to the world-wide cost reduction actions (compared to gold wire bond). However, the mechanical characterization of copper wire differs from the gold wire; hence the new wire bond process setting and new bond

  7. 47 CFR 76.804 - Disposition of home run wiring.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Disposition of home run wiring. 76.804 Section... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Cable Inside Wiring § 76.804 Disposition of home run wiring. (a) Building-by-building disposition of home run wiring. (1) Where an MVPD owns the home run wiring in an MDU...

  8. Localization of intraductal mass through the ostium of the duct using wire guided ductography technique

    International Nuclear Information System (INIS)

    Aslam, M.

    2014-01-01

    To localize intraductal mass (Papilloma) before surgery Materials Guide wire 10-15 cm length of 2/3-0 Prolene/Surgipro Plastic 26G to 20G I/V cannulas Kopans breast lesion localization hook wire Disposable syringe heaving 2ml non-ionic contrast High intensity light and magnified glass. Methods: Prepare patient in sitting or lying position adjust high intensity light clean the nipple with antiseptic lotion. Elicit the discharge with gentle periareolar pressure or ask the patient to bring the discharge. If the opening with discharge is not clearly visualize use magnified glass or loop. Slowly inserted the wire into the duct orifice, it should pass freely into the duct. Introduce the 26G I/V plastic cannula coaxially over the guide wire and remove the guide wire. Gently inject 0.2-0.4 ml contrast, remove and the syringe and apply stopper. The cannula stopper assembly is secured to the breast with tape. Magnified craniocaudal view of the breast is taken, the 26G cannula removed and bigger length 22/20G cannula gradually passed over the guide wire according to distance of lesion from the ostium. Intraductal mass location is verified the hook wire is replaced with guide wire, the position of hook confirmed by mammographic film. The wire is cut 2cms from the nipple and pt. send to operation theater Results:Hook localization has been successfully carried out in six patients. Conclusion:This is a new method of localization of intraductal mass it enables the surgeon to do microductectomy with minimal cosmetic effects to the breast. (author)

  9. THERMO-MECHANICALLY PROCESSED ROLLED WIRE FOR HIGH-STRENGTH ON-BOARD WIRE

    Directory of Open Access Journals (Sweden)

    V. A. Lutsenko

    2011-01-01

    Full Text Available It is shown that at twisting of wire of diameter 1,83 mm, produced by direct wire drawing of thermomechanically processed rolled wire of diameter 5,5 mm of steel 90, metal stratification is completely eliminated at decrease of carbon, manganese and an additional alloying of chrome.

  10. Reducing AC-Winding Losses in High-Current High-Power Inductors

    DEFF Research Database (Denmark)

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper...... designed with low ac resistance and leakage inductance to carry the ac current while the outer winding is designed for the large dc current. Detailed analysis and design of a 350 A, 10 kW inductor with the proposed technique are presented with discussions. Experimental results of a prototype 350 A inductor...... presents design, analysis and experimental verification of a two winding technique, which significantly reduces ac winding losses without compromising dc losses. The technique uses an inner auxiliary winding, which is connected in parallel with an outer main winding. The auxiliary winding is optimally...

  11. Novelties that change carrying capacity.

    Science.gov (United States)

    Erwin, Douglas H

    2012-09-01

    Comparative developmental studies have revealed a rich array of details about the patterns and processes of morphological change in animals and increasingly in plants. But, applying these insights to the study of major episodes of evolutionary innovation requires understanding how these novel morphologies become established and sufficiently abundant (either as individuals within a species or as a clade of species) to be preserved in the fossil record, and, in many cases, to influence ecological processes. Evolutionary novelties may: (1) disappear without changing the species; (2) be associated with the generation (through selection or drift) of a new species; and if the latter (3) may or may not become ecologically significant. Only the latter are commonly preserved in the fossil record. These alternatives mirror the distinction among historians of technology between innovation and invention. Here, I argue that specific sorts of evolutionary inventions drive ecological transformation, essentially constructing an environment for themselves and ancillary organisms through ecological spillover effects, increasing the "carrying capacity" of an ecosystem. Copyright © 2011 Wiley Periodicals, Inc.

  12. AC operation of large titanium sublimation pumps in a magnetic field: Results of the test stand for the W7-X neutral beam injectors

    Energy Technology Data Exchange (ETDEWEB)

    Orozco, G., E-mail: guillermo.orozco@ipp.mpg.de; Froeschle, M.; Heinemann, B.; Hopf, C.; Nocentini, R.; Riedl, R.; Staebler, A.

    2014-12-15

    Highlights: • A test stand for the high vacuum pumping system of the NBI at W7-X is presented. • In W7-X large titanium sublimation pumps (TSPs) will be operated using AC. • AC ohmic heating allows reliable operation of TSPs in the stray B field of W7-X. • The effect of the frequency and waveform of the AC current has been analysed. • AC-operated TSPs in B field perform similarly to DC-operated TSPs at ASDEX-upgrade. - Abstract: A neutral beam injection (NBI) system is being built for the Stellarator experiment Wendelstein 7-X (W7-X) currently under construction at IPP Greifswald. The NBI system consists of two injectors which are essentially a replica of the system present in the Tokamak experiment ASDEX-Upgrade at IPP Garching. A vacuum system with high pumping speed and large capacity is required to ensure proper vacuum conditions in the neutral beam line. For this purpose, large titanium sublimation pumps (TSP) are installed inside the NBI boxes, consisting of 4 m long hanging wires containing Ti and the surrounding condensation walls. The wires are DC ohmically heated up with 142 A to Ti sublimation temperature. A TSP system has been operated since many years in the AUG-NBI system, sublimating Ti in the pauses between the plasma discharges, when no magnetic field is present. However, at W7-X the superconducting coils generate a magnetic field permanently during experimental campaigns, whose stray B field with a maximum of 30 mT, affects the TSPs. Operated with DC, the wires would be deflected against the surrounding panels due to the Lorentz force. A simple possible solution is heating with AC, which reduces the wire deflection amplitude, inducing a risky wire oscillation. The feasibility of the AC operation in an equivalently strong B field such as the stray B field around W7-X has been demonstrated in a test stand for different AC waveforms and frequencies. Several test campaigns have shown no qualitative difference in the pumping properties

  13. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  14. Effect of applied DC electric fields in flame spread over polyethylene-coated electrical wire

    KAUST Repository

    Jin, Young Kyu

    2011-03-01

    We experimentally investigated the effect of applied DC electric fields on the flame spread over polyethylene-coated electrical wire. The flame-spread rates over electrical wire with negative and positive DC electric fields from 0 to ±7 kV were measured and analyzed. We compared the results for DC electric fields with previous results for AC electric fields. We explored whether or not various flame shapes could be obtained with DC electric fields and the main reason for the flame-spread acceleration, particularly at the end of the electrical wire, for AC electric fields. We found that DC electric fields do not significantly affect the flame-spread rates. However, the flame shape is mildly altered by the ionic wind effect even for DC electric fields. The flame-spread rate is relevant to the flame shape and the slanted direction in spite of the mild impact. A possible explanation for the flame spread is given by a thermal-balance mechanism and fuel-vapor jet. © 2011 The Korean Society of Mechanical Engineers.

  15. Long-Wearing Wire Guide For Welding Torch

    Science.gov (United States)

    Gutow, David A.; Burley, Richard K.; Gilbert, Jeffrey L.; Fogel, Irving

    1992-01-01

    Insert for wire-guide tube on tungsten/inert-gas welding apparatus extends life of guide tube and increases accuracy of weld. Hardened insert resists wear by sliding tungsten wire. Chamfer guides wire into insert.

  16. 29 CFR 1919.79 - Wire rope.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Wire rope. 1919.79 Section 1919.79 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED... recommended by the equipment or the wire rope manufacturer due to actual working condition requirements. In...

  17. Automatic inspection of railway overhead wires

    NARCIS (Netherlands)

    Smorenburg, C.; Valkenburg, A.L.G. van

    1988-01-01

    For the Netherlands railway company a system for inspection of the degree of wear of the contact wires is being developed. With an active sensor the reflective under-surface of the overhead wire is illuminated with a laserbeam and reflected radiation is detected by fast CCD detectors. With the

  18. Wire compensation: Performance, SPS MDs, pulsed system

    CERN Document Server

    Dorda, U

    2008-01-01

    A wire compensation (BBLR) scheme has been proposed in order to improve the long range beam-beam performance of the nominal LHC and its phase 1 and phase 2 upgrades[1]. In this paper we present experimental experience of the CERN SPS wires (BBLR) and report on progress with the RF BBLR.

  19. WIRED magazine announces rave awards nominees

    CERN Multimedia

    2002-01-01

    WIRED Magazine has anounced the nominees for its fourth annual WIRED Rave Awards, celebrating innovation and the individuals transforming commerce and culture. Jeffrey Hangst of the University of Aarhus has been nominated in the science category, for his work on the ATHENA Experiment, CERN (1/2 page).

  20. Kirschner Wire Breakage during Removal Requiring Retrieval

    Directory of Open Access Journals (Sweden)

    Kai Yuen Wong

    2016-01-01

    Full Text Available Kirschner wires (K-wires are widely used for fixation of fractures and dislocations in the hand as they are readily available, reliable, and cost-effective. Complication rates of up to 18% have been reported. However, K-wire breakage during removal is rare. We present one such case illustrating a simple technique for retrieval. A 35-year-old male presented with a distal phalanx fracture of his right middle finger. This open fracture was treated with K-wire fixation. Postoperatively, he developed a pin site infection with associated finger swelling. The K-wire broke during removal with the proximal piece completely retained in his middle phalanx. To minimise risk of osteomyelitis, the K-wire was removed with a novel surgical technique. He had full return of hand function. Intraoperative K-wire breakage has a reported rate of 0.1%. In our case, there was no obvious cause of breakage and the patient denied postoperative trauma. On the other hand, pin site infections are much more common with reported rates of up to 7% in the hand or wrist. K-wire fixation is a simple method for bony stabilisation but can be a demanding procedure with complications often overlooked. It is important to be aware of the potential sequelae.

  1. Hot-wire anemometer for spirography.

    Science.gov (United States)

    Plakk, P; Liik, P; Kingisepp, P H

    1998-01-01

    The use of a constant temperature hot-wire anemometer flow sensor for spirography is reported. The construction, operating principles and calibration procedure of the apparatus are described, and temperature compensation method is discussed. Frequency response is studied. It is shown that this hot-wire flow transducer satisfies common demands with respect to accuracy, response time and temperature variations.

  2. RHIC spin flipper AC dipole controller

    Energy Technology Data Exchange (ETDEWEB)

    Oddo, P.; Bai, M.; Dawson, C.; Gassner, D.; Harvey, M.; Hayes, T.; Mernick, K.; Minty, M.; Roser, T.; Severino, F.; Smith, K.

    2011-03-28

    The RHIC Spin Flipper's five high-Q AC dipoles which are driven by a swept frequency waveform require precise control of phase and amplitude during the sweep. This control is achieved using FPGA based feedback controllers. Multiple feedback loops are used to and dynamically tune the magnets. The current implementation and results will be presented. Work on a new spin flipper for RHIC (Relativistic Heavy Ion Collider) incorporating multiple dynamically tuned high-Q AC-dipoles has been developed for RHIC spin-physics experiments. A spin flipper is needed to cancel systematic errors by reversing the spin direction of the two colliding beams multiple times during a store. The spin flipper system consists of four DC-dipole magnets (spin rotators) and five AC-dipole magnets. Multiple AC-dipoles are needed to localize the driven coherent betatron oscillation inside the spin flipper. Operationally the AC-dipoles form two swept frequency bumps that minimize the effect of the AC-dipole dipoles outside of the spin flipper. Both AC bumps operate at the same frequency, but are phase shifted from each other. The AC-dipoles therefore require precise control over amplitude and phase making the implementation of the AC-dipole controller the central challenge.

  3. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Energy Technology Data Exchange (ETDEWEB)

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

    1997-09-01

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  4. Mobility of solid vortex matter in 'shaking' ac magnetic fields of variable amplitude

    International Nuclear Information System (INIS)

    Moreno, A.J.; Valenzuela, S.O.; Pasquini, G.; Bekeris, V.

    2004-01-01

    The vortex solid in high temperature superconductors exhibits several regimes and dynamical behaviors. A temporarily symmetric magnetic ac field (e.g. sinusoidal, square, triangular) can increase the vortex lattice mobility and a temporarily asymmetric one (e.g. sawtooth) can decrease it. In this work, we study the effect on the mobility of the vortex solid as a function of the amplitude of an ac symmetric 'shaking' field when it is applied to previously prepared high and low mobility configurations. This study was carried out in high quality twinned YBCO single crystals and vortex mobility was studied through ac susceptibility measurements

  5. Alignment Tools Used to Locate a Wire and a Laser Beam in the VISA Undulator Project

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, Z.; Ruland, R.; Dix, B.; Arnett, D.; /SLAC

    2005-08-17

    The Stanford Linear Accelerator Center is evaluating the feasibility of placing a free electron laser (FEL) at the end of the linear accelerator. The proposal is to inject electrons two thirds of the way down the linac, accelerate the electrons for the last one third of the linac, and then send the electrons into the FEL. This project is known as the LCLS (Linac Coherent Light Source). To test the feasibility of the LCLS, a smaller experiment VISA (Visual to Infrared SASE (Self Amplified Stimulated Emission) Amplifier) is being performed at Brookhaven National Laboratory. VISA consists of four wiggler segments, each 0.99 m long. The four segments are required to be aligned to the beam axis with an rms error less than 50 {micro}m [1]. This very demanding alignment is carried out in two steps [2]. First the segments are fiducialized using a pulsed wire system. Then the wiggler segments are placed along a reference laser beam which coincides with the electron beam axis. In the wiggler segment fiducialization, a wire is stretched through a wiggler segment and a current pulse is sent down the wire. The deflection of the wire is monitored. The deflection gives information about the electron beam trajectory. The wire is moved until its x position, the coordinate without wire sag, is on the ideal beam trajectory. (The y position is obtained by rotating the wiggler 90{sup o}.) Once the wire is on the ideal beam trajectory, the wire's location is measured relative to tooling balls on the wiggler segment. To locate the wire, a device was constructed which measures the wire position relative to tooling balls on the device. The device is called the wire finder. It will be discussed in this paper. To place the magnets along the reference laser beam, the position of the laser beam must be determined. A device which can locate the laser beam relative to tooling balls was constructed and is also discussed in this paper. This device is called the laser finder. With a total

  6. Mixed mobile ion effect on a.c. conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  7. Guide Wire Entrapment during Central Venous Catheterization

    Directory of Open Access Journals (Sweden)

    Kyung Woo Kim

    2014-05-01

    Full Text Available We experienced a case of venous vessel wall entrapment between the introducer needle and the guide wire during an attempt to perform right internal jugular vein (IJV catheterization. The guide wire was introduced with no resistance but could not be withdrawn. We performed ultrasonography and C-arm fluoroscopy to confirm the entrapment location. We assumed the introducer needle penetrated the posterior vessel wall during the puncture and that only the guide wire entered the vein; an attempt to retract the wire pinched the vein wall between the needle tip and the guide wire. Careful examination with various diagnostic tools to determine the exact cause of entrapment is crucial for reducing catastrophic complications and achieving better outcomes during catheterization procedures.

  8. A cycloidal wobble motor driven by shape memory alloy wires

    Science.gov (United States)

    Hwang, Donghyun; Higuchi, Toshiro

    2014-05-01

    A cycloidal wobble motor driven by shape memory alloy (SMA) wires is proposed. In realizing a motor driving mechanism well known as a type of reduction system, a cycloidal gear mechanism is utilized. It facilitates the achievement of bidirectional continuous rotation with high-torque capability, based on its high efficiency and high reduction ratio. The applied driving mechanism consists of a pin/roller based annular gear as a wobbler, a cycloidal disc as a rotor, and crankshafts to guide the eccentric wobbling motion. The wobbling motion of the annular gear is generated by sequential activation of radially phase-symmetrically placed SMA wires. Consequently the cycloidal disc is rotated by rolling contact based cycloidal gearing between the wobbler and the rotor. In designing the proposed motor, thermomechanical characterization of an SMA wire biased by extension springs is experimentally performed. Then, a simplified geometric model for the motor is devised to conduct theoretical assessment of design parametric effects on structural features and working performance. With consideration of the results from parametric analysis, a functional prototype three-phase motor is fabricated to carry out experimental verification of working performance. The observed experimental results including output torque, rotational speed, bidirectional positioning characteristic, etc obviously demonstrate the practical applicability and potentiality of the wobble motor.

  9. Preparation of Electrospun Polymer Fibers Using a Copper Wire Electrode in a Capillary Tube

    Science.gov (United States)

    Shinbo, Kazunari; Onozuka, Shintaro; Hoshino, Rikiya; Mizuno, Yoshinori; Ohdaira, Yasuo; Baba, Akira; Kato, Keizo; Kaneko, Futao

    2010-04-01

    Polymer fibers were prepared by an electrospinning method utilizing a copper wire electrode in a capillary tube. The morphology of electrospun poly(vinyl alcohol) (PVA) fibers was observed, and was found to be dependent on the wire electrode tip position in the capillary tube, the concentration of the polymer solution, the distance between the electrodes, and the applied voltage. By using the wire electrode, the experimental setup is simple and the distance between the electrodes and the applied voltage can be easily reduced. Furthermore, the preparation of poly(3-hexylthiophene) (P3HT) fibers was carried out. P3HT fibers were successfully prepared by mixing poly(ethylene oxide) (PEO) in P3HT solution. Orientation control was also carried out by depositing the fibers on a rotating collector electrode, and the alignment of the P3HT:PEO fibers was confirmed. Anisotropy of the optical absorption spectra was also observed for the aligned fibers.

  10. Single wire drift chamber design

    Energy Technology Data Exchange (ETDEWEB)

    Krider, J.

    1987-03-30

    This report summarizes the design and prototype tests of single wire drift chambers to be used in Fermilab test beam lines. The goal is to build simple, reliable detectors which require a minimum of electronics. Spatial resolution should match the 300 ..mu..m rms resolution of the 1 mm proportional chambers that they will replace. The detectors will be used in beams with particle rates up to 20 KHz. Single track efficiency should be at least 99%. The first application will be in the MT beamline, which has been designed for calibration of CDF detectors. A set of four x-y modules will be used to track and measure the momentum of beam particles.

  11. The Wire Flyer Towed Profiling System

    Science.gov (United States)

    Roman, C.; Ullman, D. S.; Hebert, D.

    2016-02-01

    The Wire Flyer is an autonomous profiling vehicle that slides up and down a standard towed cable in a controlled manner using the lift created by wing foils. The vehicle is able to create high resolution water-column sections within a specified depth band in an automated manner. The Wire Flyer is different than standard undulating tow bodies in that it decouples the vehicle's motion from the tow cable dynamics. Due to this separation the vehicle is able to profile with nearly 1:1 horizontal to vertical motion. A heavy depressor weight is fixed to the end of the cable and the cable shape remains relatively static during operation. The vehicle uses a closed loop wing angle controller to achieve desired vertical velocities between 0 and 2.5 m/s for ship speeds between 1.5 and 2.5 m/s. During typical operations, updated commands and condensed data samples can be sent to and from the vehicle via an acoustic modem to adjust the profiling pattern to ensure the desired coverage. The current 1000 meter rated vehicle is equipped with a SBE 49 FastCAT CTD, and can carry additional sensors for oxygen, Chlorophyll fluorescence and acoustic echosounding. Results showing the vehicle performance as well as the quality of the processed CTD data will be presented from three test cruises to the New England Shelf Break Front. Many shallow and deep sections were obtained with horizontal resolution that is not otherwise achievable with undulating tow bodies, underway CTDs, standard CTD tow-yos, gliders or free swimming AUVs. A typical survey at ship speeds of 3-4 knots can profile over a depth band between 200 and 600 meters depth with a repeat cycle length of less than 1 km. The vehicle concept is depth independent and could work with a full ocean depth design. Application areas for the system include sub-meso scale observations of fronts, vent and seep plumes, oxygen minimum layers, mixing and mid-water bioacoustics.

  12. Technology development and commercial production of current-carrying elements on the basis of Nb3Sn superconductor

    International Nuclear Information System (INIS)

    Nikulin, A.D.; Shikov, A.K.; Davydov, I.I.

    1995-01-01

    A description of a current carrying element intended for Tokamak-15 magnetic system is presented. The element is produced from multicore wires with superconducting Nb 3 Sn cores and calculated for 8.5 kA critical current in magnetic field of 8 T. Main processing procedures of its manufacturing are shown. Extrusion conditions needed for production of composite bronze-niobium rods and multicore wire 1.5 mm in diameter with 14641 niobium cores are determined. Heat treatment used results in formation of Nb 3 Sn intermetallics and assures maximal current-carrying capacity of 910-920 A in 8 T magnetic field. 15 refs., 9 figs

  13. Studies of implosion processes of nested tungsten wire-array Z-pinch

    International Nuclear Information System (INIS)

    Ning Cheng; Ding Ning; Liu Quan; Yang Zhenhua

    2006-01-01

    Nested wire-array is a kind of promising structured-load because it can improve the quality of Z-pinch plasma and enhance the radiation power of X-ray source. Based on the zero-dimensional model, the assumption of wire-array collision, and the criterion of optimized load (maximal load kinetic energy), optimization of the typical nested wire-array as a load of Z machine at Sandia Laboratory was carried out. It was shown that the load has been basically optimized. The Z-pinch process of the typical load was numerically studied by means of one-dimensional three-temperature radiation magneto-hydrodynamics (RMHD) code. The obtained results reproduce the dynamic process of the Z-pinch and show the implosion trajectory of nested wire-array and the transfer process of drive current between the inner and outer array. The experimental and computational X-ray pulse was compared, and it was suggested that the assumption of wire-array collision was reasonable in nested wire-array Z-pinch at least for the current level of Z machine. (authors)

  14. Electrochemically deposited BiTe-based nano wires for thermoelectric applications

    International Nuclear Information System (INIS)

    Inn-Khuan, N.; Kuan-Ying, K.; Che Zuraini Che Abdul Rahman; Nur Ubaidah Saidin; Suhaila Hani Ilias; Thye-Foo, C.

    2013-01-01

    Full-text: Nano structured materials systems such as thin-films and nano wires (NWs) are promising for thermoelectric power generation and refrigeration compared to traditional counterparts in bulk, due to their enhanced thermoelectric figures-of-merit. BiTe and its derivative compounds, in particular, are well-known for their near-room temperature thermoelectric performance. In this work, both the binary and ternary BiTe-based nano wires namely, BiTe and BiSbTe, were synthesized using template-assisted electrodeposition. Diameters of the nano wires were controlled by the pore sizes of the anodised alumina (AAO) templates used. Systematic study on the compositional change as a function of applied potential was carried out via Linear Sweep Voltametry (LSV). Chemical compositions of the nano wires were studied using Energy Dispersive X-ray Spectrometry (EDXS) and their microstructures evaluated using diffraction and imaging techniques. Results from chemical analysis on the nano wires indicated that while the Sb content in BiSbTe nano wires increased with more negative deposition potentials, the formation of Te 0 and Bi 2 Te 3 were favorable at more positive potentials. (author)

  15. A comparison study of exploding a Cu wire in air, water, and solid powders

    Science.gov (United States)

    Han, Ruoyu; Wu, Jiawei; Ding, Weidong; Zhou, Haibin; Qiu, Aici; Wang, Yanan

    2017-11-01

    In this paper, an experimental study on exploding a copper wire in air, water, incombustible powders, and energetic materials is performed. We examined the effects of the surrounding media on the explosion process and its related phenomena. Experiments were first carried out with copper wire explosions driven by microsecond timescale pulsed currents in air, water, and the half-half case. Then, the copper wires were exploded in air, water, SiO2 powders, quartz sand, NaCl powders, and energetic-material cylinders, respectively. Our experimental results indicated that the explosion process was significantly influenced by the surrounding media, resulting in noticeable differences in energy deposition, optical emission, and shock waves. In particular, incombustible powders could throttle the current flow completely when a fine wire was adopted. We also found that an air or incombustible-powder layer could drastically attenuate the shock wave generated by a wire explosion. As for energetic-material loads, obvious discrepancies were found in voltage/current waveforms from vaporization when compared with a wire explosion in air/water, which meant the metal vapor/liquid drops play a significant role in the ignition process.

  16. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  17. Steady-state analysis of a faulted three-phase four-wire system supplying induction motors with neutrals connected and other single-phase line-to-neutral loads

    Science.gov (United States)

    Wood, M. E.

    1980-01-01

    Four wire Wye connected ac power systems exhibit peculiar steady state fault characteristics when the fourth wire of three phase induction motors is connected. The loss of one phase of power source due to a series or shunt fault results in currents higher than anticipated on the remaining two phases. A theoretical approach to compute the fault currents and voltages is developed. A FORTRAN program is included in the appendix.

  18. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  19. Three phase AC motor controller

    Science.gov (United States)

    Vuckovich, Michael; Wright, Maynard K.; Burkett, John P.

    1984-03-20

    A motor controller for a three phase AC motor (10) which is adapted to operate bidirectionally from signals received either from a computer (30) or a manual control (32). The controller is comprised of digital logic circuit means which implement a forward and reverse command signal channel (27, 29) for the application of power through the forward and reverse power switching relays (16, 18, 20, 22). The digital logic elements are cross coupled to prevent activation of both channels simultaneously and each includes a plugging circuit (65, 67) for stopping the motor upon the removal of control signal applied to one of the two channels (27, 29) for a direction of rotation desired. Each plugging circuit (65, 67) includes a one-shot pulse signal generator (88, 102) which outputs a single pulse signal of predetermined pulsewidth which is adapted to inhibit further operation of the application of power in the channel which is being activated and to apply a reversal command signal to the other channel which provides a reversed phase application of power to the motor for a period defined by the pulse-width output of the one-shot signal generator to plug the motor (10) which will then be inoperative until another rotational command signal is applied to either of the two channels.

  20. Effect Of Low External Flow On Flame Spreading Over ETFE Insulated Wire Under Microgravity

    Science.gov (United States)

    Nishizawa, Katsuhiro; Fujita, Osamu; Ito, Kenichi; Kikuchi, Masao; Olson, Sandra L.; Kashiwagi, Takashi

    2003-01-01

    Fire safety is one of the most important issues for manned space missions. A likely cause of fires in spacecraft is wire insulation combustion in electrical system. Regarding the wire insulation combustion it important to know the effect of low external flow on the combustion because of the presence of ventilation flow in spacecraft. Although, there are many researches on flame spreading over solid material at low external flows under microgravity, research dealing with wire insulation is very limited. An example of wire insulation combustion in microgravity is the Space Shuttle experiments carried out by Greenberg et al. However, the number of experiments was very limited. Therefore, the effect of low flow velocity is still not clear. The authors have reported results on flame spreading over ETFE (ethylene - tetrafluoroetylene) insulated wire in a quiescent atmosphere in microgravity by 10 seconds drop tower. The authors also performed experiments of polyethylene insulated nichrom wire combustion in low flow velocity under microgravity. The results suggested that flame spread rate had maximum value in low flow velocity condition. Another interesting issue is the effect of dilution gas, especially CO2, which is used for fire extinguisher in ISS. There are some researches working on dilution gas effect on flame spreading over solid material in quiescent atmosphere in microgravity. However the research with low external flow is limited and, of course, the research discussing a relation of the appearance of maximum wire flammability in low flow velocity region with different dilution gas cannot be found yet. The present paper, therefore, investigates the effect of opposed flow with different dilution gas on flame spreading over ETFE insulated wire and change in the presence of the maximum flammability depending on the dilution gas type is discussed within the limit of microgravity time given by ground-based facility.

  1. Minimum quench energy measurement for superconducting wires

    International Nuclear Information System (INIS)

    Seo, K.; Morita, M.; Nakamura, S.; Yamada, T.; Jizo, Y.

    1996-01-01

    The authors have developed a new method of measuring minimum quench energy (MQE) of superconducting wire. There have been conventional methods using heating wires, whose diameters are ∼0.1mm and are glued by epoxy resin. When they induce a pulse heat to superconducting wires, a duration of the pulse must be several hundreds micro seconds to demonstrate actual disturbances (for instance wire motion) in a superconducting magnet. In spite of this fact, thermal diffusion time constants of the conventional heaters are larger than the duration of the actual disturbance, because of these electrical insulator of the heating wire and the epoxy bind. Therefore, this kind of heater is not able to demonstrate the actual disturbance. To solve this problem, they have proposed a new constitution of a heater. In the method, heat generation is introduced in high resistive layer on a surface of a superconducting wire. The high resistive layer is consist of carbon paste. The thickness of the carbon paste layer is ∼20microm, thus a time constant of this heater is expected to be small enough to demonstrate the actual disturbance. Adopting the new method to the MQE measurement, they successfully evaluate MQE of superconducting wires with high precision. Several results are introduced in this paper

  2. Wire pad chamber for LHCb muon system

    CERN Document Server

    Botchine, B; Lazarev, V A; Sagidova, N; Vorobev, A P; Vorobyov, A; Vorobyov, Alexei

    2000-01-01

    2000-003 Wire pad chambers (WPC) have been proposed for the outer Region 4 of the LHCb Muon System. These are double gap MWPCs with small wire spacing allowing to obtain 99% detection efficiency in a 20 ns time window. The chambers have a rectangular shape with the vertical dimension from 20 cm in Station 1 to 30 cm in Station 5. The horizontal dimensions will be different with the maximal size of 3 meters in Station 5. The wires are in the vertical direction. The short wire length allows to use small wire spacing needed for high time resolution. Also, this helps to obtain the uniform gas gain over the whole chamber area. The WPC has one row of the wire pads formed by grouping wires in separate readout channels. Four WPC prototypes have been built at PNPI and tested in the PS beam at CERN. Here we report on the results from these tests. Also, the results of simulation of the WPC performance are presented.

  3. The Assessment Of The Structure And Properties Of High-Carbon Steel Wires After The Process Of Patenting With Induction Heating

    Directory of Open Access Journals (Sweden)

    Wiewiórowska S.

    2015-06-01

    Full Text Available One of the most important types of heat treatment that high-carbon steel wires are subjected to is the patenting treatment. This process is conducted with the aim of obtaining a fine-grained uniform pearlitic structure which will be susceptible to plastic deformation in drawing processes. Patenting involves two-stage heat treatment that includes heating the wire up to the temperature above Ac3 in a continuous heating furnace (in the temperature range of 850÷1050°C followed by a rapid cooling in a tank with a lead bath down to the temperature range of 450÷550°C. The patenting process is most significantly influenced by the chemistry of the steel being treated, as well as by the temperature and the rate of heating and cooling of the wire rod or wire being patented.

  4. Creation of subsonic macro-and microjets facilities and automated measuring system (AMS-2) for the spatial - temporal hot - wire anemometric visualization of jet flow field

    Science.gov (United States)

    Sorokin, A. M.; Grek, G. R.; Gilev, V. M.; Zverkov, I. D.

    2017-10-01

    Macro-and microjets facilities for generation of the round and plane subsonic jets are designed and fabricated. Automated measuring system (AMS - 2) for the spatial - temporal hot - wire anemometric visualization of jet flow field is designed and fabricated. Coordinate device and unit of the measurement, collecting, storage and processing of hot - wire anemometric information were integrated in the AMS. Coordinate device is intended for precision movement of the hot - wire probe in jet flow field according to the computer program. At the same time accuracy of the hot - wire probe movement is 5 microns on all three coordinates (x, y, z). Unit of measurement, collecting, storage and processing of hot - wire anemometric information is intended for the hot - wire anemometric measurement of the jet flow field parameters (registration of the mean - U and fluctuation - u' characteristics of jet flow velocity), their accumulation and preservation in the computer memory, and also carries out their processing according to certain programms.

  5. Test of the wire ageing induced by radiation for the CMS barrel muon chamber

    CERN Document Server

    Conti, Enrico

    2000-01-01

    We have carried out laboratory test to measure the ageing of a wire tube due to pollutant outgassed by various materials. The tested materials are those used in the muon barrel drift tubes. An X-ray gun irradiated the test tube to accelerate the ageing process. No ageing effect has been measured for a period equivalent to 10 years of operation at LHC.

  6. Resonant tunneling of electrons in quantum wires

    International Nuclear Information System (INIS)

    Krive, I.V.; Shekhter, R.I.; Jonson, M.; Krive, I.V.

    2010-01-01

    We considered resonant electron tunneling in various nanostructures including single wall carbon nanotubes, molecular transistors and quantum wires formed in two-dimensional electron gas. The review starts with a textbook description of resonant tunneling of noninteracting electrons through a double-barrier structure. The effects of electron-electron interaction in sequential and resonant electron tunneling are studied by using Luttinger liquid model of electron transport in quantum wires. The experimental aspects of the problem (fabrication of quantum wires and transport measurements) are also considered. The influence of vibrational and electromechanical effects on resonant electron tunneling in molecular transistors is discussed.

  7. Problems associated with iridium-192 wire implants

    International Nuclear Information System (INIS)

    Arnott, S.J.; Law, J.; Ash, D.; Flynn, A.; Paine, C.H.; Durrant, K.R.; Barber, C.D.; Dixon-Brown, A.

    1985-01-01

    Three incidents are reported, from different radiotherapy centres, in which an implanted iridium-192 wire remained in the tissues of a patient after withdrawal of the plastic tubing in which it was contained. In each case the instrument used to cut the wire had probably formed a hook on the end of the wire which caused it to catch in the tissues. Detailed recommendations are made for avoiding such incidents in the future, the most important of which is that the patient should be effectively monitored after the supposed removal of all radioactive sources. (author)

  8. Investigation of wire motion in superconducting magnets

    International Nuclear Information System (INIS)

    Ogitsu, T.; Tsuchiya, K.; Devred, A.

    1990-09-01

    The large Lorentz forces occuring during the excitation of superconducting magnets can provoke sudden motions of wire, which eventually release enough energy to trigger a quench. These wire motions are accompanied by two electromagnetic effects: an induced emf along the moved wire, and a local change in flux caused by the minute dislocation of current. Both effects cause spikes in the coil voltage. Voltage data recorded during the excitation of a superconducting quadrupole magnet which early exhibit such events are here reported. Interpretations of the voltage spikes in terms of energy release are also presented, leading to insights on the spectrum of the disturbances which occur in real magnets. 15 refs

  9. AC loss analysis of a HTS coil with parallel superconducting tapes of unbalanced current distribution

    International Nuclear Information System (INIS)

    Lee, S.; Byun, S.; Kim, W.; Choi, K.; Lee, H.

    2007-01-01

    Considering the current capacities of the HTS tapes recently being developed, it is inevitable to use these HTS tapes in parallel in order to apply them to power transformers. But non-uniform distributions of current and large AC losses are major problems in a HTS coil with parallel superconducting tapes. Many parallel HTS tapes have been fabricated and tested so far. The results showed that we had to transpose each tape in order to reduce AC losses and have uniform distributions of current. But the measurement of the current distribution process has been quite difficult not only in the case of the parallel HTS tapes but also in the case of the coil with parallel HTS tapes. In our study, we investigated the effect of current distribution on the AC losses in parallel HTS tapes and coils with parallel superconducting tapes. The current distribution in parallel HTS tapes could be measured with small Hall sensors, the dependence of AC losses and critical current on the current distribution was analyzed. We fabricated a parallel HTS tape and HTS coil with the transposed parallel HTS tapes for an application of a power transformer. The performance of non-uniform current distribution in the parallel HTS wires is worse than that of a uniform one

  10. Report on results for fiscal 1997 on development of superconducting electric power application technology. Pt. 1. R and D of superconducting wire, R and D of superconducting generator, studies on total system, R and D of refrigeration system, and verification test; 1997 nendo chodendo denryoku oyo gijutsu kaihatsu seika hokokusho. 1. Chodendo senzai no kenkyu kaihatsu, chodendo hatsudenki no kenkyu kaihatsu, total system no kenkyu, reito system no kenkyu kaihatsu, jissho shiken

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-09-01

    This report explains the outline as Part 1. In fiscal 1997, the 10th year of the project, a multi cylindrical rotary model for which an in-situ verification test was finished was brought back to the plant and dismantled for examination, while the in-situ verification test of a slow-response type model machine rotor was conducted in combination with a refrigeration system. In addition, in the research of AC wire materials and oxide based materials, studies were made with a purpose of high characterization and long wire materialization. In the metallic materials, a 10kANbTi conductor was developed while, in oxide-based materials, research was done on performance improvement and wire materialization based on various synthesizing methods. The manufacturing, factory test and in-situ text were conducted for a 70,000kW model machine with the purpose of R and D of a 200,000kW class pilot machine. Examination was made on the test method of the 70,000kW class model machine, operation technology of a superconducting generation system, and the effect of introducing the superconducting generator into a power system. In the conventional refrigeration system, a single unit test was carried out for the liquefaction, liquid storing capacity, etc., of the system. The 70,000kW class model machine was put through a test for confirming the general operation including the refrigeration system. (NEDO)

  11. Evaluation of Carrying Capacity Land-Based Layout to Mitigate Flood Risk (Case Study in Tempuran Floodplain, Ponorogo Regency) Novia Lusiana1 Bambang Rahadi2 Tunggul Sutanhaji3 1Environmental and Natural Resources Management Graduate Program University of Brawijaya, Malang, Indonesia 23Laboratory of Environment and Natural Resources Engineering, Department of Agricultural Engineering, Faculty of Agricultural Technology, University of Brawijaya, Malang, Indonesia Email : novialusiana@rocketmail.com, jbrahadi@ub.ac.id, tunggulsutanhaji@yahoo.com

    Science.gov (United States)

    Lusiana, N.

    2013-12-01

    Abstract Floods haves frequently hit Indonesia and have had greater negative impacts. In Javaboth the area affected by flooding and the amount of damage caused by floods have increased. At least, five factors, affect the flooding in Indonesia, including rainfall, reduced retention capacity of the watershed, erroneous design of river channel development, silting-up of the river, and erroneous regional layout. The level of the disastrous risks can be evaluated based on the extent of the threat and susceptibility of a region. One methode for risk assessment is Geographical Information System (GIS)-based mapping. Objectives of this research are: 1) evaluating current flood risk in susceptible areas, 2) applying supported land-based layout as effort to mitigate floodrisk, and 3) evaluating floodrisk for the period 2031 in the Tempuran floodplain of Ponorogo Regency. Result show that the area categorized as high risk covers 104. 6 ha (1. 2%), moderate risk covers 2512. 9 ha (28. 4%), low risk covers 3140. 8 ha (35. 5%), and the lowest risk covers 3096. 1 (34. 9%). Using Regional Layout Design for the years 2011 - 2031, the high risk area covers 67. 9 ha (0.8%), moderate risk covers 3033 ha (34. 3%), low risk covers 2770. 8 ha (31, 3%), and the lowest risk covers 2982. 6 ha (34%). Based on supported land suitability, the high-risk areais only 2. 9 ha (0.1%), moderate risk covers of 426. 1 ha (4. 8%), low risk covers 4207. 4 ha (47. 5%), and the lowest risk covers 4218 ha (47. 6%). Flood risk can be mitigated by applying supported land-based layout as shown by the reduced high-risk area, and the fact that > 90% of the areas are categorized as low or lowest risk of disaster. Keywords : Carrying Capacity, Land Capacity, Flood Risk

  12. 47 CFR 76.802 - Disposition of cable home wiring.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Disposition of cable home wiring. 76.802... MULTICHANNEL VIDEO AND CABLE TELEVISION SERVICE Cable Inside Wiring § 76.802 Disposition of cable home wiring... cable operator shall not remove the cable home wiring unless it gives the subscriber the opportunity to...

  13. Automatic reel controls filler wire in welding machines

    Science.gov (United States)

    Millett, A. V.

    1966-01-01

    Automatic reel on automatic welding equipment takes up slack in the reel-fed filler wire when welding operation is terminated. The reel maintains constant, adjustable tension on the wire during the welding operation and rewinds the wire from the wire feed unit when the welding is completed.

  14. 47 CFR 32.2321 - Customer premises wiring.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Customer premises wiring. 32.2321 Section 32... Customer premises wiring. (a) This account shall include all amounts transferred from the former Account 232, Station Connections, inside wiring subclass. (b) Embedded Customer Premises Wiring is that...

  15. 30 CFR 77.701-3 - Grounding wires; capacity.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Grounding wires; capacity. 77.701-3 Section 77... MINES Grounding § 77.701-3 Grounding wires; capacity. Where grounding wires are used to ground metallic sheaths, armors, conduits, frames, casings, and other metallic enclosures, such grounding wires will be...

  16. Wire Bonder: Kulicke and Soffa Model 4526

    Data.gov (United States)

    Federal Laboratory Consortium — Description:CORAL Name: Wire BonderNeeds Description.Scientific Opportunities / Applications:Wedge bonderSemi-automatic and manual modesIndependent Z-axis control,...

  17. Beam Profiling through Wire Chambing Tracking

    CERN Document Server

    Nash, W

    2013-01-01

    This note describes the calibration of the Delay Wire Chambers (DWCs) used during test runs of CALICE’s Tungsten Digital Hadron Calorimeter (W-DHCAL) prototype in CERN’s SPS beam line (10 – 300 GeV).

  18. Copyright and Wire Broadcasting Under Belgian Law

    Science.gov (United States)

    Namurois, Albert

    1975-01-01

    A discussion of a case whereby substantial damages, if not criminal proceedings, will sanction, according to circumstances, both television organizations and those who in certain conditions distribute their programs by wire or communicate them to the public. (Author/HB)

  19. Josephson junction arrays and superconducting wire networks

    International Nuclear Information System (INIS)

    Lobb, C.J.

    1992-01-01

    Techniques used to fabricate integrated circuits make it possible to construct superconducting networks containing as many as 10 6 wires or Josephson junctions. Such networks undergo phase transitions from resistive high-temperature states to ordered low-resistance low-temperature states. The nature of the phase transition depends strongly on controllable parameters such as the strength of the superconductivity in each wire or junction and the external magnetic field. This paper will review the physics of these phase transitions, starting with the simplest zero-magnetic field case. This leads to a Kosterlitz-Thouless transition when the junctions or wires are weak, and a simple mean-field fransition when the junctions or wires are strong. Rich behavior, resulting from frustration, occurs in the presence of a magnetic field. (orig.)

  20. Highly stretchable wrinkled gold thin film wires.

    Science.gov (United States)

    Kim, Joshua; Park, Sun-Jun; Nguyen, Thao; Chu, Michael; Pegan, Jonathan D; Khine, Michelle

    2016-02-08

    With the growing prominence of wearable electronic technology, there is a need to improve the mechanical reliability of electronics for more demanding applications. Conductive wires represent a vital component present in all electronics. Unlike traditional planar and rigid electronics, these new wearable electrical components must conform to curvilinear surfaces, stretch with the body, and remain unobtrusive and low profile. In this paper, the piezoresistive response of shrink induced wrinkled gold thin films under strain demonstrates robust conductive performance in excess of 200% strain. Importantly, the wrinkled metallic thin films displayed negligible change in resistance of up to 100% strain. The wrinkled metallic wires exhibited consistent performance after repetitive strain. Importantly, these wrinkled thin films are inexpensive to fabricate and are compatible with roll to roll manufacturing processes. We propose that these wrinkled metal thin film wires are an attractive alternative to conventional wires for wearable applications.

  1. Tensosensitivity of the Hot-Wire Probe

    National Research Council Canada - National Science Library

    Pak, A

    2002-01-01

    ...., on the anemometer type. In a constant current anemometer, it is possible to measure and separate out the noise moving to the electric circuit of the anemometer, it is not the case with hot-wire anemometers of other types...

  2. Molecular wires, switches and memories

    Science.gov (United States)

    Chen, Jia

    Molecular electronics, an emerging field, makes it possible to build individual molecules capable of performing functions identical or analogous to present- day conductors, switches, or memories. These individual molecules, with a nano-meter scale characteristic length, can be designed and chemically synthesized with specific atoms, geometries and charge distribution. This thesis focuses on the design, and measurements of molecular wires, and related strategically engineered structures-molecular switches and memories. The experimental system relies on a thermodynamically driven self-assembling process to attach molecules onto substrate surfaces without intervention from outside. The following topics will be discussed: directed nanoscale manipulation of self-assembled molecules using scanning tunneling microscope; investigation on through-bond transport of nanoscale symmetric metal/conjugated self- assembled monolayers (SAM)/metal junctions, where non- Ohmic thermionic emission was observed to be the dominant process, with isocyanide-Pd contacts showing the lowest thermionic barrier of 0.22 eV; the first realization of robust and large reversible switching behavior in an electronic device that utilizes molecules containing redox centers as the active component, exhibiting negative differential resistance (NDR) and large on-off peak-to-valley ratio (PVR); observation of erasable storage of higher conductivity states in these redox- center containing molecular devices, and demonstration of a two-terminal electronically programmable and erasable molecular memory cell with long bit retention time.

  3. The effect of ZnO nanoparticle coating on the frictional resistance between orthodontic wires and ceramic brackets

    Directory of Open Access Journals (Sweden)

    Ahmad

    2016-06-01

    Full Text Available Background. Any decrease in friction between orthodontic wire and bracket can accelerate tooth movement in the sliding technique and result in better control of anchorage. This study was carried out to evaluate frictional forces by coating orthodontic wires and porcelain brackets with zinc oxide nanoparticles (ZnO. Methods. In this in vitro study, we evaluated a combination of 120 samples of 0.019×0.025 stainless steel (SS orthodontic wires and 22 mil system edgewise porcelain brackets with and without spherical zinc oxide nanoparticles. Spherical ZnO nanoparticles were deposited on wires and brackets by immersing them in ethanol solution and SEM (scanning electron microscope evaluation confirmed the presence of the ZnO coating. The frictional forces were calculated between the wires and brackets in four groups: group ZZ (coated wire and bracket, group OO (uncoated wire and bracket, group ZO (coated wire and uncoated bracket and group OZ (uncoated wire and coated bracket. Kolmogorov-Smirnov, Mann-Whitney and Kruskal-Wallis tests were used for data analysis. Results. The frictional force in ZZ (3.07±0.4 N was the highest (P <0.05, and OZ (2.18±0.5 N had the lowest amount of friction (P <0.05 among the groups. There was no significant difference in frictional forces between the ZO and OO groups (2.65±0.2 and 2.70±0.2 N, respectively. Conclusion. Coating of porcelain bracket surfaces with ZnO nanoparticles can decrease friction in the sliding technique, and wire coating combined with bracket coating is not recommended due to its effect on friction.

  4. Load-Deflection and Friction Properties of PEEK Wires as Alternative Orthodontic Wires.

    Science.gov (United States)

    Tada, Yoshifumi; Hayakawa, Tohru; Nakamura, Yoshiki

    2017-08-09

    Polyetheretherketone (PEEK) is now attracting attention as an alternative to metal alloys in the dental field. In the present study, we evaluated the load-deflection characteristics of PEEK wires in addition to their frictional properties. Three types of PEEK wires are used: two sizes of rectangular shape, 0.016 × 0.022 in² and 0.019 × 0.025 in² (19-25PEEK), and rounded shape, diameter 0.016 in (16PEEK). As a control, Ni-Ti orthodontic wire, diameter 0.016 in, was used. The three-point bending properties were evaluated in a modified three-point bending system for orthodontics. The static friction between the orthodontic wire and the bracket was also measured. The load-deflection curves were similar among Ni-Ti and PEEK wires, except for 16PEEK with slot-lid ligation. The bending force of 19-25PEEK wire was comparable with that of Ni-Ti wire. 19-25PEEK showed the highest load at the deflection of 1500 μm ( p 0.05). No significant difference was seen in static friction between all three PEEK wires and Ni-Ti wire ( p > 0.05). It is suggested that 19-25PEEK will be applicable for orthodontic treatment with the use of slot-lid ligation.

  5. Audio wiring guide how to wire the most popular audio and video connectors

    CERN Document Server

    Hechtman, John

    2012-01-01

    Whether you're a pro or an amateur, a musician or into multimedia, you can't afford to guess about audio wiring. The Audio Wiring Guide is a comprehensive, easy-to-use guide that explains exactly what you need to know. No matter the size of your wiring project or installation, this handy tool provides you with the essential information you need and the techniques to use it. Using The Audio Wiring Guide is like having an expert at your side. By following the clear, step-by-step directions, you can do professional-level work at a fraction of the cost.

  6. Simulation of the AC corona phenomenon with experimental validation

    Science.gov (United States)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R.

    2017-11-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach.

  7. Simulation of the AC corona phenomenon with experimental validation

    International Nuclear Information System (INIS)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R

    2017-01-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach. (paper)

  8. Note: Improved wire-wound heater.

    Science.gov (United States)

    Steinmann, Ricardo G; Vitoux, Hugo

    2015-01-01

    The authors have measured, at cryogenic temperature, the upper limit of the heat transfer in different configurations of a wire-wound heater. We found that the heat transferred has an upper limit of about 15 W/cm(2) and is dependent on the diameter of the wire. In this paper, we present three ways of increasing the heat transferred by this type of heater and its application in different continuous flow cryostats.

  9. Graphene wire medium: Homogenization and application

    DEFF Research Database (Denmark)

    Andryieuski, Andrei; Chigrin, Dmitry N.; Lavrinenko, Andrei

    2012-01-01

    In this contribution we analyze numerically the optical properties of the graphene wire medium, which unit cell consists of a stripe of graphene embedded into dielectric. We propose a simple method for retrieval of the isofrequency contour and effective permittivity tensor. As an example...... of the graphene wire medium application we demonstrate a reconfigurable hyperlens for the terahertz subwavelength imaging capable of resolving two sources with separation λ0/5 in the far-field....

  10. Novel use of the "buddy"wire.

    LENUS (Irish Health Repository)

    O'Hare, A

    2008-12-29

    Summary: During interventional procedures the tortuosity of the vasculature hampers catheter stability. The buddy wire may be used to aid and maintain vascular access.We describe a case of acute subarachnoid haemorrhage secondary to dissecting aneurysm of the vertebral artery.We discuss the value of the buddy wire during balloon occlusion of the vertebral artery not as it is typically used, but to actually prevent the balloon repeatedly entering the posterior inferior cerebellar artery during the procedure.

  11. A Magnetic Sensor with Amorphous Wire

    Directory of Open Access Journals (Sweden)

    Dongfeng He

    2014-06-01

    Full Text Available Using a FeCoSiB amorphous wire and a coil wrapped around it, we have developed a sensitive magnetic sensor. When a 5 mm long amorphous wire with the diameter of 0.1 mm was used, the magnetic field noise spectrum of the sensor was about 30 pT/ÖHz above 30 Hz. To show the sensitivity and the spatial resolution, the magnetic field of a thousand Japanese yen was scanned with the magnetic sensor.

  12. COBRA-IV wire wrap data comparisons

    International Nuclear Information System (INIS)

    Donovan, T.E.; George, T.L.; Wheeler, C.L.

    1979-02-01

    Thermal hydraulic analyses of hexagonally packed wire-wrapped fuel assemblies are complicated by the induced crossflow between adjacent subchannels. The COBRA-IV computer code simultaneously solves the hydrodynamics and thermodynamics of fuel assemblies. The modifications and the results are presented which are predicted by the COBRA-IV calculation. Comparisons are made with data measured in five experimental models of a wire-wrapped fuel assembly

  13. Wiring System Diagnostic Techniques for Legacy Aircraft

    Science.gov (United States)

    2003-02-01

    Reunions des specialistes des techniques de estion du cycle de vie pour vehicules aeriens vieillissants ] To order the complete compilation report, use...Ageing Mechanisms and Control. Specialists’ Meeting on Life Management Techniques for Ageing Air Vehicles [Les mecanismes vieillissants et le controle...be identified. Additionally, wiring failures tend to be intermittent in nature and can take considerable time to isolate. Wire modifications and

  14. Should women carry their antenatal records?

    OpenAIRE

    Draper, J; Field, S; Thomas, H; Hare, M J

    1986-01-01

    A study of women's views on carrying their medical records during their pregnancy was conducted in Cambridge in 1982. Eighty eight women who were given their full records were compared with a control group of 83 women who carried the traditional cooperation card, both groups answering postal questionnaires about the advantages and disadvantages of carrying their respective records. Most women found advantages in carrying the complete record, although it was too large to carry for practical pu...

  15. ROOT Analysis of 2004 H8 Test Beam Data & Studies of MDT Sense Wire Displacements

    CERN Document Server

    2004-01-01

    Tests are being carried out at the CERN H8 Test Facility on the subdetectors of ATLAS. Using MUTRAK, a tool developed by Dan Levin, data from test muon beam runs are converted to PAW plots and ntuples for easy analysis. ROOT classes are currently being developed to convert the PAW output of MUTRAK to ROOT files for more detailed analysis. Also studies are currently underway to understand the effect of sense wire displacements in Monitored Drift Tubes on drift time spectra. Concurrent tests using simulations in GARFIELD and Cosmic Ray MDT experiments are underway to study wire sags which may be up to 480 micrometers due to gravitational and electrostatic forces .

  16. Subchannel Analysis of Wire Wrapped SCWR Assembly

    Directory of Open Access Journals (Sweden)

    Jianqiang Shan

    2014-01-01

    Full Text Available Application of wire wrap spacers in SCWR can reduce pressure drop and obtain better mixing capability. As a consequence, the required coolant pumping power is decreased and the coolant temperature profile inside the fuel bundle is flattened which will obviously decrease the peak cladding temperature. The distributed resistance model for wire wrap was developed and implemented in ATHAS subchannel analysis code. The HPLWR wire wrapped assembly was analyzed. The results show that: (1 the assembly with wire wrap can obtain a more uniform coolant temperature profile than the grid spaced assembly, which will result in a lower peak cladding temperature; (2 the pressure drop in a wire wrapped assembly is less than that in a grid spaced assembly, which can reduce the operating power of pump effectively; (3 the wire wrap pitch has significant effect on the flow in the assembly. Smaller Hwire/Drod will result in stronger cross flow a more uniform coolant temperature profile, and also a higher pressure drop.

  17. Superconducting wires and methods of making thereof

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Xingchen; Sumption, Michael D.; Peng, Xuan

    2018-03-13

    Disclosed herein are superconducting wires. The superconducting wires can comprise a metallic matrix and at least one continuous subelement embedded in the matrix. Each subelement can comprise a non-superconducting core, a superconducting layer coaxially disposed around the non-superconducting core, and a barrier layer coaxially disposed around the superconducting layer. The superconducting layer can comprise a plurality of Nb.sub.3Sn grains stabilized by metal oxide particulates disposed therein. The Nb.sub.3Sn grains can have an average grain size of from 5 nm to 90 nm (for example, from 15 nm to 30 nm). The superconducting wire can have a high-field critical current density (J.sub.c) of at least 5,000 A/mm.sup.2 at a temperature of 4.2 K in a magnetic field of 12 T. Also described are superconducting wire precursors that can be heat treated to prepare superconducting wires, as well as methods of making superconducting wires.

  18. Si Wire-Array Solar Cells

    Science.gov (United States)

    Boettcher, Shannon

    2010-03-01

    Micron-scale Si wire arrays are three-dimensional photovoltaic absorbers that enable orthogonalization of light absorption and carrier collection and hence allow for the utilization of relatively impure Si in efficient solar cell designs. The wire arrays are grown by a vapor-liquid-solid-catalyzed process on a crystalline (111) Si wafer lithographically patterned with an array of metal catalyst particles. Following growth, such arrays can be embedded in polymethyldisiloxane (PDMS) and then peeled from the template growth substrate. The result is an unusual photovoltaic material: a flexible, bendable, wafer-thickness crystalline Si absorber. In this paper I will describe: 1. the growth of high-quality Si wires with controllable doping and the evaluation of their photovoltaic energy-conversion performance using a test electrolyte that forms a rectifying conformal semiconductor-liquid contact 2. the observation of enhanced absorption in wire arrays exceeding the conventional light trapping limits for planar Si cells of equivalent material thickness and 3. single-wire and large-area solid-state Si wire-array solar cell results obtained to date with directions for future cell designs based on optical and device physics. In collaboration with Michael Kelzenberg, Morgan Putnam, Joshua Spurgeon, Daniel Turner-Evans, Emily Warren, Nathan Lewis, and Harry Atwater, California Institute of Technology.

  19. Needleless electrospinning with twisted wire spinneret

    International Nuclear Information System (INIS)

    Holopainen, Jani; Penttinen, Toni; Santala, Eero; Ritala, Mikko

    2015-01-01

    A needleless electrospinning setup named ‘Needleless Twisted Wire Electrospinning’ was developed. The polymer solution is electrospun from the surface of a twisted wire set to a high voltage and collected on a cylindrical collector around the wire. Multiple Taylor cones are simultaneously self-formed on the downward flowing solution. The system is robust and simple with no moving parts aside from the syringe pump used to transport the solution to the top of the wire. The structure and process parameters of the setup and the results on the preparation of polyvinyl pyrrolidone (PVP), hydroxyapatite (HA) and bioglass fibers with the setup are presented. PVP fiber sheets with areas of 40 × 120 cm 2 and masses up to 1.15 g were prepared. High production rates of 5.23 g h −1 and 1.40 g h −1 were achieved for PVP and HA respectively. The major limiting factor of the setup is drying of the polymer solution on the wire during the electrospinning process which will eventually force to interrupt the process for cleaning of the wire. Possible solutions to this problem and other ways to develop the setup are discussed. The presented system provides a simple way to increase the production rate and area of fiber sheet as compared with the conventional needle electrospinning. (paper)

  20. 75 FR 60480 - In the Matter of Certain Bulk Welding Wire Containers and Components Thereof and Welding Wire...

    Science.gov (United States)

    2010-09-30

    ... COMMISSION In the Matter of Certain Bulk Welding Wire Containers and Components Thereof and Welding Wire... importation, or the sale within the United States after importation of certain bulk welding wire containers, components thereof, and welding wire by reason of infringement of certain claims of United States Patent Nos...

  1. Empolder and application of LiveWire program

    International Nuclear Information System (INIS)

    Zhang Bo; Li Jing; Wang Xiaoming

    2007-01-01

    LiveWire is a specific module of Netscape Web server to actualize CGI function; through LiveWire application program one can create dynamic web page on web site. This article introduces how to write LiveWire application code, have to compile, debug and manage LiveWire application programs, and how to apply LiveWire application program on Netscape Web server to create a dynamic web page. (authors)

  2. Wiring design for the control of electromagnetic interference (EMI)

    Science.gov (United States)

    Kopasakis, George

    1995-01-01

    Wiring design is only one important aspect of EMI control. Other important areas for EMI are: circuit design, filtering, grounding, bonding, shielding, lighting, electrostatic discharge (ESD), transient suppression, and electromagnetic pulse (EMP). Topics covered include: wire magnetic field emissions at low frequencies; wire radiated magnetic field emissions at frequencies; wire design guidelines for EMI control; wire design guidelines for EMI control; high frequency emissions from cables; and pulse frequency spectra.

  3. AC distribution system for TFTR pulsed loads

    International Nuclear Information System (INIS)

    Carroll, R.F.; Ramakrishnan, S.; Lemmon, G.N.; Moo, W.I.

    1977-01-01

    This paper outlines the AC distribution system associated with the Tokamak Fusion Test Reactor and discusses the significant areas related to design, protection, and equipment selection, particularly where there is a departure from normal utility and industrial applications

  4. Logistics Reduction: Advanced Clothing System (ACS)

    Data.gov (United States)

    National Aeronautics and Space Administration — The goal of the Advanced Exploration System (AES) Logistics Reduction (LR) project's Advanced Clothing System (ACS) is to use advanced commercial off-the-shelf...

  5. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  6. Energetics of load carrying in Nepalese porters.

    Science.gov (United States)

    Bastien, Guillaume J; Schepens, Bénédicte; Willems, Patrick A; Heglund, Norman C

    2005-06-17

    Nepalese porters routinely carry head-supported loads equal to 100 to 200% of their body weight (Mb) for many days up and down steep mountain footpaths at high altitudes. Previous studies have shown that African women carry head-supported loads of up to 60% of their Mb far more economically than army recruits carrying equivalent loads in backpacks. Here we show that Nepalese porters carry heavier loads even more economically than African women. Female Nepalese porters, for example, carry on average loads that are 10% of their Mb heavier than the maximum loads carried by the African women, yet do so at a 25% smaller metabolic cost.

  7. Study of a large wire chamber; Etude d`une chambre de grande taille a un fil

    Energy Technology Data Exchange (ETDEWEB)

    Marchand, C.; Del Moral, R. [Centre d`Etudes Nucleaires, Bordeaux-1 Univ., 33 Gradignan (France); Dufour, J-P. [URA451 Gradignan (France)

    1997-06-01

    We have tested a cylindrical large size single-wire chamber to check the possibility of obtaining high precision in the measurement with such detectors of the energy of the particles, dissipated entirely in the gas of the chamber. Such tests were carried out at the same time as preliminary studies of the multiwire systems devoted to measurements of individual energies, multiplicity and angular distributions for particle nuclei, with or without beta emission. The length of the chamber is 1 m, the diameter, 0.2 m and the wire diameter is 100 {mu}m. The composition of the chamber gas is 90% Ar and 10% CH{sub 4}. Several measurements were performed with this chamber and the energy spectrum from a 3 {alpha} source is given. The FWHM at 5.16 MeV is 76 keV which is a rather good value for a detector of 4 {mu}{pi} geometrical efficiency. On the basis of these results the project of a 8 wire detector was developed. The simulation of the operation of this chamber was made with the help of GARFIELD code of CERN. It was found that the field in the vicinity of the wire is very homogeneous. The paper presents also the equipotentials at 1 mm distance from the wire center. Also, are shown the gain fluctuations computed for 20 avalanches when the external tube potential and the potential center wire are matched in order to obtain a homogeneous field around the wires

  8. The Role of Overloading on the Reduction of Residual Stress by Cyclic Loading in Cold-Drawn Prestressing Steel Wires

    Directory of Open Access Journals (Sweden)

    Jesús Toribio

    2017-01-01

    Full Text Available Prestressing steel wires are commonly used as reinforcement elements in structures bearing fatigue loads. These wires are obtained by a conforming process called cold drawing, where a progressive reduction of the wire diameter is produced, causing residual stress in the commercial wire. The aim of this paper is to analyze the effect of diverse in-service cyclic loading conditions (cyclic loading and cyclic loading with overload on such a residual stress field. To achieve this goal, firstly, a numerical simulation of the wire drawing process of a commercial prestressing steel wire was carried out to reveal the residual stress state induced by the manufacture technique. Afterwards, a numerical simulation was performed of the in-service loading conditions of a prestressing steel wire in which the previously calculated residual stress state is included. The analysis of the obtained results shows a significant reduction of the residual stress state of about 50% for common in-service loadings and as high as 90% for certain cases undergoing overloads during cyclic loading. Therefore, an improvement of the mechanical performance of these structural components during their life in-service can be achieved.

  9. Control of flow structure in the wake region of circular cylinder with meshy wire in deep water

    Directory of Open Access Journals (Sweden)

    Burcu Oğuz

    2016-08-01

    Full Text Available In this study the aim is decreasing the effect and the intensity of the temporary loads resulted from vortex shedding that have an impact on the cylinder (chimneys, high buildings etc. located in deep water and the object or objects in the wake region and definition of the optimum values (wire thickness and porosity β With different thickness and different porosity ratios the effect of meshy wire that surrounded a circular cylinder of D=50 mm diameter was observed at Re_D=5000. The porosity ratios were four different values between a range of β=0.5-0.8 with an interval of 0.1. The thicknesses of wire were 1 mm, 2 mm, 3 mm and 4 mm. The flow structure in the wake region of circular cylinder was tried to be controlled by meshy wire that surrounded the cylinder. Experiments were carried out by using particle image velocimetry (PIV technique. Comparing with bare cylinder results, turbulence kinetic energy (TKE and Reynolds shear stress values increase with wire thicknesses of b=1 mm, 2 mm for all porosity ratios and decrease with b=3 mm, 4 mm. With porosity ratio of β=0.6 and wire thickness of b=4 mm TKE and Reynolds shear stress results show that meshy wire controls the flow in the wake region of the cylinder. Frequency value results also define that best flow control is obtained with β=0.6 and b=4 mm.

  10. Life cycle assessment of the application of nanoclays in wire coating

    Science.gov (United States)

    Tellaetxe, A.; Blázquez, M.; Arteche, A.; Egizabal, A.; Ermini, V.; Rose, J.; Chaurand, P.; Unzueta, I.

    2012-09-01

    A life cycle assessment (LCA) is carried out to compare nanoclay-reinforced polymer wire coatings with conventional ones. While the conventional wire coatings contain standard halogen free retardants, in reinforced coatings, montmorillonite (nanoclay) is incorporated into electric cable linings as a rheological agent for an increased resistance to fire. In addition, a reduced load of standard halogen free retardants is obtained. The synergistic effect of the montmorillonite on traditional flame retardant additives (by the formation of a three-dimensional char network) can lead to a revolution in wire production. The application of nanoclays contributes also to anti-dripping effect and flexibility increase [1]. Some producers have already started commercializing wire with nanotechnology-based coating; in the short term the use of nanoclay in wire coating production will probably reach a significant market share replacing traditional formulations. The main aim of this study is to compare the environmental impacts along the life cycle of a traditional wire coating (mineral flame retardants like ATH or MDH in a polymer matrix) with the nanoclay-reinforced wire coating, where the montmorillonite replaces a low percentage of the mineral flame retardant. The system boundaries of the study include the following unit processes: nanoclay production, thermoplastic material and mineral flame retardants production, cable coating manufacturing by extrusion and different end of life scenarios (recycling, incineration and landfill disposal). Whereas nanoreinforced composites have shown and increased fire retardance, the addition of nanomaterials seems to have no significant relevance in the environmental assessment. However, the lack of nano-specific characterization factors for nanomaterials and emission rates associated to the different life cycle stages -mainly in the extrusion and use phase, where accidental combustions can take place- still remains a challenge for realistic

  11. Life cycle assessment of the application of nanoclays in wire coating

    International Nuclear Information System (INIS)

    Tellaetxe, A; Blázquez, M; Unzueta, I; Arteche, A; Egizabal, A; Ermini, V; Rose, J; Chaurand, P

    2012-01-01

    A life cycle assessment (LCA) is carried out to compare nanoclay-reinforced polymer wire coatings with conventional ones. While the conventional wire coatings contain standard halogen free retardants, in reinforced coatings, montmorillonite (nanoclay) is incorporated into electric cable linings as a rheological agent for an increased resistance to fire. In addition, a reduced load of standard halogen free retardants is obtained. The synergistic effect of the montmorillonite on traditional flame retardant additives (by the formation of a three-dimensional char network) can lead to a revolution in wire production. The application of nanoclays contributes also to anti-dripping effect and flexibility increase. Some producers have already started commercializing wire with nanotechnology-based coating; in the short term the use of nanoclay in wire coating production will probably reach a significant market share replacing traditional formulations. The main aim of this study is to compare the environmental impacts along the life cycle of a traditional wire coating (mineral flame retardants like ATH or MDH in a polymer matrix) with the nanoclay-reinforced wire coating, where the montmorillonite replaces a low percentage of the mineral flame retardant. The system boundaries of the study include the following unit processes: nanoclay production, thermoplastic material and mineral flame retardants production, cable coating manufacturing by extrusion and different end of life scenarios (recycling, incineration and landfill disposal). Whereas nanoreinforced composites have shown and increased fire retardance, the addition of nanomaterials seems to have no significant relevance in the environmental assessment. However, the lack of nano-specific characterization factors for nanomaterials and emission rates associated to the different life cycle stages -mainly in the extrusion and use phase, where accidental combustions can take place- still remains a challenge for realistic life

  12. Characteristics of the Sliding Electric Contact of Pantograph/Contact Wire Systems in Electric Railways

    Directory of Open Access Journals (Sweden)

    Guangning Wu

    2017-12-01

    Full Text Available The sliding electric contact of pantograph/contact wire systems plays a significant part in the current collection stability and operation life of pantograph/contact wire systems. This paper addresses the evolutionary process of sliding electric contact of pantograph/contact wire systems by analyzing three key characteristics including contact resistance, temperature distribution and microstructure. The influence of electric current on contact resistance was interpreted. Furthermore, the evolution of the spatial temperature distribution of the carbon strip was obtained in the zigzag movement, while the dominant role of electric effect in temperature rise was demonstrated. In the end, the wear morphology differences under pure friction and current-carrying conditions were analyzed. The formation of radial cracks was illustrated and its influenced on the wear process was discussed.

  13. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    International Nuclear Information System (INIS)

    Schaerz, B.; Bruzzone, P.; Favez, J.Y.; Lister, J.B.; Zapretilina, E.

    2001-11-01

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  14. Mixed and dynamic response of hot wires and cold wires and measurements of turbulence statistics

    DEFF Research Database (Denmark)

    Larsen, Søren Ejling; Højstrup, Jørgen; Fairall, C. W.

    1986-01-01

    Hot wires respond to temperature as well as to velocity, whereas cold wires respond to velocity as well as to temperature. The static and dynamic response characteristics are summarized and it is shown that the frequency transfer functions for the four different responses in general are different...

  15. Modeling and simulation of the fluid flow in wire electrochemical machining with rotating tool (wire ECM)

    Science.gov (United States)

    Klocke, F.; Herrig, T.; Zeis, M.; Klink, A.

    2017-10-01

    Combining the working principle of electrochemical machining (ECM) with a universal rotating tool, like a wire, could manage lots of challenges of the classical ECM sinking process. Such a wire-ECM process could be able to machine flexible and efficient 2.5-dimensional geometries like fir tree slots in turbine discs. Nowadays, established manufacturing technologies for slotting turbine discs are broaching and wire electrical discharge machining (wire EDM). Nevertheless, high requirements on surface integrity of turbine parts need cost intensive process development and - in case of wire-EDM - trim cuts to reduce the heat affected rim zone. Due to the process specific advantages, ECM is an attractive alternative manufacturing technology and is getting more and more relevant for sinking applications within the last few years. But ECM is also opposed with high costs for process development and complex electrolyte flow devices. In the past, few studies dealt with the development of a wire ECM process to meet these challenges. However, previous concepts of wire ECM were only suitable for micro machining applications. Due to insufficient flushing concepts the application of the process for machining macro geometries failed. Therefore, this paper presents the modeling and simulation of a new flushing approach for process assessment. The suitability of a rotating structured wire electrode in combination with an axial flushing for electrodes with high aspect ratios is investigated and discussed.

  16. STRS SpaceWire FPGA Module

    Science.gov (United States)

    Lux, James P.; Taylor, Gregory H.; Lang, Minh; Stern, Ryan A.

    2011-01-01

    An FPGA module leverages the previous work from Goddard Space Flight Center (GSFC) relating to NASA s Space Telecommunications Radio System (STRS) project. The STRS SpaceWire FPGA Module is written in the Verilog Register Transfer Level (RTL) language, and it encapsulates an unmodified GSFC core (which is written in VHDL). The module has the necessary inputs/outputs (I/Os) and parameters to integrate seamlessly with the SPARC I/O FPGA Interface module (also developed for the STRS operating environment, OE). Software running on the SPARC processor can access the configuration and status registers within the SpaceWire module. This allows software to control and monitor the SpaceWire functions, but it is also used to give software direct access to what is transmitted and received through the link. SpaceWire data characters can be sent/received through the software interface, as well as through the dedicated interface on the GSFC core. Similarly, SpaceWire time codes can be sent/received through the software interface or through a dedicated interface on the core. This innovation is designed for plug-and-play integration in the STRS OE. The SpaceWire module simplifies the interfaces to the GSFC core, and synchronizes all I/O to a single clock. An interrupt output (with optional masking) identifies time-sensitive events within the module. Test modes were added to allow internal loopback of the SpaceWire link and internal loopback of the client-side data interface.

  17. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  18. First AC loss test and analysis of a Bi2212 cable-in-conduit conductor for fusion application

    Science.gov (United States)

    Qin, Jinggang; Shi, Yi; Wu, Yu; Li, Jiangang; Wang, Qiuliang; He, Yuxiang; Dai, Chao; Liu, Fang; Liu, Huajun; Mao, Zhehua; Nijhuis, Arend; Zhou, Chao; Devred, Arnaud

    2018-01-01

    The main goal of the Chinese fusion engineering test reactor (CFETR) is to build a fusion engineering tokamak reactor with a fusion power of 50-200 MW, and plan to test the breeding tritium during the fusion reaction. This may require a maximum magnetic field of the central solenoid and toroidal field coils up to 15 T. New magnet technologies should be developed for the next generation of fusion reactors with higher requirements. Bi2Sr2CaCu2Ox (Bi2212) is considered as a potential and promising superconductor for the magnets in the CFETR. R&D activities are ongoing at the Institute of Plasma Physics, Chinese Academy of Sciences for demonstration of the feasibility of a CICC based on Bi2212 round wire. One sub-size conductor cabled with 42 wires was designed, manufactured and tested with limited strand indentation during cabling and good transport performance. In this paper, the first test results and analysis on the AC loss of Bi2212 round wires and cabled conductor samples are presented. Furthermore, the impact of mechanical load on the AC loss of the sub-size conductor is investigated to represent the operation conditions with electromagnetic loads. The first tests provide an essential basis for the validation of Bi2212 CICC and its application in fusion magnets.

  19. THE STRUCTURE ANALYTICAL RESEARCH OF POROUS PERMEABLE WIRE MATERIAL (in Russian

    Directory of Open Access Journals (Sweden)

    Andrzej JAKUBOWSKI

    2016-04-01

    Full Text Available The details of making technology of porous permeable material with use of wire are allowed to carry out the analytical research of structure and structural characteristics of wire winding body. Its permit for prognostication the final proper-ties of material, that is produced by the following deformation treatment (diameter reduction. Due to the regular orga-nized arrangement of wire, the coil of winding body is considered as a multispan continuous beam, but a contact of coils – as interaction of two cylinders. Possibility of exactly calculation of the contacts between coils is allowed to go over the single fragment displacements into deformation of whole winding body. During research of deformation processes in regards of winding body geometry and used wire mechanical properties, the structural characteristics of porous permea-ble wire material are expected. The optimal number of winding layers, eliminating the distortion of organized final struc-ture, is established. The material pressure–compactness relation is obtained in order to control the technological condi-tions of winding and drafting for guarantee the product required properties.

  20. Influence of hardening and surface modification of endourological wires on corrosion resistance.

    Science.gov (United States)

    Walke, Witold; Przondziono, Joanna

    2012-01-01

    Guide wires with suitable functional characteristics are of crucial importance for proper urological treatment. This study presents an analysis of the effect of work hardening taking place in the process of wire cold drawing and the effect of surface modification by means of electrochemical polishing and chemical passivation on the resistance of wires made of X10CrNi18-8 steel used in urology. Corrosion resistance was evaluated on the grounds of the registered anodic polarisation curves by means of potentiodynamic method. The tests were made in solution simulating human urine. Anodic polarisation curves were presented for selected wire diameters. Mechanical properties were tested in a static uniaxial tensile test. The course of flow curve as well as mathematical form of flow stress function were determined. Curves presenting the relation of polarisation resistance as a function of strain applied in the drawing process are given. The tests carried out show that surface modification by means of electrochemical polishing and then chemical passivation of wires used in endourological treatment is fundamental.

  1. Non-destructive X-ray examination of weft knitted wire structures

    Science.gov (United States)

    Obermann, M.; Ellouz, M.; Aumann, S.; Martens, Y.; Bartelt, P.; Klöcker, M.; Kordisch, T.; Ehrmann, A.; Weber, M. O.

    2016-07-01

    Conductive yarns or wires are often integrated in smart textiles to enable data or energy transmission. In woven fabrics, these conductive parts are fixed at defined positions and thus protected from external loads. Knitted fabrics, however, have relatively loose structures, resulting in higher impacts of possible mechanical forces on the individual yarns. Hence, metallic wires with smaller diameters in particular are prone to break when integrated in knitted fabrics. In a recent project, wires of various materials including copper, silver and nickel with diameters varying between 0.05 mm and 0.23 mm were knitted in combination with textile yarns. Hand flat knitting machines of appropriate gauges were used to produce different structures. On these samples, non-destructive examinations, using an industrial X-ray system Seifert x|cube (225 kV) equipped with a minifocus X-ray tube, were carried out, directly after knitting as well as after different mechanical treatments (tensile, burst, and washing tests). In this way, structural changes of the stitch geometry could be visualized before failure. In this paper, the loop geometries in the knitted fabrics are depicted depending on knitted structures, wire properties and the applied mechanical load. Consequently, it is shown which metallic wires and yarns are most suitable to be integrated into knitted smart textiles.

  2. Precipitation formation in recrystallized nickel-plated non-sag tungsten wire

    International Nuclear Information System (INIS)

    Lai, Z.H.

    1994-01-01

    It is well established that some metals, such as palladium and nickel, can easily penetrate into tungsten by fast diffusion via crystal defects such as grain boundaries and dislocations. As a result of the fast penetration of these so called activators the recrystallization temperature of heavily drawn non-sag tungsten wire can be lower from about 2,000 C to about 1,000 C, thus the application of the tungsten wire, serving as reinforcement material in metal matrix composites used at high temperatures, is limited. An interesting question is in which form these activators exist in the recrystallized tungsten wire. It is generally believed that W-Ni intermediate compounds could form in the recrystallized material, presumably at grain boundaries. The free energy difference between the pure tungsten fibbers and the precipitating W(Ni) solid solution was suggested as the chemical driving force which governed the recrystallization process. The presence of nickel in small particles had also been observed in recrystallized grains of nickel plated tungsten wires using scanning electron microscopy (SEM) and secondary ion mass spectroscopy. These particles were considered to be nickel rich precipitates. However, a detailed investigation of the precipitation process has not been reported. In the present work an investigation of the structure, composition and distribution of nickel rich particles precipitated in recrystallized grains of nickel plated heavily drawn non-sage tungsten wires was carried out using analytical electron microscopy (AEM)

  3. Local Dynamic Stability Associated with Load Carrying

    Directory of Open Access Journals (Sweden)

    Jian Liu

    2013-03-01

    Conclusion: Current study confirmed the sensitivity of local dynamic stability measure in load carrying situation. It was concluded that load carrying tasks were associated with declined local dynamic stability, which may result in increased risk of fall accident. This finding has implications in preventing fall accidents associated with occupational load carrying.

  4. Study of the electric Held in HTS tape caused by perpendicular AC magnetic field

    International Nuclear Information System (INIS)

    Roiberg, V; Kopansky, F.

    2004-01-01

    Full Text: In a previous work we studied the influence of AC magnetic fields on voltage-currents (V-I) characteristics of high temperature superconducting (HTS) multi filament BSCC0-2223 tapes. It was found that AC magnetic fields perpendicular to the ab plane (the wide surface of the tape) cause a linear decrease of the critical current (IC) with amplitude of the AC magnetic field. The degradation of IC in .AC field was explained by the geometrical model according to which the transport current floe: is confined to the central zone of the tape where .AC field does not penetrate. For deeper understanding of the observed phenomena we carried out a study of the time dependence of the electric field during the cycle of AC field. At the same time we expanded the frequency range to low frequencies down to 1 Hz. The main results of the work are as following. 1. The time modulation of the electric field E in the HTS tape carrying transport DC current has the double frequency relating to AC magnetic field. 2. In field amplitudes less than 70 G the electric field modulation decreases with increasing frequency in opposite to its well-pronounced increase in higher AC field amplitudes. Alcove 70 G, the electric field increases with increasing the frequency of the external magnetic field. The wave forms of the electric field are different in both amplitudes ranges. 3. E-I curves of the tape in low amplitudes are frequency independent and coincide with E-l curves in AC field with intensity equal to the AC field amplitude. 4. In high AC field amplitudes, a strong dependence of the E-I curves on frequency is observed in the frequency range of 1-40 Hz and no dependence is observed in higher frequencies. Our results suggest that a combination of the geometrical model with flux creep concepts is necessary for a better understanding of the electric field behavior in our measurement conditions

  5. Joint angle measurement: a comparative study of the reliability of goniometry and wire tracing for the hand.

    Science.gov (United States)

    Ellis, B; Bruton, A; Goddard, J R

    1997-11-01

    To compare the inter- and intra-rater reliability of goniometry and wire tracing in the assessment of finger joint angles: metacarpo-phalangeal (MCPJ), proximal (PIPJ) and distal interphalangeal joints (DIPJ). Twenty occupational therapists and 20 physiotherapists with a range of clinical experience were recruited from nine different centres. Using a masked goniometer and wire tracing they carried out repeated assessments of the MCPJ, PIPJ and DIPJ of a normal subject fixed in two different positions. The two assessment methods did not produce comparable angle measurements. Goniometry showed greater inter- and intra-rater reliability than wire tracing. Regardless of the assessment tool, the repeatability coefficient indicated that DIPJ measurement was less reliable than the other joints. Clinical and specialist experience did not affect reliability. Although both goniometry and wire tracing show limitations as reliable assessment tools, it is recommended that where possible goniometry should be used.

  6. Strength of stainless steel surgical wire in various fixation modes.

    Science.gov (United States)

    Schultz, R S; Boger, J W; Dunn, H K

    1985-09-01

    Although wire is a commonly used fixation device in orthopedics, little is known about the effects of fastening methods and configurations on the strength of wiring systems. Three sizes of stainless steel surgical wire were tested in noncyclic tensile loading. Load failure levels increased with enlarging wire diameter. Fastening twists were stronger than knots or the ASIF bend technique. The failure mode for twists was untwisting. More than two twists gave no additional strength to the system. Two commercial wire tightening devices gave stronger and more reproducible twists than did ordinary pliers. The addition of a tension equalizing loop opposite the fastening loop weakened the wire system by 10%-15%. The combination of two single wire loops was stronger than a continuous double loop of wire. The results from this study are intended to help the orthopedic surgeon optimize the use of wire.

  7. Integrated Electrical Wire Insulation Repair System

    Science.gov (United States)

    Williams, Martha; Jolley, Scott; Gibson, Tracy; Parks, Steven

    2013-01-01

    An integrated system tool will allow a technician to easily and quickly repair damaged high-performance electrical wire insulation in the field. Low-melt polyimides have been developed that can be processed into thin films that work well in the repair of damaged polyimide or fluoropolymer insulated electrical wiring. Such thin films can be used in wire insulation repairs by affixing a film of this low-melt polyimide to the damaged wire, and heating the film to effect melting, flow, and cure of the film. The resulting repair is robust, lightweight, and small in volume. The heating of this repair film is accomplished with the use of a common electrical soldering tool that has been modified with a special head or tip that can accommodate the size of wire being repaired. This repair method can furthermore be simplified for the repair technician by providing replaceable or disposable soldering tool heads that have repair film already "loaded" and ready for use. The soldering tool heating device can also be equipped with a battery power supply that will allow its use in areas where plug-in current is not available

  8. EVALUATION OF INDUCTANCE WITH ELECTRICAL WIRES

    Directory of Open Access Journals (Sweden)

    V. Kudry

    2016-08-01

    Full Text Available In this paper proved the possibility of developing passive electronic inductive elements based replace metal wire that is wound inductor, the wire is made of electret. The relative permeability of the electret S  10 000, several orders of magnitude greater than the permeability of conventional insulation materials, i < 10, resulting current in the wire acquires properties bias current. The essence of innovation is to replace the source of of magnetic induction flow that pervades the core of the coil. According to the theory of electrodynamics, current bias, in contrast to conduction current, generated no movement of charge along the wire, but the change of the charge in the local volume.Equivalence bias current and conduction current is manifested in the possibility of forming a magnetic field. The flow through magnetic induction coil core regardless of the current it generates, creates voltage at its ends.The paper also shows the numeric characteristics that determine the effective frequency range, specified the reason why electric a wire with і < 10 can not generate magnetic flux through the core and serve as a passive reactive component.

  9. Percutaneous tension band wiring for patellar fractures.

    Science.gov (United States)

    Rathi, Akhilesh; Swamy, M K S; Prasantha, I; Consul, Ashu; Bansal, Abhishek; Bahl, Vibhu

    2012-08-01

    To evaluate outcome of percutaneous tension band wiring for transverse fractures of the patella. 16 men and 7 women aged 27 to 65 (mean, 40) years underwent percutaneous tension band wiring for transverse fractures of the patella with a displacement of >3 mm. Pain, operating time, mobility, functional score, and complications were evaluated. 20 patients underwent successful percutaneous tension band wiring. The remaining 3 patients in whom closed reduction failed underwent open reduction and tension band wiring. The mean operating time was 46 (range, 28-62) minutes. The mean follow-up period was 20 (range, 15-30) months. At the latest follow-up, all patients had regained full extension. The objective score was excellent in 20 patients and good in 3, whereas the subjective score was excellent in 17, good in 5, and fair in one. All patients had radiological union at week 8. One patient had patellofemoral arthritis (secondary to a postoperative articular step). Two patients developed superficial infections, which resolved after antibiotic therapy. Mean thigh muscle wasting was 0.7 (range, 0.4-1) cm. Three patients encountered hardware problems (impingement/irritation of the skin over the knee) necessitating implant removal. Percutaneous tension band wiring is a viable option for transverse fractures of the patella.

  10. TRANSMISSION LINE-WIRE DANCING (GALLOPING – LYAPUNOV INSTABILITY

    Directory of Open Access Journals (Sweden)

    V. I. Vanko

    2014-01-01

    Full Text Available This article describes aerodynamic losses of damping, or aerodynamic instability, which we observe in experiments and in engineering practice. As applied to industrial high-voltage lines this phenomenon is usually called galloping (dancing of phase line wires. This phenolmenon can be explained by Lyapunov’s instability of equilibrium state of wires profile (cross-section. In addition to known condition of Grauert-den-Hartog’s instability there was obtained practical condition of instability, which depends only on stationary aerodynamic profile’s factor – dimensionless coefficient of head resistance and lift coefficient, and also on their derivative with respect to the angle of attack.There was suggested an effective numerical-analytical method of investigation of stability for equilibrium of profile’s state in flow, which was developed at the department “Applied mathematics” of Bauman MSTU. This method allows to determine the stationary aerodynamics characteristics of profile by numerical simulation of profile flow under different angles of attack by vortex element method and later on the application of analytical conditions of stability and Lyapunov’s instability of equilibrium positions. The obtained results during the investigation of rhombic and square profiles stability, as well as general profile of iced wire, and their comparisons with the known experiments’ results in aerodynamic tubes indicate the precision of developed methods and algorithms. The usage of mesh-free Lagrange method of vortex elements and software for their realization allows to solve also dual problems of aerohydroelasticity and to carry out direct numerical simulation of profile movement in flow. In this article the investigations’ results of different authors in this field were taken into account.

  11. A Wire Grid Paraboloid for Large Low Frequency Telescopes

    Science.gov (United States)

    Kuiper, Tom

    2017-05-01

    Planetary magnetic fields are usually studied remotely through their electron cyclotron maser (ECM) emission from electrons trapped in their magnetic fields. Jupiter has been well studied since the 1960's because its strong magnetic field allows emissions up to about 40 MHz to be observed. The emission from Earth and other outer planets is mostly below 1 MHz and can only be observed from space. It is reasonable to assume that most exoplanets with ECM must be observed at low frequencies from space. Even optimistic assumptions about the strength of such emission leads one to conclude that very large filled aperture telescopes, with a diameters of a kilometer or more, will be needed.This paper reports on a study of a copper wire reflector with a diameter of 1 km operating between 100 kHz and 3.75 MHz. It would require 200 kg of 0.5 mm diameter copper wire (AWG 24)) to be lifted to and deployed in space. For aluminum, the mass would be about 100 kg. By optimizing the wire spacing the mass can be reduced to 80% of a simple radial-azimuthal arrangement. A relatively flat reflector (0.6 ≤ f/D ≤ 1.0) needs to be anchored at about 5 points from center to ring along 24 radii. Station-keeping CubeSats could serve as anchors. A total of about 100-120 anchors would be needed for an f/D = 1 reflector, adding 200-300 kg. to the mass of the reflector. It would be possible to carry several such reflectors into space in a single payload.The Deep Space Network is operated by the Jet Propulsion Laboratory, California Institute of Technology, under contract to the National Aeronautics and Space Administration.

  12. Effect of Size on Tensile Strength of Fine Polycrystalline Nickel Wires

    National Research Council Canada - National Science Library

    Rubenstein, Lester

    1966-01-01

    .... The tensile strength of recrystallized wires was diameter independent. The proportional limit stress of recrystallized wires was inversely related to power functions of wire diameter and grain size...

  13. The development of natural-draught cooling towers of prestressed wire-rope network construction of aerodynamic design

    International Nuclear Information System (INIS)

    Braun, R.; Jasch, E.

    1975-01-01

    Natural-draught cooling towers carried to a height of up to 200 m will be required for the dissipation of the residual heat from the thermal processes of large-capacity power stations to be erected in future. The structural problems involved in such large-size towers can be overcome by using prestressed wire-rope network construction. A structural concept is discussed which proposes to use a cooling tower shell constructed of a prestressed, planked wire-rope network of circular hyperbolic form carried by a spacer ring attached to the central mast. Comments are given on the ensuing problems of aerodynamics, stress-strength assessment, and erection. (orig.) [de

  14. A.c. susceptibility study of CaCl2 doped copper–zinc ferrite system

    Indian Academy of Sciences (India)

    Unknown

    The Curie temperature measurement was carried out by a.c. susceptibility and modified Loria-Sinha technique at lower humidity in summer (40% relative humidity) and at higher humidity in rainy season (93% relative humi- dity). It is observed that magnetic property like suscepti- bility is not affected by relative humidity.

  15. Magnetic wires in MEMS and bio-medical applications

    International Nuclear Information System (INIS)

    Barbic, Mladen

    2002-01-01

    Magnetic wires of appropriate design have special features making them useful to micro-electromechanical systems and bio-medical applications. Several applications that exploit the properties of magnetic wires are reviewed including: (a) a magnetic micro-manipulation technique that utilizes integrated micro-coils and magnetic micro-wires for localized positioning of micron-sized magnetic objects, (b) integrated micro-coil/micro-wire system operating as a micro-fluidic micro-motor, (c) mechanical tweezers using magneto-static interaction between two magnetic micro-wires, and (d) ultra-high gradient magnetic separation system based on porous membranes partially filled with magnetic wires

  16. From Beamline to Scanner with 225Ac

    Science.gov (United States)

    Robertson, Andrew K. H.; Ramogida, Caterina F.; Kunz, Peter; Rodriguez-Rodriguez, Cristina; Schaffer, Paul; Sossi, Vesna

    2016-09-01

    Due to the high linear energy transfer and short range of alpha-radiation, targeted radiation therapy using alpha-emitting pharmaceuticals that successfully target small disease clusters will kill target cells with limited harm to healthy tissue, potentially treating the most aggressive forms of cancer. As the parent of a decay chain with four alpha- and two beta-decays, 225Ac is a promising candidate for such a treatment. However, this requires retention of the entire decay chain at the target site, preventing the creation of freely circulating alpha-emitters that reduce therapeutic effect and increase toxicity to non-target tissues. Two major challenges to 225Ac pharmaceutical development exist: insufficient global supply, and the difficulty of preventing toxicity by retaining the entire decay chain at the target site. While TRIUMF works towards large-scale (C i amounts) production of 225Ac, we already use our Isotope Separation On-Line facility to provide small (< 1 mCi) quantities for in-house chemistry and imaging research that aims to improve and assess 225Ac radiopharmaceutical targeting. This presentation provides an overview of this research program and the journey of 225Ac from the beamline to the scanner. This research is funded by the Natural Sciences and Engineering Research Council of Canada.

  17. A comparison of a 'J' wire and a straight wire in successful antegrade cannulation of the superficial femoral artery

    International Nuclear Information System (INIS)

    Gay, D.A.T.; Edwards, A.J.; Puckett, M.A.; Roobottom, C.A.

    2005-01-01

    AIMS: To evaluate the success of two different types of wire in common use in their ability to successfully cannulate the superficial femoral artery (SFA) using antegrade puncture. METHODS: 50 consecutive patients in whom antegrade infra-inguinal intervention was planned, underwent common femoral arterial puncture and then cannulation with either a standard 3 mm 'J' wire or a floppy tipped straight wire (William Cook--Europe). The frequency with which each type of wire entered the SFA or profunda femoris artery without image guidance was recorded. Further analysis was also made of the success of manipulation of the wire into the SFA following profunda cannulation and the use of alternative guide wires. RESULTS: In 19 out of 25 (76%) patients the 'J' wire correctly entered the SFA without image guidance. Only 5 out of 25 (25%) of straight wires entered the SFA with the initial pass (p<0.0001). Following further manipulation with the same wire all except 1 'J' wire was successfully negotiated into the SFA. The same was true for only 9 of the remaining straight wires with 11 patients requiring an alternative guide wire. CONCLUSIONS: When performing antegrade cannulation of the SFA a 'J' wire is more likely to be successful than a straight guide wire

  18. Cockpit canopy shattering using exploding wire techniques

    International Nuclear Information System (INIS)

    Novac, B M; Smith, I R; Downs, P R; Marston, P; Fahey, D

    2007-01-01

    This paper presents the principal experimental results provided by a preliminary investigation into the possibility of using exploding wire (EW) techniques to shatter the plastic cockpit canopy of a modern jet aircraft. The data provided forms the basis for a qualitative understanding of the physics of interaction between the plasma produced by an EW and the surrounding elasto-plastic material in which the wire is embedded. To optimize the shock-wave 'clean cutting' effect, the significance of the material, the dimensions of the exploding wire and the amplitude of the current and voltage pulses are all considered. This leads to important conclusions concerning both the characteristics of the EW and the optimum arrangement of the electrical circuit, with the single most important optimization factor being the peak electrical power input to the EW, rather than the dissipated Joule energy. A full-scale system relevant to an actual cockpit canopy shattering is outlined and relevant results are presented and discussed

  19. Reusable Hot-Wire Cable Cutter

    Science.gov (United States)

    Pauken, Michael T.; Steinkraus, Joel M.

    2010-01-01

    During the early development stage of balloon deployment systems for missions, nichrome wire cable cutters were often used in place of pyro-actuated cutters. Typically, a nichrome wire is wrapped around a bundle of polymer cables with a low melting point and connected to a relay-actuated electric circuit. The heat from the nichrome reduces the strength of the cable bundle, which quickly breaks under a mechanical load and can thus be used as a release mechanism for a deployment system. However, the use of hand-made heated nichrome wire for cutters is not very reliable. Often, the wrapped nichrome wire does not cut through the cable because it either pulls away from its power source or does not stay in contact with the cable being cut. Because nichrome is not readily soldered to copper wire, unreliable mechanical crimps are often made to connect the nichrome to an electric circuit. A self-contained device that is reusable and reliable was developed to sever cables for device release or deployment. The nichrome wire in this new device is housed within an enclosure to prevent it from being damaged by handling. The electric power leads are internally connected within the unit to the nichrome wire using a screw terminal connection. A bayonet plug, a quick and secure method of connecting the cutter to the power source, is used to connect the cutter to the power leads similar to those used in pyro-cutter devices. A small ceramic tube [0.25-in. wide 0.5-in. long (.6.4-mm wide 13-mm long)] houses a spiraled nichrome wire that is heated when a cable release action is required. The wire is formed into a spiral coil by wrapping it around a mandrel. It is then laid inside the ceramic tube so that it fits closely to the inner surface of the tube. The ceramic tube provides some thermal and electrical insulation so that most of the heat generated by the wire is directed toward the cable bundle in the center of the spiral. The ceramic tube is cemented into an aluminum block, which

  20. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    supply (UPS) AC motor drives and other power sup systems, need to step-up the DC input voltage. increase the output voltage level in order requirements, DC-DC boost converter is used provide DC bus voltage for PWM inverters. Hence, conventional design always cascades DC and a separate DC-AC converter.

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...

  2. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered magnet. 886.4440 Section 886.4440 Food... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  3. Alternating current (AC) iontophoretic transport across human epidermal membrane: effects of AC frequency and amplitude.

    Science.gov (United States)

    Yan, Guang; Xu, Qingfang; Anissimov, Yuri G; Hao, Jinsong; Higuchi, William I; Li, S Kevin

    2008-03-01

    As a continuing effort to understand the mechanisms of alternating current (AC) transdermal iontophoresis and the iontophoretic transport pathways in the stratum corneum (SC), the objectives of the present study were to determine the interplay of AC frequency, AC voltage, and iontophoretic transport of ionic and neutral permeants across human epidermal membrane (HEM) and use AC as a means to characterize the transport pathways. Constant AC voltage iontophoresis experiments were conducted with HEM in 0.10 M tetraethyl ammonium pivalate (TEAP). AC frequencies ranging from 0.0001 to 25 Hz and AC applied voltages of 0.5 and 2.5 V were investigated. Tetraethyl ammonium (TEA) and arabinose (ARA) were the ionic and neutral model permeants, respectively. In data analysis, the logarithm of the permeability coefficients of HEM for the model permeants was plotted against the logarithm of the HEM electrical resistance for each AC condition. As expected, linear correlations between the logarithms of permeability coefficients and the logarithms of resistances of HEM were observed, and the permeability data were first normalized and then compared at the same HEM electrical resistance using these correlations. Transport enhancement of the ionic permeant was significantly larger than that of the neutral permeant during AC iontophoresis. The fluxes of the ionic permeant during AC iontophoresis of 2.5 V in the frequency range from 5 to 1,000 Hz were relatively constant and were approximately 4 times over those of passive transport. When the AC frequency decreased from 5 to 0.001 Hz at 2.5 V, flux enhancement increased to around 50 times over passive transport. While the AC frequency for achieving the full effect of iontophoretic enhancement at low AC frequency was lower than anticipated, the frequency for approaching passive diffusion transport at high frequency was higher than expected from the HEM morphology. These observations are consistent with a transport model of multiple

  4. Use of Kirschner wires with eyelets for tension band wiring of olecranon fractures.

    Science.gov (United States)

    Kim, Jin Young; Lee, Young Ho; Gong, Hyun Sik; Lee, Sang Lim; Lee, Sang Ki; Baek, Goo Hyun

    2013-09-01

    To evaluate the clinical and radiographic outcomes of tension band wiring of displaced olecranon fractures treated using Kirschner wires with eyelets to assess their clinical performance with respect to complications such as backing out of the K-wires, restriction of forearm rotation, and neurovascular injury. The authors retrospectively reviewed 44 patients treated for an isolated, displaced olecranon fracture and checked range of motion, postoperative pain, complications, and incidence of hardware removal. The mean follow-up period was 41 months (range, 26-73 mo). All fractures united, and anatomical reduction was achieved in all cases at final follow-up. Mean elbow flexion was 135° (range, 115° to 140°), and mean elbow extension was 4° (range, 0° to 15°). No pin migration, restriction of forearm rotation, or neurovascular injury occurred. Hardware removal was performed in 8 cases (18%). Compared to previous results with conventional Kirschner wires, no meaningful improvement in postoperative pain level or in the rate of hardware removal was observed. Tension band wiring using the pin studied produced excellent clinical and radiologic outcomes for the treatment of isolated, displaced Mayo type IIA and some type IIB olecranon fractures. The pin was effective in preventing the backing out of Kirschner wires and avoiding the complications associated with anterior cortical engagement of Kirschner wires, such as neurovascular injury or restriction of forearm rotation. Copyright © 2013 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  5. Modeling of Service-Drop Wires and Interior-Wiring Cables for Lightning Overvoltage Studies

    Science.gov (United States)

    Matsuura, Susumu; Noda, Taku; Nakamura, Masatoshi; Sakai, Hiroshi

    As the information society progresses, a variety of electronic appliances have come into wide use in common houses. If a lightning stroke causes faults or incorrect operations of these electronic appliances, a social economic loss is considered to be large. For this reason, the focus of lightning protection measures for distribution lines in Japan has expanded to include the low-voltage side of the distribution line in addition to the high-voltage side. In order to calculate lightning overvoltages at the low-voltage side, the surge characteristics of service-drop wires and interior-wiring cables have to be modeled accurately. First, this paper describes test results of the surge characteristics of service-drop wires and interior-wiring cables. The modal surge impedances and the propagation velocities of various service-drop wires and interior-wiring cables are obtained by the test. Based on the test results obtained, this paper proposes a modeling methodology of these wires and cables for accurate EMTP (Electro-Magnetic Transients Program) lightning overvoltage simulations. The proposed model is validated by comparing EMTP simulation results with field test results.

  6. Recent progress in BPSCCO wire fabrication and applications prototypes

    International Nuclear Information System (INIS)

    Kato, T.; Hayashi, K.; Hikata, T.

    1997-01-01

    A J c (77 K) of a 1,200 m long silver-sheathed bismuth-based wire has reached 10,000 A/cm 2 , as evaluated with a strict Ic criterion of 10 -14Ω circ m for overall wire cross-sectional area. One of the most important issues for J c enhancement is grain connectability. Differential technique of ZFC (zero field cooling) curves proved to be a simple and effective evaluation method for grain connection. The performance of application prototypes progressed greatly. Three typical examples were as follows; (1) Current leads of 2,000 A carrying capability have been implemented to NbTi bending magnets of superconducting synchrotron radiation facility of Sumitomo Electric, and have been stably operated for over one year from December 1993. (2) Two flexible cable conductors of 1 m-length, having I c (77 K) of 5,800 A (J c =12,000 A/cm 2 ) and 12,000 A (J c =11,000 A/cm 2 ), were fabricated with multilayer wound technique. (3) A 60 mm bore magnet, cooled with GM refrigerator down to 21 K, has stably generated 3 T without any cryogen. The size of this magnet was large enough for actual applications

  7. Quantum conductance in silicon quantum wires

    CERN Document Server

    Bagraev, N T; Klyachkin, L E; Malyarenko, A M; Gehlhoff, W; Ivanov, V K; Shelykh, I A

    2002-01-01

    The results of investigations of electron and hole quantum conductance staircase in silicon quantum wires are presented. The characteristics of self-ordering quantum wells of n- and p-types, which from on the silicon (100) surface in the nonequilibrium boron diffusion process, are analyzed. The results of investigations of the quantum conductance as the function of temperature, carrier concentration and modulation degree of silicon quantum wires are given. It is found out, that the quantum conductance of the one-dimensional channels is observed, for the first time, at an elevated temperature (T >= 77 K)

  8. Numerical Simulation of Wire-Coating

    DEFF Research Database (Denmark)

    Wapperom, Peter; Hassager, Ole

    1999-01-01

    A finite element program has been used to analyze the wire-coating process of an MDPE melt. The melt is modeled by a nonisothermal Carreau model. The emphasis is on predicting an accurate temperature field. Therefore, it is necessary to include the heat conduction in the metal parts. A comparison...... is made with the results of a simulation that models the heat conduction in the metal head by means of a Biot boundary condition. The influence of the wire velocity, inlet temperature and power-law index will be examined....

  9. Control of grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep M.; Chen, Zhe

    2010-01-01

    Over the last decade, distributed energy resources (DER) technology has undergone a fast development. Increased penetration of DER units and wide spread use of renewable energy sources challenge the entire architecture of traditional power system. Microgrid, characterizing higher flexibility...... and reliability, becomes an attractive candidate for the configuration of future electrical power system. This paper gives a brief review of grid interactive ac microgrid configurations. Control methods for power electronics interfaced DER units in grid interactive ac microgrids are discussed. In addition......, microgrid controls and power management strategies are presented. Future trends of microgrid are discussed pointing out how this concept can be a key to achieve a more intelligent and flexible AC grid....

  10. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  11. Superconducting three element synchronous ac machine

    International Nuclear Information System (INIS)

    Boyer, L.; Chabrerie, J.P.; Mailfert, A.; Renard, M.

    1975-01-01

    There is a growing interest in ac superconducting machines. Of several new concepts proposed for these machines in the last years one of the most promising seems to be the ''three elements'' concept which allows the cancellation of the torque acting on the superconducting field winding, thus overcoming some of the major contraints. This concept leads to a device of induction-type generator. A synchronous, three element superconducting ac machine is described, in which a room temperature, dc fed rotating winding is inserted between the superconducting field winding and the ac armature. The steady-state machine theory is developed, the flux linkages are established, and the torque expressions are derived. The condition for zero torque on the field winding, as well as the resulting electrical equations of the machine, are given. The theoretical behavior of the machine is studied, using phasor diagrams and assuming for the superconducting field winding either a constant current or a constant flux condition

  12. New Regimes of Implosions of Larger Sized Wire Arrays With and Without Modified Central Plane at 1.5-1.7 MA Zebra

    Science.gov (United States)

    Safronova, A. S.; Kantsyrev, V. L.; Esaulov, A. A.; Weller, M. E.; Shrestha, I.; Shlyaptseva, V. V.; Stafford, A.; Keim, S. F.; Petkov, E. E.; Lorance, M.; Chuvatin, A. S.; Coverdale, C. A.; Jones, B.

    2013-10-01

    The recent experiments at 1.5-1.7 MA on Zebra at UNR with larger sized planar wires arrays (compared to the wire loads at 1 MA current) have demonstrated higher linear radiation yield and electron temperatures as well as advantages of better diagnostics access to observable plasma regions. Such multi-planar wire arrays had two outer wire planes from mid-Z material to create a global magnetic field (gmf) and mid-Z plasma flow between them. Also, they included a modified central plane with a few Al wires at the edges to influence gmf and to create Al plasma flow in the perpendicular direction. The stationary shock waves which existed over tens of ns on shadow images and the early x-ray emissions before the PCD peak on time-gated spectra were observed. The most recent experiments with similar loads but without the central wires demonstrated a very different regime of implosion with asymmetrical jets and no precursor formation. This work was supported by NNSA under DOE Cooperative Agreement DE-NA0001984 and in part by DE-FC52-06NA27616. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Company, for the U.S. Department of Energy's National Nuclear Security Administration under Contract DE-AC04-94AL85000.

  13. Multifilament Cable Wire versus Conventional Wire for Sternal Closure in Patients Undergoing Major Cardiac Surgery.

    Science.gov (United States)

    Oh, You Na; Ha, Keong Jun; Kim, Joon Bum; Jung, Sung-Ho; Choo, Suk Jung; Chung, Cheol Hyun; Lee, Jae Won

    2015-08-01

    Stainless steel wiring remains the most popular technique for primary sternal closure. Recently, a multifilament cable wiring system (Pioneer Surgical Technology Inc., Marquette, MI, USA) was introduced for sternal closure and has gained wide acceptance due to its superior resistance to tension. We aimed to compare conventional steel wiring to multifilament cable fixation for sternal closure in patients undergoing major cardiac surgery. Data were collected retrospectively on 1,354 patients who underwent sternal closure after major cardiac surgery, using either the multifilament cable wiring system or conventional steel wires between January 2009 and October 2010. The surgical outcomes of these two groups of patients were compared using propensity score matching based on 18 baseline patient characteristics. Propensity score matching yielded 392 pairs of patients in the two groups whose baseline profiles showed no significant differences. No significant differences between the two groups were observed in the rates of early mortality (2.0% vs. 1.3%, p=0.578), major wound complications requiring reconstruction (1.3% vs. 1.3%, p>0.99), minor wound complications (3.6% vs. 2.0%, p=0.279), or mediastinitis (0.8% vs. 1.0%, p=1.00). Patients in the multifilament cable group had fewer sternal bleeding events than those in the conventional wire group, but this tendency was not statistically significant (4.3% vs. 7.4%, p=0.068). The surgical outcomes of sternal closure using multifilament cable wires were comparable to those observed when conventional steel wires were used. Therefore, the multifilament cable wiring system may be considered a viable option for sternal closure in patients undergoing major cardiac surgery.

  14. Comparison of subtransverse process wiring and sublaminar wiring in the treatment of idiopathic thoracic scoliosis.

    Science.gov (United States)

    Akmeşe, Ramazan; Kemal Us, Ali

    2013-04-01

    A retrospective study. The objectives of this study were to show the advantages of an alternative segmental spinal instrumentation technique, termed subtransverse process wiring, and compare it with a sublaminar wiring technique in the treatment of idiopathic thoracic scoliosis. High rates of neurological complications and the need for high experience limit the use of the sublaminar wiring technique, although it is an effective segmental spinal instrumentation technique in the treatment of scoliosis. This is the first study to correlate sublaminar wiring and subtransverse process wiring techniques clinically. In a retrospective study, 64 patients with idiopathic thoracic scoliosis were chosen randomly. Nineteen patients were treated with subtransverse process wires (group A), and 45 patients were treated with sublaminar wires (group B). The mean follow-up period was 50.9 months (25 to 90 mo) in group A and 57.9 months (26 to 108 mo) in group B. The average deformity correction was 26.5 degrees (52.9%) in group A and 28.9 degrees (54.1%) in group B. The average correction loss was 2.9 degrees (17.2%) in group A and 6.4 degrees (27%) in group B. None of the patients developed neurological complications in group A. In group B, 5 (11.1%) intraoperative dural tears, 4 (8.9%) neurological deficits, and 8 (14.4%) transient dysesthesia syndromes were seen. The average operation time was 3.6 hours (3 to 4 h) in group A and 4.9 hours (3.75 to 8 h) in group B. The average replacement of blood (erythrocyte suspension) was 2.9 U (2 to 5 U) in group A and 3.1 U (2 to 6 U) in group B. Sublaminar wiring is a time-consuming technique with high risks of neurological complications, whereas subtransverse process wiring is an easy and neurologically safe method, which maintains effective deformity correction and stability of the correction.

  15. Multifilament Cable Wire versus Conventional Wire for Sternal Closure in Patients Undergoing Major Cardiac Surgery

    Directory of Open Access Journals (Sweden)

    You Na Oh

    2015-08-01

    Full Text Available Background: Stainless steel wiring remains the most popular technique for primary sternal closure. Recently, a multifilament cable wiring system (Pioneer Surgical Technology Inc., Marquette, MI, USA was introduced for sternal closure and has gained wide acceptance due to its superior resistance to tension. We aimed to compare conventional steel wiring to multifilament cable fixation for sternal closure in patients undergoing major cardiac surgery. Methods: Data were collected retrospectively on 1,354 patients who underwent sternal closure after major cardiac surgery, using either the multifilament cable wiring system or conventional steel wires between January 2009 and October 2010. The surgical outcomes of these two groups of patients were compared using propensity score matching based on 18 baseline patient characteristics. Results: Propensity score matching yielded 392 pairs of patients in the two groups whose baseline profiles showed no significant differences. No significant differences between the two groups were observed in the rates of early mortality (2.0% vs. 1.3%, p=0.578, major wound complications requiring reconstruction (1.3% vs. 1.3%, p>0.99, minor wound complications (3.6% vs. 2.0%, p=0.279, or mediastinitis (0.8% vs. 1.0%, p=1.00. Patients in the multifilament cable group had fewer sternal bleeding events than those in the conventional wire group, but this tendency was not statistically significant (4.3% vs. 7.4%, p=0.068. Conclusion: The surgical outcomes of sternal closure using multifilament cable wires were comparable to those observed when conventional steel wires were used. Therefore, the multifilament cable wiring system may be considered a viable option for sternal closure in patients undergoing major cardiac surgery.

  16. Magnetic anisotropy and anisotropic ballistic conductance of thin magnetic wires

    International Nuclear Information System (INIS)

    Sabirianov, R.

    2006-01-01

    The magnetocrystalline anisotropy of thin magnetic wires of iron and cobalt is quite different from the bulk phases. The spin moment of monatomic Fe wire may be as high as 3.4 μ B , while the orbital moment as high as 0.5 μ B . The magnetocrystalline anisotropy energy (MAE) was calculated for wires up to 0.6 nm in diameter starting from monatomic wire and adding consecutive shells for thicker wires. I observe that Fe wires exhibit the change sign with the stress applied along the wire. It means that easy axis may change from the direction along the wire to perpendicular to the wire. We find that ballistic conductance of the wire depends on the direction of the applied magnetic field, i.e. shows anisotropic ballistic magnetoresistance. This effect occurs due to the symmetry dependence of the splitting of degenerate bands in the applied field which changes the number of bands crossing the Fermi level. We find that the ballistic conductance changes with applied stress. Even for thicker wires the ballistic conductance changes by factor 2 on moderate tensile stain in our 5x4 model wire. Thus, the ballistic conductance of magnetic wires changes in the applied field due to the magnetostriction. This effect can be observed as large anisotropic BMR in the experiment

  17. Measuring Social carrying Capacity: An Exploratory Study

    OpenAIRE

    López-Bonilla, Jesús Manuel; López-Bonilla, Luis Miguel

    2007-01-01

    The tourist carrying capacity commands a growing interest given that it is closely linked with sustainable tourist development. The justification of the utility of this concept is given by means of a simple and efficient methodological proposal, by analysing the social carrying capacity. To this end, an empirical application is carried out in the Western Andalusia. In some of the cases analysed, the satisfaction of the tourist is found to decline when the levels of the tourist use are higher ...

  18. EDITORIAL More than a wire More than a wire

    Science.gov (United States)

    Demming, Anna

    2010-10-01

    Nanowires are the natural evolution of the connections in circuits when scaled down to nanometre sizes. On closer inspection, of course, the role of nanowires in developing new technologies is much more than just a current-bearing medium. By sizing the diameters of these objects down to the nanoscale, their properties become increasingly sensitive to factors such as the gas composition, temperature and incident light of their surrounding environment, as well as defects and variations in diameter. What becomes important in modern electronics innovations is not just what is connected, but how. Nanowires had already begun to attract the attention of researchers in the early 1990s as advances in imaging and measurement devices invited researchers to investigate the properties of these one-dimensional structures [1, 2]. This interest has sparked ingenious ways of fabricating nanowires such as the use of a DNA template. A collaboration of researchers at Louisiana Tech University in the US hs provided an overview of various methods to assemble conductive nanowires on a DNA template, including a summary of different approaches to stretching and positioning the templates [3]. Work in this area demonstrates a neat parallel for the role of DNA molecules as the building blocks of life and the foundations of nanoscale device architectures. Scientists at HP Labs in California are using nanowires to shrink the size of logic arrays [4]. One aspect of electronic interconnects that requires particular attention at nanoscale sizes is the effect of defects. The researchers at HP Labs demonstrate that their approach, which they name FPNI (field-programmable nanowire interconnect), is extremely tolerant of the high defect rates likely to be found in these nanoscale structures, and allows reduction in size and power without significantly sacrificing the clock rate. Another issue in scaling down electronics is the trend for an increasing resistivity with decreasing wire width. Researchers

  19. Evolution of cementite morphology in pearlitic steel wire during wet wire drawing

    DEFF Research Database (Denmark)

    Zhang, Xiaodan; Godfrey, Andrew; Hansen, Niels

    2010-01-01

    decreasing from 19 nm (ε = 0) to 2 nm (ε = 3.7) in correspondence with the reduction in wire diameter. The deformation of the cementite is strongly related to plastic deformation in the ferrite, with coarse slip steps, shear bands and cracks in the cementite plates/particles observed parallel to either {110...... microscope observations show that cementite plates become increasingly aligned with the wire axis as the drawing strain is increased. Measurements in the transmission electron microscope show that the cementite deforms plastically during wire drawing , with the average thickness of the cementite plates...

  20. Load-Deflection and Friction Properties of PEEK Wires as Alternative Orthodontic Wires

    OpenAIRE

    Tada, Yoshifumi; Hayakawa, Tohru; Nakamura, Yoshiki

    2017-01-01

    Polyetheretherketone (PEEK) is now attracting attention as an alternative to metal alloys in the dental field. In the present study, we evaluated the load-deflection characteristics of PEEK wires in addition to their frictional properties. Three types of PEEK wires are used: two sizes of rectangular shape, 0.016 ? 0.022 in2 and 0.019 ? 0.025 in2 (19-25PEEK), and rounded shape, diameter 0.016 in (16PEEK). As a control, Ni-Ti orthodontic wire, diameter 0.016 in, was used. The three-point bendin...

  1. Measurements of AC losses in oxide superconducting tapes and coils; Sankabutsu chodendo senzai oyobi koiru no koryu sonshitsu shokutei

    Energy Technology Data Exchange (ETDEWEB)

    Nakagami, M.; Watabe, K.; Kawagoe, A.; Sumiyoshi, F. [Kagoshima Univ., Kagoshima (Japan); Hayashi, H. [Kyushu Electric Power Co., Inc., Fukuoka (Japan)

    1999-06-07

    The application to the electric power equipment is expected oxide superconductivity wire rod, and short length linearity under the operating condition and quantitative evaluation of the ac loss in coil shape are important. Until now, we propose the pointing vector method as loss measuring method of the short length linear sample, and the equipment has been produced experimentally. However, in this measuring method, it was small within the signal of electric field with 10{sup -4}-10{sup -6} at loss component ratio, and there was a problem that the sensitometry was not sufficiently taken, since moreover, they are about number 10nV and weak signal very. Then, noise counterplan method in the measuring circuit, etc. were examined in order to improve the sensitometry this time. In addition, the examination of loss measuring method of the wire rod as coil shape is also reported, because it was done. (NEDO)

  2. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  3. Preliminary study on AC superconducting machines

    International Nuclear Information System (INIS)

    Yamamoto, M.; Ishigohka, T.; Shimohka, T.; Mizukami, N.; Yamaguchi, M.

    1988-01-01

    This paper describes the issues involved in developing AC superconducting machines. In the first phase, as a preliminary experiment, a 4kVa AC superconducting coil which employs 100A class 50/60Hz superconductors is made and tested. And, in the second phase, as an extension of the 4kVa coil, a model superconducting transformer is made and examined. The transformer has a novel quench protection system with an auxiliary coil only in the low voltage side. The behavior of the overcurrent protection system is confirmed

  4. AC conductivity for a holographic Weyl semimetal

    Energy Technology Data Exchange (ETDEWEB)

    Grignani, Gianluca; Marini, Andrea; Peña-Benitez, Francisco; Speziali, Stefano [Dipartimento di Fisica e Geologia, Università di Perugia,I.N.F.N. Sezione di Perugia,Via Pascoli, I-06123 Perugia (Italy)

    2017-03-23

    We study the AC electrical conductivity at zero temperature in a holographic model for a Weyl semimetal. At small frequencies we observe a linear dependence in the frequency. The model shows a quantum phase transition between a topological semimetal (Weyl semimetal phase) with a non vanishing anomalous Hall conductivity and a trivial semimetal. The AC conductivity has an intermediate scaling due to the presence of a quantum critical region in the phase diagram of the system. The phase diagram is reconstructed using the scaling properties of the conductivity. We compare with the experimental data of https://www.doi.org/10.1103/PhysRevB.93.121110 obtaining qualitative agreement.

  5. STRUCTURE AND CHARACTERISTICS OF PATENTED HIGH-CARBON WIRE

    Directory of Open Access Journals (Sweden)

    A. Ju. Borisenko

    2011-01-01

    Full Text Available The influence of bainite structure on mechanical characteristics of wire of steel 80 after patenting is studied. The quantity and structure state of bainite, providing high complex of mechanical characteristics of high-carbon wire, is determined.

  6. Spectroscopic properties of colloidal indium phosphide quantum wires

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Lin-Wang; Wang, Fudong; Yu, Heng; Li, Jingbo; Hang, Qingling; Zemlyanov, Dmitry; Gibbons, Patrick C.; Wang, Lin-Wang; Janes, David B.; Buhro, William E.

    2008-07-11

    Colloidal InP quantum wires are grown by the solution-liquid-solid (SLS) method, and passivated with the traditional quantum dots surfactants 1-hexadecylamine and tri-n-octylphosphine oxide. The size dependence of the band gaps in the wires are determined from the absorption spectra, and compared to other experimental results for InP quantum dots and wires, and to the predictions of theory. The photoluminescence behavior of the wires is also investigated. Efforts to enhance photoluminescence efficiencies through photochemical etching in the presence of HF result only in photochemical thinning or photo-oxidation, without a significant influence on quantum-wire photoluminescence. However, photo-oxidation produces residual dot and rod domains within the wires, which are luminescent. The results establish that the quantum-wire band gaps are weakly influenced by the nature of the surface passivation, and that colloidal quantum wires have intrinsically low photoluminescence efficiencies.

  7. Dynamic resistance of a high-T c coated conductor wire in a perpendicular magnetic field at 77 K

    Science.gov (United States)

    Jiang, Zhenan; Toyomoto, Ryuki; Amemiya, Naoyuki; Zhang, Xingyou; Bumby, Chris W.

    2017-03-01

    Superconducting high-T c coated conductor (CC) wires comprise a ceramic thin film with a large aspect ratio. This geometry can lead to significant dissipative losses when exposed to an alternating magnetic field. Here we report experimental measurements of the ‘dynamic resistance’ of commercially available SuperPower and Fujikura CC wires in an AC perpendicular field. The onset of dynamic resistance occurs at a threshold field amplitude, which is determined by the total DC transport current and the penetration field of the conductor. We show that the field-dependence of the normalised magnetisation loss provides an unambiguous value for this threshold field at zero transport current. From this insight we then obtain an expression for the dynamic resistance in perpendicular field. This approach implies a linear relationship between dynamic resistance and applied field amplitude, and also between threshold field and transport current and this is consistent with our experimental data. The analytical expression obtained yields values that closely agree with measurements obtained across a wide range of frequencies and transport currents, and for multiple CC wires produced by different wire manufacturers and with significantly differing dimensions and critical currents. We further show that at high transport currents, the measured DC resistance includes an additional nonlinear term which is due to flux-flow resistance incurred by the DC transport current. This occurs once the field-dependent critical current of the wire falls below the DC transport current for part of each field cycle. Our results provide an effective and simple approach to calculating the dynamic resistance of a CC wire, at current and field magnitudes consistent with those expected in superconducting machines.

  8. The Effect of Wire Dimension, Type and Thickness of Coating Layer on Friction of Coated Stainless-Steel Arch Wires

    Directory of Open Access Journals (Sweden)

    Ahmed Abdulhussain Abbas

    2018-03-01

    Full Text Available Background/Purpose: Esthetic coated arch wires are the desired types to match esthetic brackets in the clinical orthodontics, but the presence of coating layer is greatly affect friction during sliding mechanics. The aims of this study were to evaluate the effect of total wire dimension with the type and thickness of coating layer on friction of coated stainless-steel wires. Methods: The sample of this study consisted of 140 segments of coated stainless-steel arch wires involving two wire dimensions (0.016 × 0.022 inch and 0.019 × 0.025 inch. The samples were supplied from seven companies (DB, RMO, TP, DANY, G&H, Highland and Hubit and the uncoated control samples were supplied from IOS company. Wire dimensions and thickness of coating layer were measured by the metallurgical light incident microscope and the static frictional force was measured using pulling the wire through set of ceramic brackets by the universal testing machine. The data were then statistically analyzed using ANOVA tests. Results: Generally measured wire dimensions do not match the stated dimensions by the manufacturer. The frictional forces of coated wires differ from uncoated control being higher in the labially coated wires and lesser in the fully Teflon coated wires owing to differences in the wire dimension, thickness of coating layer, and physical properties of coating materials. Conclusion: when tested in vitro, Teflon fully coated wires produce the least amount of friction.

  9. Bivalve carrying capacity in coastal ecosystems

    NARCIS (Netherlands)

    Dame, R.F.; Prins, T.C.

    1998-01-01

    carrying capacity of suspension feeding bivalves in 11 coastal and estuarine ecosystems is examined. Bivalve carrying capacity is defined in terms of water mass residence time, primary production time and bivalve clearance time. Turnover times for the 11 ecosystems are compared both two and three

  10. Calculations on the current density and the voltage-current relation under a.c. conditions of filaments

    NARCIS (Netherlands)

    Hartmann, R.A.; Dijkstra, D.; van Beckum, F.P.H.; van de Klundert, L.J.M.

    1989-01-01

    Technical applications of multifilamentary wires indicate that filaments are used in complex magnetic fields (a combination of non-parallel a.c./d.c. transverse and rotating fields) carrying an a.c./d.c. transport current of various frequency. Furthermore, due to technical manufacturing processes

  11. FY 1998 result report on development of superconductive power application technologies. Pt. 1. Research and development of superconductive wire materials / Research of a total system / Research and development of a freezing system / Demonstration tests; 1998 nendo chodendo denryoku oyo gijutsu kaihatsu. 1. Chodendo senzai no kenkyu kaihatsu, chodendo hatsudenki no kenkyu kaihatsu, total system no kenkyu, reito system no kenkyu kaihatsu, jissho shiken

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    Superconductive technologies are introduced into electric power devices for attempts of achieving higher stabilization, density and efficiency, as well as size and weight reduction and improvement in performance of the devices. The project has been worked on since fiscal 1998 as part of the New Sunshine Project. Fiscal 1998 being the eleventh year has taken the following subjects as the research promotion policies: establishment of plans targeted at accomplishment of the goals of the project; adequate and reliable implementation of verification of technological assignments; and steady and efficient demonstration tests. Subsequent to the previous year during which site demonstration tests were completed on a low-speed responsive model machine, the site demonstration test has begun on the ultra high-speed responsive model machine as the final stage of the project. The ultra high-speed responsive model machine was coupled with a freezing system and a load synchronizing machine, and different kinds of test were carried out where good results were obtained. Researches were conducted on characteristics improvement and device element technologies aimed at achieving the practical application level by utilizing the respective features of AC metal-based wires and oxide-based wires, where sound results were obtained. Also in an improved freezing system, valuable data were attained as part of establishing the basic technologies for a superconductive power generation system. (NEDO)

  12. The Concept of Carrying Capacity in Tourism

    Directory of Open Access Journals (Sweden)

    Josef Zelenka

    2014-05-01

    Full Text Available Carrying capacity is often pragmatically, theoretically as well as purely intuitively considered as a concept in the context of tourism sustainability. The carrying capacity application has the greatest potential in protected areas, in frequently visited cultural and natural attractions, and in relation to sustaining of the lifestyle of the local community and tourism destination potential in general. Despite its importance, partial applications, determination of basic theoretical principles, and specifying connection to the other theoretical concepts in tourism (particularly destination life cycle, LAC concept, visitors management, there still is a rightful opinion of some authors suggesting that there is no consistent theory of tourism carrying capacity. This theory would be the base for sophisticated practical carrying capacity applications. This paper is therefore focused on introduction of the theoretical concept of carrying capacity, which can be discussed and possibly further elaborated.

  13. Bandwidth improvement for germanium photodetector using wire bonding technology.

    Science.gov (United States)

    Chen, Guanyu; Yu, Yu; Deng, Shupeng; Liu, Lei; Zhang, Xinliang

    2015-10-05

    We demonstrate an ultrahigh speed germanium photodetector by introducing gold wires into the discrete ground electrodes with standard wire bonding technology. To engineer the parasitic parameter, the physical dimension of the gold wire used for wire bonding is specially designed with an inductance of about 450 pH. Simulation and experimental results show that the bandwidth of the photodetector can be effectively extended from less than 30 GHz to over 60 GHz.

  14. Signals analysis of fluxgate array for wire rope defaults

    International Nuclear Information System (INIS)

    Gu Wei; Chu Jianxin

    2005-01-01

    In order to detecting the magnetic leakage fields of the wire rope defaults, a transducer made up of the fluxgate array is designed, and a series of the characteristic values of wire rope defaults signals are defined. By processing the characteristic signals, the LF or LMA of wire rope are distinguished, and the default extent is estimated. The experiment results of the new method for detecting the wire rope faults are introduced

  15. MDT WIRE TENSION MEASUREMENT USING AN ELECTROSTATIC METHOD

    CERN Document Server

    Balla, A; Esposito, B; Felici, G; Nedosekin, A; Ponzio, B; Russo, V; Spitalieri, M C

    1998-01-01

    An automated system to measure wire tension in MDT tubes is presented.The method uses electrostatic forces between wire and tube to excite mechanical oscillation around the wire harmonic resonance. A LC oscillating circuit is used to measure capacitance variation due towire oscillation. Wire tension is determined by the frequency at which the wirereaches the maximum oscillation amplitude. Both the excitation and measuring circuits are controlled by a computer.

  16. Electricity: Residential Wiring. Secondary Schools. Curriculum Guide.

    Science.gov (United States)

    Trust Territory of the Pacific Islands Dept. of Education, Saipan.

    This curriculum guide on residential wiring for secondary students is one of six developed for inservice teachers at Marianas High School in Saipan. The guide provides the rationale, description, goals, and objectives of the program; the program of studies and performance objectives by levels; samples of lesson plans for effective delivery of…

  17. Building Trades. Carpentry, Electrical Wiring, Plumbing.

    Science.gov (United States)

    Missouri Univ., Columbia. Instructional Materials Lab.

    This curriculum guide contains 21 units of self-paced, self-contained instructional materials in the complete building trades curriculum. It is divided into vocational areas of carpentry, electrical wiring, and plumbing. The purpose of the curriculum is to provide minimum skills for disadvantaged and handicapped students entering mainstream…

  18. Description of CBETA magnet tuning wire holders

    Energy Technology Data Exchange (ETDEWEB)

    Brooks, S. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-07-19

    A non-­magnetic insert will be placed directly inside the permanent magnet blocks in every CBETA Halbach magnet in order to hold a set of iron “tuning wires”. These wires have various lengths around the perimeter of the aperture in order to cancel multipole field errors from the permanent magnet blocks.

  19. Selective deposition by hot wire ALD

    NARCIS (Netherlands)

    Kovalgin, Alexey Y.; Yang, Mengdi; Aarnink, Antonius A.I.; Wolters, Robertus A.M.

    2018-01-01

    A method for selectively depositing a metal nlm onto a substrate is disclosed. In particular, the method comprising nowing a metal precursor onto the substrate and nowing a non-metal precursor onto the substrate,while contacting the non-metal precursor with a hot wire. Specincally, a reaction

  20. Studying superconducting Nb$_{3}$Sn wire

    CERN Multimedia

    AUTHOR|(CDS)2099575

    2015-01-01

    Studying superconducting Nb$_{3}$Sn wire. From the current experience from LHC and HL-LHC we know that the performance requirements for Nb$_{3}$Sn conductor for future circular collider are challenging and should exceed that of present state-of-the-art materials.

  1. Studying superconducting Nb3Sn wire

    CERN Multimedia

    AUTHOR|(CDS)2099575

    2015-01-01

    Studying superconducting Nb3Sn wire. From the current experience from LHC and HL-LHC we know that the performance requirements for Nb3Sn conductor for future circular collider are challenging and should exceed that of present state-of-the-art materials.

  2. Two-wire Interface for Digital Microphones

    NARCIS (Netherlands)

    Groothedde, Wouter; Klumperink, Eric A.M.; Nauta, Bram; Eschauzier, Rudolphe Gustave Hubertus; van Rijn, Nico

    2003-01-01

    A two-wire interface for a digital microphone circuit includes a power line and a ground line. The interface utilizes the ground line as a "voltage active line" to transmit both clock and data signals between the digital microphone circuit and a receiving circuit. The digital microphone circuit

  3. Two-Wire interface for digital microphones

    NARCIS (Netherlands)

    Groothedde, Wouter; Klumperink, Eric A.M.; Nauta, Bram; Eschauzier, Rudolphe Gustave Hubertus; van Rijn, Nico

    2005-01-01

    A two-wire interface for a digital microphone circuit includes a power line and a ground line. The interface utilizes the ground line as a "voltage active line" to transmit both clock and data signals between the digital microphone circuit and a receiving circuit. The digital microphone circuit

  4. First thin AC-coupled silicon strip sensors on 8-inch wafers

    Energy Technology Data Exchange (ETDEWEB)

    Bergauer, T., E-mail: thomas.bergauer@oeaw.ac.at [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Dragicevic, M.; König, A. [Institute of High Energy Physics of the Austrian Academy of Sciences, Nikolsdorfer Gasse 18, 1050 Wien (Vienna) (Austria); Hacker, J.; Bartl, U. [Infineon Technologies Austria AG, Siemensstrasse 2, 9500 Villach (Austria)

    2016-09-11

    The Institute of High Energy Physics (HEPHY) in Vienna and the semiconductor manufacturer Infineon Technologies Austria AG developed a production process for planar AC-coupled silicon strip sensors manufactured on 200 μm thick 8-inch p-type wafers. In late 2015, the first wafers were delivered featuring the world's largest AC-coupled silicon strip sensors. Detailed electrical measurements were carried out at HEPHY, where single strip and global parameters were measured. Mechanical studies were conducted and the long-term behavior was investigated using a climate chamber. Furthermore, the electrical properties of various test structures were investigated to validate the quality of the manufacturing process.

  5. Multi-phase AC/AC step-down converter for distribution systems

    Energy Technology Data Exchange (ETDEWEB)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  6. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles

    Directory of Open Access Journals (Sweden)

    Tainá CC Monte

    2014-12-01

    Full Text Available Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. : ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1, but the same was not observed for ac8 (1.2:1. The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male and distance from the anus to the rear end (female compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  7. Brazilian Angiostrongylus cantonensis haplotypes, ac8 and ac9, have two different biological and morphological profiles.

    Science.gov (United States)

    Monte, Tainá C C; Gentile, Rosana; Garcia, Juberlan; Mota, Ester; Santos, Jeannie N; Maldonado Júnior, Arnaldo

    2014-12-01

    Angiostrongylus cantonensis is the etiologic agent of eosinophilic meningoencephalitis in humans. Cases have been recorded in many parts of the world, including Brazil. The aim of this study was to compare the differences in the biology and morphology of two different Brazilian haplotypes of A. cantonensis: ac8 and ac9. A significantly larger number of L1 larvae eliminated in the faeces of rodents at the beginning of the patent period was observed for ac9 haplotype and compared to the total of L1 larvae eliminated, there was a significant difference between the two haplotypes. The ac9 haplotype showed a significant difference in the proportion of female and male specimens (0.6:1), but the same was not observed for ac8 (1.2:1). The morphometric analysis showed that male and female specimens isolated from ac8 haplotype were significantly larger with respect to body length, oesophagus length, spicule length (male) and distance from the anus to the rear end (female) compared to specimens from ac9. The morphological analysis by light microscopy showed little variation in the level of bifurcations at the lateral rays in the right lobe of the copulatory bursa between the two haplotypes. The biological, morphological and morphometric variations observed between the two haplotypes agree with the observed variation at the molecular level using the cytochrome oxidase subunit I marker and reinforce the possible influence of geographical isolation on the development of these haplotypes.

  8. PEEK (polyether-ether-ketone)-coated nitinol wire: Film stability for biocompatibility applications

    International Nuclear Information System (INIS)

    Sheiko, Nataliia; Kékicheff, Patrick; Marie, Pascal; Schmutz, Marc; Jacomine, Leandro; Perrin-Schmitt, Fabienne

    2016-01-01

    Highlights: • A thin (12 μm) homogeneous PEEK film without any defects or voids is deposited on NiTi wires. • The coating remains stable in biological environment with negligible Ni ion release and no cytotoxicity. • Large pressure (>2 GPa) can only disrupt the coating film as shown by nanoscratch tests. • Coated spring wires sustain mechanical stress in continuous cycles of axial compression/stretching for >7 million cycles. - Abstract: High quality biocompatible poly-ether-ether-ketone (PEEK) coatings were produced on NiTi shape memory alloy wires using dipping deposition from colloidal aqueous PEEK dispersions after substrate surface treatment. The surface morphology and microstructure were investigated by Scanning Electron Microscopy at every step of the process from the as-received Nitinol substrate to the ultimate PEEK-coated NiTi wire. Nanoscratch tests were carried out to access the adhesive behavior of the polymer coated film to the NiTi. The results indicate that the optimum process conditions in cleaning, chemical etching, and electropolishing the NiTi, were the most important and determining parameters to be achieved. Thus, high quality PEEK coatings were obtained on NiTi wires, straight or curved (even with a U-shape) with a homogeneous microstructure along the wire length and a uniform thickness of 12 μm without any development of cracks or the presence of large voids. The biocompatibility of the PEEK coating film was checked in fibrobast cultured cells. The coating remains stable in biological environment with negligible Ni ion release, no cytotoxicity, and no delamination observed with time.

  9. PEEK (polyether-ether-ketone)-coated nitinol wire: Film stability for biocompatibility applications

    Energy Technology Data Exchange (ETDEWEB)

    Sheiko, Nataliia [Institut Charles Sadron, C.N.R.S. UPR 22, Université de Strasbourg, 23 rue du Loess, BP 84047, 67034 Strasbourg Cedex 2 (France); Kékicheff, Patrick, E-mail: patrick.kekicheff@ics-cnrs.unistra.fr [Institut Charles Sadron, C.N.R.S. UPR 22, Université de Strasbourg, 23 rue du Loess, BP 84047, 67034 Strasbourg Cedex 2 (France); Marie, Pascal; Schmutz, Marc; Jacomine, Leandro [Institut Charles Sadron, C.N.R.S. UPR 22, Université de Strasbourg, 23 rue du Loess, BP 84047, 67034 Strasbourg Cedex 2 (France); Perrin-Schmitt, Fabienne [Faculté de Médecine, INSERM, UMR-S 1121, “Biomaterials and Bioengineering”, Université de Strasbourg, 11 rue Humann, 67085 Strasbourg Cedex (France)

    2016-12-15

    Highlights: • A thin (12 μm) homogeneous PEEK film without any defects or voids is deposited on NiTi wires. • The coating remains stable in biological environment with negligible Ni ion release and no cytotoxicity. • Large pressure (>2 GPa) can only disrupt the coating film as shown by nanoscratch tests. • Coated spring wires sustain mechanical stress in continuous cycles of axial compression/stretching for >7 million cycles. - Abstract: High quality biocompatible poly-ether-ether-ketone (PEEK) coatings were produced on NiTi shape memory alloy wires using dipping deposition from colloidal aqueous PEEK dispersions after substrate surface treatment. The surface morphology and microstructure were investigated by Scanning Electron Microscopy at every step of the process from the as-received Nitinol substrate to the ultimate PEEK-coated NiTi wire. Nanoscratch tests were carried out to access the adhesive behavior of the polymer coated film to the NiTi. The results indicate that the optimum process conditions in cleaning, chemical etching, and electropolishing the NiTi, were the most important and determining parameters to be achieved. Thus, high quality PEEK coatings were obtained on NiTi wires, straight or curved (even with a U-shape) with a homogeneous microstructure along the wire length and a uniform thickness of 12 μm without any development of cracks or the presence of large voids. The biocompatibility of the PEEK coating film was checked in fibrobast cultured cells. The coating remains stable in biological environment with negligible Ni ion release, no cytotoxicity, and no delamination observed with time.

  10. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  11. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    intuition and reason, not by perception and induction'. On the Platonist view, because sentences cannot have either spatial or temporal location, they cannot have material properties either. This timeless and 'spaceless' nature of sentences Katz and Postal (1989:7) illustrate with reference http://spilplus.journals.ac.za/ ...

  12. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  13. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    in general terms,. ° what does Gutt see as significant conceptual consequences of his work? Needless to say, the framework for this talk will be Sperber and. Wilson's relevance theory of verbal communication, which was sketched in yesterday's contribution by Melinda Sinclair. Within http://spilplus.journals.ac.za/ ...

  14. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  15. Modeling of long High Voltage AC Underground

    DEFF Research Database (Denmark)

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to dat...

  16. Second VAMAS a.c. loss measurement intercomparison: magnetization measurement of low-frequency (hysteretic) a.c. loss in NbTi multifilamentary strands

    Science.gov (United States)

    Collings, E. W.; Sumption, M. D.; Itoh, K.; Wada, H.; Tachikawa, K.

    The results of the 2 nd VAMAS measurement intercomparison program on low-frequency (hysteretic) a.c. loss are presented and discussed. Two sets of multifilamentary NbTi strands (Set No. 1: copper matrix, fil. diams 0.5, 1, 3, and 12 μm; Set No. 2: cupronickel matrix, fil. diams 0.4, 0.5, and 1 μm) were subjected to interlaboratory testing. In an initial series of tests, samples in various forms (e.g. wire bundles, coils) were measured mostly by vibrating-sample- and SQUID magnetometry. Considerable scatter was noted especially in the small-filament-diameter a.c.-loss data. In a study of measurement accuracy, a supplementary series of tests compared the results of VSM measurement of a given pair of copper-matrix samples. In the light of all the results, factors contributing to a.c. loss error are discussed and recommendations are made concerning the specification of future a.c.-loss measurement intercomparisons.

  17. Structured Wiring Systems: Bringing Sanity to Network Cabling!

    Science.gov (United States)

    Learn, Larry L., Ed.

    1995-01-01

    While most organizations, including libraries, can benefit from a structured wiring system, few likely have the expertise and resources to place, specify, and install network cabling by themselves. This article reviews common wiring plans, addresses basic concepts of structured wiring systems, and discusses the importance and benefits of such a…

  18. Modeling, simulation and parametric optimization of wire EDM ...

    African Journals Online (AJOL)

    In the present work, quadratic mathematical models have been derived to represent the process behavior of wire electrical discharge machining (WEDM) operation. Experiments have been conducted with six process parameters: discharge current, pulse duration, pulse frequency, wire speed, wire tension and dielectric flow ...

  19. Bonding of a niobium wire to a niobium thin film

    NARCIS (Netherlands)

    Jaszczuk, W.; Jaszczuk, W.; ter Brake, Hermanus J.M.; Flokstra, Jakob; Veldhuis, Dick; Stammis, R.; Rogalla, Horst

    1991-01-01

    A method for bonding a niobium wire to a niobium thin film is described. The bonds are to be used as superconducting connections between wire-wound gradiometers and thin-film coupling coils on DC SQUIDS. The method is characterized by two steps. Firstly, the hardness of the niobium wire is reduced

  20. 77 FR 28404 - Galvanized Steel Wire From China and Mexico

    Science.gov (United States)

    2012-05-14

    ...)] Galvanized Steel Wire From China and Mexico Determinations On the basis of the record \\1\\ developed in the... reason of imports from Mexico of galvanized steel wire, provided for in subheadings 7217.20.30, 7217.20... galvanized steel wire from China and Mexico were sold at LTFV within the meaning of 733(b) of the Act (19 U.S...

  1. 76 FR 29266 - Galvanized Steel Wire From China and Mexico

    Science.gov (United States)

    2011-05-20

    ...)] Galvanized Steel Wire From China and Mexico Determinations On the basis of the record \\1\\ developed in the... reason of imports from China and Mexico of galvanized steel wire, provided for in subheading 7217.20.30... subsidized imports of galvanized steel wire from China and Mexico. Accordingly, effective March 31, 2011, the...

  2. 46 CFR 111.30-19 - Buses and wiring.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Buses and wiring. 111.30-19 Section 111.30-19 Shipping... REQUIREMENTS Switchboards § 111.30-19 Buses and wiring. (a) General. Each bus must meet the requirements of... 60092-302 (clause 7) (incorporated by reference; see 46 CFR 110.10-1). (b) Wiring. Instrumentation and...

  3. Basic Wiring. Third Edition. Teacher Edition [and] Student Edition.

    Science.gov (United States)

    Kaltwasser, Stan; Flowers, Gary; Blasingame, Don; Batson, Larry; Ipock, Dan; Carroll, Charles; Friesen, Wade; Fleming, Glenn

    This publication contains both a teacher edition and a student edition of materials for a foundation course in an electrical wiring program. The course introduces basic concepts and skills that are prerequisites to residential wiring and commercial and industrial wiring courses. The contents of the materials are tied to measurable and observable…

  4. 29 CFR 1926.404 - Wiring design and protection.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 8 2010-07-01 2010-07-01 false Wiring design and protection. 1926.404 Section 1926.404... Requirements § 1926.404 Wiring design and protection. (a) Use and identification of grounded and grounding... construction sites, which are not a part of the permanent wiring of the building or structure and which are in...

  5. 46 CFR 129.340 - Cable and wiring.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Cable and wiring. 129.340 Section 129.340 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS ELECTRICAL INSTALLATIONS Power Sources and Distribution Systems § 129.340 Cable and wiring. (a) If individual wires, rather than...

  6. 46 CFR 28.370 - Wiring methods and materials.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Wiring methods and materials. 28.370 Section 28.370... Operate With More Than 16 Individuals on Board § 28.370 Wiring methods and materials. (a) All cable and... not more than 10 percent. (c) Cable and wiring not serving equipment in a high risk fire area such as...

  7. 46 CFR 28.865 - Wiring methods and materials.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Wiring methods and materials. 28.865 Section 28.865... FISHING INDUSTRY VESSELS Aleutian Trade Act Vessels § 28.865 Wiring methods and materials. (a) All cable... terminals is not more than 10 percent. (c) Cable and wiring not serving equipment in high risk fire areas...

  8. Interpolation Algorithm for Fast Evaluation of EM Coupling between Wires

    NARCIS (Netherlands)

    Marasini, C.; Lepelaars, E.S.A.M.; Zwamborn, A.P.M.

    2009-01-01

    Efficient and accurate evaluation of the EM field radiated by a current flowing along a wire is essential to solve the electromagnetic coupling between arbitrary oriented wires. In this paper, a numerically efficient algorithm for the evaluation of coupling is presented. The currents along the wires

  9. 77 FR 1504 - Stainless Steel Wire Rod From India

    Science.gov (United States)

    2012-01-10

    ... COMMISSION Stainless Steel Wire Rod From India Determination On the basis of the record \\1\\ developed in the... antidumping duty order on stainless steel wire rod From India would be likely to lead to continuation or... contained in USITC Publication 4300 (January 2012), entitled Stainless Steel Wire Rod From India...

  10. Experimental investigation of industrial copper deformed by wire ...

    African Journals Online (AJOL)

    drawing on microstructure and physical properties of industrial copper wires. Copper wires were provided by E.N.I.CA.Biskra (Algeria). We investigated some wires with different strain levels (as received, 1.20, 2.10, and ε = 3.35).

  11. A laser-wire system for the International Linear Collider

    Indian Academy of Sciences (India)

    Laser-wire; accelerator test facility; laser; optical system; Compton; beam emittance; MOPA; fiber laser. Abstract. A new laser-wire has been installed in the extraction line of the ATF at KEK. It aims at demonstrating that laser-wires can be used to measure micrometre scale beam size. In parallel, studies have been made to ...

  12. A laser-wire system for the International Linear Collider

    Indian Academy of Sciences (India)

    ... line of the ATF at KEK. It aims at demonstrating that laser-wires can be used to measure micrometre scale beam size. In parallel, studies have been made to specify a laser suitable for the ILC laser-wires. Keywords. Laser-wire; accelerator test facility; laser; optical system; Compton; beam emittance; MOPA; fiber laser.

  13. Lunar Module Wiring Design Considerations and Failure Modes

    Science.gov (United States)

    Interbartolo, Michael

    2009-01-01

    This slide presentation reviews the considerations for the design of wiring for the Lunar Module. Included are a review of the choice of conductors and insulations, the wire splicing (i.e., crimping, and soldering), the wire connectors, and the fabrication of the wire harnesses. The problems in fabrication include the wires being the wrong length, the damage due to the sharp edges, the requried use of temproary protective covers and inadequate training. The problems in the wire harness installation include damge from sharp eges, work on adjacent harnesses, connector damage, and breaking wires. Engineering suggestions from the Apollo-era in reference to the conductors that are reviewed include: the use of plated conductors, and the use of alloys for stronger wiring. In refernce to insulation, the suggestions from Apollo era include the use of polymer tape-wrap wire insulation due to the light weight, however, other types of modern insulation might be more cost-effective. In reference to wire splices and terminal boards the suggestions from the Apollo Era include the use of crimp splices as superior to solder splices, joining multiple wire to a common point using modular plug-ins might be more reliable, but are heavier than crimp splicing. For connectors, the lessons from the Apollo era indicate that a rear environmental seal that does not require additional potting is preferred, and pins should be crimped or welded to the incoming wires and be removable from the rear of the connector.

  14. Load-deflection characteristics of superelastic nickel-titanium wires.

    NARCIS (Netherlands)

    Bartzela, T.; Senn, C.; Wichelhaus, A.

    2007-01-01

    OBJECTIVE: To determine the mechanical properties of commercially available thermodynamic wires and to classify these wires mathematically into different groups. MATERIALS AND METHODS: The samples examined were 48 nickel-titanium (NiTi) alloy orthodontic wires commercially available from five

  15. 30 CFR 77.705 - Guy wires; grounding.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Guy wires; grounding. 77.705 Section 77.705... MANDATORY SAFETY STANDARDS, SURFACE COAL MINES AND SURFACE WORK AREAS OF UNDERGROUND COAL MINES Grounding § 77.705 Guy wires; grounding. Guy wires from poles supporting high-voltage transmission lines shall be...

  16. An X-ray scanner for wire chambers

    Science.gov (United States)

    Akesson, T.; Arik, E.; Assamagan, K.; Baker, K.; Benjamin, D.; Bertelsen, H.; Bytchkov, V.; Callahan, J.; Capeans-Garrido, M.; Catinaccio, A.; Cetin, A.; Cwetanski, P.; Danielsson, H.; Dittus, F.; Dolgoshein, B.; Dressnandt, N.; Ebenstein, W. L.; Eerola, P.; Farthouat, P.; Froidevaux, D.; Grichkevitch, Y.; Hajduk, Z.; Hansen, J. R.; Keener, P. K.; Kekelidze, G.; Konovalov, S.; Kowalski, T.; Kramarenko, V. A.; Kruger, K.; Lundberg, B.; Luehring, F.; Manara, A.; McFarlane, K.; Mitsou, V. A.; Morozov, S.; Muraviev, S.; Nadtochy, A.; Newcomer, F. M.; Olszowska, J.; Ogren, H.; Oh, S. H.; Peshekhonov, V.; Price, M.; Rembser, C.; Romaniouk, A.; Rust, D. R.; Schegelsky, V.; Sapinski, M.; Shmeleva, A.; Smirnov, S.; Smirnova, L. N.; Sosnovtsev, V.; Soutchkov, S.; Spiridenkov, E.; Tikhomirov, V.; VanBerg, R.; Vassilakopoulos, V.; Wang, C.; Williams, H. H.

    2003-07-01

    The techniques to measure the position of sense wires and field wires, the gas gain and the gas flow rate inside wire chambers using a collimated and filtered X-ray beam are reported. Specific examples are given using barrel modules of the Transition Radiation Tracker of the ATLAS experiment.

  17. Electronic conductance of quantum wire with serial periodic potential structures

    International Nuclear Information System (INIS)

    Fayad, Hisham M.; Shabat, Mohammed M.; Abdus Salam International Centre for Theoretical Physics, Trieste

    2000-08-01

    A theory based on the total transfer matrix is presented to investigate the electronic conductance in a quantum wire with serial periodic potentials. We apply the formalism in computation of the electronic conductance in a wire with different physical parameters of the wire structure. The numerical results could be used in designing some future quantum electronic devices. (author)

  18. Effects of Environmental Factors and Metallic Electrodes on AC Electrical Conduction Through DNA Molecule.

    Science.gov (United States)

    Abdalla, S; Obaid, A; Al-Marzouki, F M

    2017-12-01

    Deoxyribonucleic acid (DNA) is one of the best candidate materials for various device applications such as in electrodes for rechargeable batteries, biosensors, molecular electronics, medical- and biomedical-applications etc. Hence, it is worthwhile to examine the mechanism of charge transport in the DNA molecule, however, still a question without a clear answer is DNA a molecular conducting material (wire), semiconductor, or insulator? The answer, after the published data, is still ambiguous without any confirmed and clear scientific answer. DNA is found to be always surrounded with different electric charges, ions, and dipoles. These surrounding charges and electric barrier(s) due to metallic electrodes (as environmental factors (EFs)) play a substantial role when measuring the electrical conductivity through λ-double helix (DNA) molecule suspended between metallic electrodes. We found that strong frequency dependence of AC-complex conductivity comes from the electrical conduction of EFs. This leads to superimposing serious incorrect experimental data to measured ones. At 1 MHz, we carried out a first control experiment on electrical conductivity with and without the presence of DNA molecule. If there are possible electrical conduction due to stray ions and contribution of substrate, we will detected them. This control experiment revealed that there is an important role played by the environmental-charges around DNA molecule and any experiment should consider this role. We have succeeded to measure both electrical conductivity due to EFs (σ ENV ) and electrical conductivity due to DNA molecule (σ DNA ) independently by carrying the measurements at different DNA-lengths and subtracting the data. We carried out measurements as a function of frequency (f) and temperature (T) in the ranges 0.1 Hz molecule from all EFs effects that surround the molecule, but also to present accurate values of σ DNA and the dielectric constant of the molecule ε' DNA as a

  19. Measurements of thermal conductivity and thermal diffusivity of hen egg-white lysozyme crystals using a short hot wire method

    Science.gov (United States)

    Fujiwara, Seiji; Maki, Syou; Tanaka, Seiichi; Maekawa, Ryunosuke; Masuda, Tomoki; Hagiwara, Masayuki

    2017-07-01

    Thermal conductivity and thermal diffusivity of hen egg-white lysozyme (HEWL) crystals were examined by using the transient short hot wire method. This method is based on the conventional hot wire method, but improved by using a wire that is much shorter than conventional ones. The magneto-Archimedes levitation technique was utilized to attach the HEWL crystals onto the wire. Owing to the upward magnetic force, the HEWL crystals were deposited at the air-liquid interface of the protein buffer solution where the short hot wire was preliminarily fixed. In situ observation clarified that the wire was completely buried into the HEWL crystals. By means of these techniques, the measurement of thermal conductivity and thermal diffusivity of HEWL crystals was realized for the first time. Gadolinium chloride (a paramagnetic subject) was used as a precipitant agent of crystallization. Crystal growth was carried out over 20 h at 17.2 °C. The applied magnetic field was 4 T. Measurements were conducted during the crystal growth at two different times. The thermal conductivity and diffusivity of the HEWL crystals were determined to be 0.410 W/(m.K) and 3.77×10-8 m2/s at 14 h after, and 0.438 W/(m.K) and 5.18×10-8 m2/s at 20 h after, respectively. We emphasize that this method is versatile and applicable for other protein crystals.

  20. Vibrating-Wire, Supercooled Liquid Water Content Sensor Calibration and Characterization Progress

    Science.gov (United States)

    King, Michael C.; Bognar, John A.; Guest, Daniel; Bunt, Fred

    2016-01-01

    NASA conducted a winter 2015 field campaign using weather balloons at the NASA Glenn Research Center to generate a validation database for the NASA Icing Remote Sensing System. The weather balloons carried a specialized, disposable, vibrating-wire sensor to determine supercooled liquid water content aloft. Significant progress has been made to calibrate and characterize these sensors. Calibration testing of the vibrating-wire sensors was carried out in a specially developed, low-speed, icing wind tunnel, and the results were analyzed. The sensor ice accretion behavior was also documented and analyzed. Finally, post-campaign evaluation of the balloon soundings revealed a gradual drift in the sensor data with increasing altitude. This behavior was analyzed and a method to correct for the drift in the data was developed.

  1. Research on the Plasma Anemometer Based on AC Glow Discharge

    Directory of Open Access Journals (Sweden)

    Bing Yu

    2017-01-01

    Full Text Available A new plasma anemometer based on AC glow discharge is designed in this article. Firstly, theoretical analysis of plasma anemometer working principle is introduced to prove the feasibility of the experimental measurement method. Then the experiments are carried out to study the effects of different parameters on the static discharge characteristics of the plasma anemometer system, by which the system optimization methods are obtained. Finally, several groups of appropriate parameters are selected to build the plasma anemometer system based on resistance capacitance coupling negative feedback AC glow discharge, and different airflow speeds are applied to obtain the achievable velocity measurement range. The results show that there is a linear relationship between airflow velocity and discharge current in an allowable error range, which can be applied for airflow velocity measurement. Negative feedback coupling module, which is composed of the coupling resistance and the coupling capacitance, has good effects on improving the system stability. The measurement range of the airflow velocity is significantly increased when the electrode gap is 3 mm, coupling resistance is 470 Ω, and coupling capacitance is 220 pF.

  2. Research regarding wires elastic deformations influence on joints positioning of a wire-driven robotic arm

    Science.gov (United States)

    Ciofu, C.; Stan, G.

    2016-08-01

    In this paper, we present the influence of driving wires deformation on positioning precision of joints from an elephant's trunk robotic arm. Robotic arms driven by wires have the joint accuracy largely depending on wires rigidity. The joint moment of resistance causes elastic deformation of wires and it is determined by: manipulated object load, weight loads previous to the analyzed joint and inherent resistance moment of joint. Static load analysis emphasizes the particular wires elastic deformation of each driven joint from an elephant's trunk robotic arm with five degrees of freedom. We consider the case of a constant manipulated load. Errors from each driving system of joints are not part of the closed loop system. Thus, precision positioning depends on wires elastic deformation which is about microns and causes angle deviation of joints about tens of minutes of sexagesimal degrees. The closer the joints to base arm the smaller positioning precision of joint. The obtained results are necessary for further compensation made by electronic corrections in the programming algorithm of the elephant's trunk robotic arm to improve accuracy.

  3. U.S. Navy Wire-Rope Handbook. Volume 1. Design and Engineering of Wire-Rope Systems

    Science.gov (United States)

    1976-01-01

    percent nickel and are designated "Type 304 " and "Type 302" by the American Iron and Steel Institute ( AISI ). Type 304 stainless steel rope may be...from AISI Specifica- tion XYZ14 on Alloy Steel Wire) .... ............ ... 3-2 3-2. Typical Load-Elongation Behavior of Wire Rope .... ...... 3-9 3...Cosecants .......... ................... ... 10-S 10-11. Physical and Mechanical Properties of Wire ............ . .. 10-10 10-12. Wire Gauges

  4. Properties of information carrying waves in cosmology

    International Nuclear Information System (INIS)

    O'Shea, E.M.

    2004-01-01

    Recently we studied the effects of information carrying waves propagating through isotropic cosmologies. By information carrying we mean that the waves have an arbitrary dependence on a function. We found that the waves introduce shear and anisotropic stress into the universe. We then constructed explicit examples of pure gravity wave perturbations for which the presence of this anisotropic stress is essential and the null hypersurfaces playing the role of the histories of the wavefronts in the background space-time are shear free. Motivated by this result we now prove that these two properties are true for all information carrying waves in isotropic cosmologies

  5. Population growth and earth's human carrying capacity.

    Science.gov (United States)

    Cohen, J E

    1995-07-21

    Earth's capacity to support people is determined both by natural constraints and by human choices concerning economics, environment, culture (including values and politics), and demography. Human carrying capacity is therefore dynamic and uncertain. Human choice is not captured by ecological notions of carrying capacity that are appropriate for nonhuman populations. Simple mathematical models of the relation between human population growth and human carrying capacity can account for faster-than-exponential population growth followed by a slowing population growth rate, as observed in recent human history.

  6. Gun Carrying by High School Students in Boston, MA: Does Overestimation of Peer Gun Carrying Matter?

    Science.gov (United States)

    Hemenway, David; Vriniotis, Mary; Johnson, Renee M.; Miller, Matthew; Azrael, Deborah

    2011-01-01

    This paper investigates: (1) whether high school students overestimate gun carrying by their peers, and (2) whether those students who overestimate peer gun carrying are more likely to carry firearms. Data come from a randomly sampled survey conducted in 2008 of over 1700 high school students in Boston, MA. Over 5% of students reported carrying a…

  7. Mechanical characterization of Cu-Zn wire electrode base used in EDM and study of influence of the process of machining on its properties

    Energy Technology Data Exchange (ETDEWEB)

    Sedjal, H., E-mail: hasedjal@yahoo.fr; Amirat, B. [Département of Mechanical engineering, University of M.MAMMERI, Tizi Ouzou (Algeria); Aichour, M.; Marouf, T.; Chitroub, M. [Engineering and Material Sciences Laboratory, Department of Metallurgy, Polytechnic national school, Algiers (Algeria)

    2015-03-30

    This work is part of a Research National project (PNR) carried out by the group of research of the engineering and material sciences laboratory of the polytechnic national school at Algiers in collaboration with company BCR, which relates to “the characterization of the wire intended for the EDM of matrices metal. The goal of this work is to bring metallographic explanations on the wire electrode used by the machine ROBOFIL 290P, mechanically characterized this wire as of knowing of advantage about the process of its manufacturing (wiredrawing, .) The methods of studies used are it micro Vickers pyramid hardness, the tensile test, optical microscopy and scan electronic microscopy SEM.

  8. Feasibility study of beam-beam compensation in the Tevatron with wires

    International Nuclear Information System (INIS)

    Sen, Tanaji; Erdelyi, Bela

    2005-01-01

    We explore the possibility of compensating long-range beam-beam interactions in the Tevatron by current carrying wires. Compensation strategies depend on whether the compensation is done close to the interaction or nonlocally, on the aspect ratio of the strong beam and on other details. Strategies for each case have been developed and applied to the Tevatron. We discuss the results of these strategies at injection and collision energy

  9. Test of the wire ageing induced by radiation for the CMS barrel muon chambers

    CERN Document Server

    Conti, E

    2001-01-01

    We have carried out laboratory tests to measure the ageing of a wire tube due to pollutants outgassed by various materials. The tested materials are those used in the barrel muon drift tubes of the CMS experiment at LHC. An X-ray gun irradiated the test tube to accelerate the ageing process. No ageing effect has been measured for a period equivalent to 10 years of operation at LHC. (15 refs).

  10. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  11. Development of Electromechanical Architectures for AC Voltage Metrology

    Directory of Open Access Journals (Sweden)

    Alexandre BOUNOUH

    2010-12-01

    Full Text Available This paper presents results of work undertaken for exploring MEMS capabilities to fabricate AC voltage references for electrical metrology and high precision instrumentation through the mechanical-electrical coupling in MEMS. From first MEMS test structures previously realized, a second set of devices with improved characteristics has been developed and fabricated with Silicon on Insulator (SOI Surface Micromachining process. These MEMS exhibit pull-in voltages of 5 V and 10 V to match with the best performance of the read-out electronics developed for driving the MEMS. Deep Level Transient Spectroscopy measurements carried out on the new design show resonance frequencies of about only some kHz, and the stability of the MEMS output voltage measured at 100 kHz has been found very promising for the best samples where the relative deviation from the mean value over almost 12 hours showed a standard deviation of about 6.3 ppm.

  12. Near-field optical spectroscopy of single quantum wires

    Science.gov (United States)

    Harris, T. D.; Gershoni, D.; Grober, R. D.; Pfeiffer, L.; West, K.; Chand, N.

    1996-02-01

    Low temperature near-field scanning optical microscopy is used for spectroscopic studies of single, nanometer dimension, cleaved edge overgrown quantum wires. A direct experimental comparison between a two dimensional system and a single genuinely one dimensional quantum wire system, inaccessible to conventional far field optical spectroscopy, is enabled by the enhanced spatial resolution. We show that the photoluminescence of a single quantum wire is easily distinguished from that of the surrounding quantum well. Emission from localized centers is shown to dominate the photoluminescence from both wires and wells at low temperatures. A factor of 3 absorption enhancement for these wires compared to the wells is concluded from the photoluminescence excitation data.

  13. Laparoscopic extraction of fractured Kirschner wire from the pelvis

    Directory of Open Access Journals (Sweden)

    Vinaykumar N Thati

    2014-01-01

    Full Text Available Kirschner wire is a sharp stainless steel guide wire commonly used in fixation of fractured bone segments. There are case reports of migrated K wire from the upper limb into the spine and chest, and from the lower limb in to the abdomen and pelvis. Here, we present a case report of accidental intra-operative fracture of K wire during percutaneous femoral nailing for sub-trochanteric fracture of right femur, which migrated in to the pelvis when the orthopaedician tried to retrieve the broken segment of the K wire. This case highlights the use of laparoscopy as minimally invasive surgical option.

  14. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  15. Magnetic nanowires (Fe, Fe-Co, Fe-Ni – magnetic moment reorientation in respect of wires composition

    Directory of Open Access Journals (Sweden)

    Kalska-Szostko Beata

    2015-03-01

    Full Text Available Magnetic nanowires of Fe, Fe-Co, and Fe-Ni alloy and layered structure were prepared by electrochemical alternating current (AC deposition method. The morphology of the nanowires in and without the matrix was studied by energy dispersive X-ray spectroscopy (EDX, scanning electron microscopy (SEM, and X-ray diffraction (XRD, respectively. The wires either show strong dependence on the combination of elements deposition (alloy or layered or chemical composition (Co or Ni. The magnetic properties of the nanostructures were determined on the basis of Mössbauer spectroscopy (MS.

  16. Enhanced THz guiding properties of curved two-wire lines.

    Science.gov (United States)

    Zha, Jingshu; Kim, Geun Ju; Jeon, Tae-In

    2016-03-21

    We present experimental and simulation studies of enhanced terahertz (THz) guiding properties of curved two-wire lines for several surface conditions. When a THz-wave propagates through curved two-wire lines, a rough wire surface with dielectric coating contributes to a lower bending loss compared to a smooth or rough wire surface without coating. Dielectric coating and rough surface confine the THz field to the wire surface making the bending loss low. The guiding property at a curve depth of 30 mm of a rough wire surface with 25-μm-thick coating is improved by 34% compared to that of a smooth wire without coating. Furthermore, computer simulation technology (CST) software visually shows the bending loss as same as the experimental studies.

  17. Basic study of HTS magnet using 2G wires for maglev train

    Energy Technology Data Exchange (ETDEWEB)

    Ogata, M., E-mail: ogata@rtri.or.j [Railway Technical Research Institute, 2-8-38, Hikari-cho, Kokubunji-shi, Tokyo 185-8540 (Japan); Miyazaki, Y.; Hasegawa, H.; Sasakawa, T.; Nagashima, K. [Railway Technical Research Institute, 2-8-38, Hikari-cho, Kokubunji-shi, Tokyo 185-8540 (Japan)

    2010-11-01

    There are several advantages by applying a high-temperature superconducting wire to an on-board superconducting magnet for the maglev train. At first, an increase of thermal capacity of superconducting coils contributes a stability of the superconducting state of the coils. In addition, a reliability of superconducting magnet improves by simplification of the magnet structure. And the weight of the superconducting magnet and the energy consumption of the on-board cryocooler will decrease. Therefore, we examined the possibility on application of the 2G wire with a high critical current density in a high magnetic field. We performed numerical analysis regarding the weight of a superconducting magnet and the energy consumption of an on-board cryocooler in consideration of the characteristics of the 2G wire. Furthermore, we have carried out the I{sub c} measurement for the commercial 2G wires under various experimental conditions such as temperature, magnetic field strength and angle. We also performed the trial manufacture and evaluation of I{sub c} characteristics for the small race track-shaped superconducting coil.

  18. Preliminary study of HTS magnet using 2G wires for maglev train

    Energy Technology Data Exchange (ETDEWEB)

    Ogata, Masafumi; Miyazaki, Yoshiki; Hasegawa, Hitoshi; Sasakawa, Takashi; Nagashima, Ken, E-mail: ogata@rtri.or.j [Railway Technical Research Institute, Hikari-cho 2-8-38, Kokubunji-shi, Tokyo (Japan)

    2010-06-01

    There are several advantages by applying a high temperature superconducting wire to an on-board superconducting magnet for the maglev train. At first, an increase of thermal capacity of superconducting coils contributes a stability of the superconducting state of the coils. In addition, a reliability of superconducting magnet improves by simplification of the magnet structure. And the weight of the superconducting magnet and the energy consumption of the on-board cryocooler will decrease. Therefore, we examined the possibility on application of the 2G wire with a high critical current density in a high magnetic field. We performed numerical analysis regarding the weight of a superconducting magnet and the energy consumption of an on-board cryocooler in consideration of the characteristics of the 2G wire. Furthermore, we have carried out the I{sub c} measurement for the commercial 2G wires under various experimental conditions such as temperature, magnetic field strength and angle. We also performed the trial manufacture and evaluation of I{sub c} characteristics for the small race track-shaped superconducting coil.

  19. Basic study of HTS magnet using 2G wires for maglev train

    Science.gov (United States)

    Ogata, M.; Miyazaki, Y.; Hasegawa, H.; Sasakawa, T.; Nagashima, K.

    2010-11-01

    There are several advantages by applying a high-temperature superconducting wire to an on-board superconducting magnet for the maglev train. At first, an increase of thermal capacity of superconducting coils contributes a stability of the superconducting state of the coils. In addition, a reliability of superconducting magnet improves by simplification of the magnet structure. And the weight of the superconducting magnet and the energy consumption of the on-board cryocooler will decrease. Therefore, we examined the possibility on application of the 2G wire with a high critical current density in a high magnetic field. We performed numerical analysis regarding the weight of a superconducting magnet and the energy consumption of an on-board cryocooler in consideration of the characteristics of the 2G wire. Furthermore, we have carried out the Ic measurement for the commercial 2G wires under various experimental conditions such as temperature, magnetic field strength and angle. We also performed the trial manufacture and evaluation of Ic characteristics for the small race track-shaped superconducting coil.

  20. Preliminary study of HTS magnet using 2G wires for maglev train

    Science.gov (United States)

    Ogata, Masafumi; Miyazaki, Yoshiki; Hasegawa, Hitoshi; Sasakawa, Takashi; Nagashima, Ken

    2010-06-01

    There are several advantages by applying a high temperature superconducting wire to an on-board superconducting magnet for the maglev train. At first, an increase of thermal capacity of superconducting coils contributes a stability of the superconducting state of the coils. In addition, a reliability of superconducting magnet improves by simplification of the magnet structure. And the weight of the superconducting magnet and the energy consumption of the on-board cryocooler will decrease. Therefore, we examined the possibility on application of the 2G wire with a high critical current density in a high magnetic field. We performed numerical analysis regarding the weight of a superconducting magnet and the energy consumption of an on-board cryocooler in consideration of the characteristics of the 2G wire. Furthermore, we have carried out the Ic measurement for the commercial 2G wires under various experimental conditions such as temperature, magnetic field strength and angle. We also performed the trial manufacture and evaluation of Ic characteristics for the small race track-shaped superconducting coil.

  1. PEEK (polyether-ether-ketone)-coated nitinol wire: Film stability for biocompatibility applications

    Science.gov (United States)

    Sheiko, Nataliia; Kékicheff, Patrick; Marie, Pascal; Schmutz, Marc; Jacomine, Leandro; Perrin-Schmitt, Fabienne

    2016-12-01

    High quality biocompatible poly-ether-ether-ketone (PEEK) coatings were produced on NiTi shape memory alloy wires using dipping deposition from colloidal aqueous PEEK dispersions after substrate surface treatment. The surface morphology and microstructure were investigated by Scanning Electron Microscopy at every step of the process from the as-received Nitinol substrate to the ultimate PEEK-coated NiTi wire. Nanoscratch tests were carried out to access the adhesive behavior of the polymer coated film to the NiTi. The results indicate that the optimum process conditions in cleaning, chemical etching, and electropolishing the NiTi, were the most important and determining parameters to be achieved. Thus, high quality PEEK coatings were obtained on NiTi wires, straight or curved (even with a U-shape) with a homogeneous microstructure along the wire length and a uniform thickness of 12 μm without any development of cracks or the presence of large voids. The biocompatibility of the PEEK coating film was checked in fibrobast cultured cells. The coating remains stable in biological environment with negligible Ni ion release, no cytotoxicity, and no delamination observed with time.

  2. Preliminary study of HTS magnet using 2G wires for maglev train

    International Nuclear Information System (INIS)

    Ogata, Masafumi; Miyazaki, Yoshiki; Hasegawa, Hitoshi; Sasakawa, Takashi; Nagashima, Ken

    2010-01-01

    There are several advantages by applying a high temperature superconducting wire to an on-board superconducting magnet for the maglev train. At first, an increase of thermal capacity of superconducting coils contributes a stability of the superconducting state of the coils. In addition, a reliability of superconducting magnet improves by simplification of the magnet structure. And the weight of the superconducting magnet and the energy consumption of the on-board cryocooler will decrease. Therefore, we examined the possibility on application of the 2G wire with a high critical current density in a high magnetic field. We performed numerical analysis regarding the weight of a superconducting magnet and the energy consumption of an on-board cryocooler in consideration of the characteristics of the 2G wire. Furthermore, we have carried out the I c measurement for the commercial 2G wires under various experimental conditions such as temperature, magnetic field strength and angle. We also performed the trial manufacture and evaluation of I c characteristics for the small race track-shaped superconducting coil.

  3. Performance of PrekotAC Filter Aids on Pressure Drop across Two Different Filter Media

    Directory of Open Access Journals (Sweden)

    Hajar S.

    2017-01-01

    Full Text Available A study on the performance of formulated PrekotAC filter aids on pressure drop across two different types of filter media, i.e polytetrafluoroethylene (PTFE and polyimide (P84 was carried out in a laboratory scale fabric filtration system. Filter aids is applied in order to prolong the lifespan of the fabric filter by reducing the pressure drop across a filter cake. PrekotAC which is a combination of 90%wt activated carbon and 10%wt PreKotTM was tested under various material loadings of 0.2, 0.4, and 0.6 mg/mm2 at a constant filtration velocity of 5 m/min across its cake and filter media. The results showed that PrekotAC presents a lower pressure drop across the P84 compared to PTFE filter media under various material loadings. This is because of its different characteristics that effect the porosity of the filter media and allow a higher volumetric airflow passing through, resulting in lower pressure drop compared to PTFE filter media. In addition, the diversity in terms of particle size distribution of the formulated PrekotAC that increase its permeability property helps to reduce the pressure drop across the media and its filter cake. Thus, PrekotAC has a promising characteristic as a two in one filter aids, a pre-coating and adsorbent material for fabric filtration system.

  4. Disorder and Interaction Effects in Quantum Wires

    International Nuclear Information System (INIS)

    Smith, L W; Ritchie, D A; Farrer, I; Griffiths, J P; Jones, G A C; Thomas, K J; Pepper, M

    2012-01-01

    We present conductance measurements of quasi-one-dimensional quantum wires affected by random disorder in a GaAs/AlGaAs heterostructure. In addition to quantised conductance plateaux, we observe structure superimposed on the conductance characteristics when the channel is wide and the density is low. Magnetic field and temperature are varied to characterize the conductance features which depend on the lateral position of the 1D channel formed in a split-gate device. Our results suggest that there is enhanced backscattering in the wide channel limit, which gives rise to quantum interference effects. When the wires are free of disorder and wide, the confinement is weak so that the mutual repulsion of the electrons forces a single row to split into two. The relationship of this topological change to the disorder in the system will be discussed.

  5. Superconducting wire turns to electrical power

    CERN Document Server

    Sargent, P

    2003-01-01

    Two years after the discovery that magnesium diboride is a superconductor, engineers and entrepreneurs are keen to transform its properties into profit. The discovery of superconductivity at 39 K in the metallic compound magnesium diboride two years ago created quite a stir. Since then, physicists and chemists have come a long way in understanding the curious set of circumstances that lead to such a high critical temperature in this widely available material. At the same time, metallurgists, engineers and entrepreneurs have been focusing on the commercial potential of magnesium diboride as superconducting wire, which was the subject of a one-day meeting in Cambridge, UK, in April. Superconducting wire made from magnesium diboride could make 'second- generation' electrical machines commercially viable. (U.K.)

  6. Neutron refraction by cylindrical metal wires

    International Nuclear Information System (INIS)

    Plomp, J.; Barker, J.G.; Haan, V.O. de; Bouwman, W.G.; Well, A.A. van

    2007-01-01

    Undesired Small-Angle Neutron Scattering (SANS) from interior features of an object can be minimised by reducing the sample thickness. However, refraction effects produced by the exterior shape of the object depend upon the scattering cross-section and not on the thickness of the object. In the field of polarised neutrons a wire coil is often used to manipulate the polarisation vector of the neutron. In this paper, we show that the cylindrical shape of the wire together with the refractive index introduces an angular distribution in the neutron beam. This can be observed in instrumentation sensitive to SANS. We show results measured on three different SANS instruments: Ultra Small-Angle Neutrons Scattering (USANS), Spin-Echo Small-Angle Neutron Scattering (SESANS) and a Time-of-Flight (TOF) SESANS. These results are all in good agreement with the theory of refraction

  7. Neutron refraction by cylindrical metal wires

    Energy Technology Data Exchange (ETDEWEB)

    Plomp, J. [Faculty of Applied Sciences, Delft University of Technology, Delft (Netherlands)]. E-mail: j.plomp@tudelft.nl; Barker, J.G. [NIST Center for Neutron Research, National Institute of Standards and Technology, Gaithersburg, MD 20899 (United States); Haan, V.O. de [Faculty of Applied Sciences, Delft University of Technology, Delft (Netherlands); Bouwman, W.G. [Faculty of Applied Sciences, Delft University of Technology, Delft (Netherlands); Well, A.A. van [Faculty of Applied Sciences, Delft University of Technology, Delft (Netherlands)

    2007-05-01

    Undesired Small-Angle Neutron Scattering (SANS) from interior features of an object can be minimised by reducing the sample thickness. However, refraction effects produced by the exterior shape of the object depend upon the scattering cross-section and not on the thickness of the object. In the field of polarised neutrons a wire coil is often used to manipulate the polarisation vector of the neutron. In this paper, we show that the cylindrical shape of the wire together with the refractive index introduces an angular distribution in the neutron beam. This can be observed in instrumentation sensitive to SANS. We show results measured on three different SANS instruments: Ultra Small-Angle Neutrons Scattering (USANS), Spin-Echo Small-Angle Neutron Scattering (SESANS) and a Time-of-Flight (TOF) SESANS. These results are all in good agreement with the theory of refraction.

  8. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  9. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    is then added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  10. Collapse of DNA in ac Electric Fields

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W.; Staunton, Rory J.; Ashan, Amir; Austin, Robert H.; Riehn, Robert

    2011-06-01

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  11. Collapse of DNA in ac electric fields.

    Science.gov (United States)

    Zhou, Chunda; Reisner, Walter W; Staunton, Rory J; Ashan, Amir; Austin, Robert H; Riehn, Robert

    2011-06-17

    We report that double-stranded DNA collapses in the presence of ac electric fields at frequencies of a few hundred Hertz, and does not stretch as commonly assumed. In particular, we show that confinement-stretched DNA can collapse to about one quarter of its equilibrium length. We propose that this effect is based on finite relaxation times of the counterion cloud, and the subsequent partitioning of the molecule into mutually attractive units. We discuss alternative models of those attractive units.

  12. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  13. Optimal growth trajectories with finite carrying capacity

    Science.gov (United States)

    Caravelli, F.; Sindoni, L.; Caccioli, F.; Ududec, C.

    2016-08-01

    We consider the problem of finding optimal strategies that maximize the average growth rate of multiplicative stochastic processes. For a geometric Brownian motion, the problem is solved through the so-called Kelly criterion, according to which the optimal growth rate is achieved by investing a constant given fraction of resources at any step of the dynamics. We generalize these finding to the case of dynamical equations with finite carrying capacity, which can find applications in biology, mathematical ecology, and finance. We formulate the problem in terms of a stochastic process with multiplicative noise and a nonlinear drift term that is determined by the specific functional form of carrying capacity. We solve the stochastic equation for two classes of carrying capacity functions (power laws and logarithmic), and in both cases we compute the optimal trajectories of the control parameter. We further test the validity of our analytical results using numerical simulations.

  14. From barbed wire to radar traps

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    Several million DM are required already to protect the building sites of power plants. From the very beginning concrete, wood, and barbed wire are used to make a protective wall against intruders, or in official German, 'unauthorized persons'. This expensive provisional set-up is later supplanted by electronic alarm and safety systems. A review of available systems helps to give a picture of power plant protection. (orig.) 891 HP [de

  15. Visible emission from exploding wire in water

    Czech Academy of Sciences Publication Activity Database

    Šimek, Milan; Prukner, Václav; Schmidt, Jiří; Koláček, Karel; Štraus, Jaroslav; Frolov, Oleksandr

    2007-01-01

    Roč. 53, č. 10 (2007), s. 53-53 ISSN 0003-0503. [The 61st Annual Gaseous Electronic Conference. Dallas, Texas , 13.10.2008-17.10.2008] R&D Projects: GA ČR GA202/06/1324 Institutional research plan: CEZ:AV0Z20430508 Keywords : Exploding wire * emission Subject RIV: BL - Plasma and Gas Discharge Physics

  16. Wire chambers with their magnetostrictive readout

    CERN Multimedia

    1974-01-01

    This set of wire chamber planes shaped as a cylinder sector was installed inside the magnet of a polarized spin target modified to allow as well momentum analysis of the produced particles. The experiment (S126) was set up by the CERN-Trieste Collaboration in the PS beam m9 to measure spin effects in the associated production of of a positive kaon and a positive Sigma by interaction of a positive pion with polarized protons.

  17. METHOD OF MAKING WIRE FUEL ELEMENTS

    Science.gov (United States)

    Zambrow, J.L.

    1960-08-01

    A method is given for making a nuclear reactor fuel element in the form of a uranium-bearing wire clad with zirconium. A uranium bar is enclosed in a zirconium sheath which is coated with an oxide of magnesium, beryllium, or zirconium. The sheathed bar is then placed in a steel tube and reduced to the desired diameter by swaging at 800 to 900 deg C, after which the steel and oxide are removed.

  18. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  19. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  20. An Optical Carry Chain Fast Adder

    Directory of Open Access Journals (Sweden)

    D. Al-Dabass

    1994-12-01

    Full Text Available A significant problem in Arithmetic Unit design and particularly for systolic arrays remains the speed attainable in achieving high speed addition. The root of the problem is carry propagation and a method is presented which is relatively independent of word length. The problem is addressed by the description of a suggested radical design involving a hybrid optical and electronic approach. The method of carry chain addition through pass gates is explained and a suggested implementation utilising Fabry-Perott resonators, optical waveguides and voltage controlled couplers is described. The design is suitable for n-stage modular expansion.

  1. Parallelization of Reversible Ripple-carry Adders

    DEFF Research Database (Denmark)

    Thomsen, Michael Kirkedal; Axelsen, Holger Bock

    2009-01-01

    The design of fast arithmetic logic circuits is an important research topic for reversible and quantum computing. A special challenge in this setting is the computation of standard arithmetical functions without the generation of \\emph{garbage}. Here, we present a novel parallelization scheme......{O}(m\\cdot k)$. The underlying mechanisms of the parallelization scheme are formally proven correct. We also show designs for garbage-less reversible comparison circuits. We compare the circuit costs of the resulting ripple-block carry adder with known optimized reversible ripple-carry adders in measures...

  2. Abstraction carrying code and resource-awareness

    OpenAIRE

    Hermenegildo, Manuel V.; Albert Albiol, Elvira; López García, Pedro; Puebla Sánchez, Alvaro Germán

    2005-01-01

    Proof-Carrying Code (PCC) is a general approach to mobile code safety in which the code supplier augments the program with a certifícate (or proof). The intended benefit is that the program consumer can locally validate the certifícate w.r.t. the "untrusted" program by means of a certifícate checker—a process which should be much simpler, eíñcient, and automatic than generating the original proof. Abstraction Carrying Code (ACC) is an enabling technology for PCC in which an abstract mod...

  3. Numerical Investigation of Corrugated Wire Mesh Laminate

    Directory of Open Access Journals (Sweden)

    Jeongho Choi

    2013-01-01

    Full Text Available The aim of this work is to develop a numerical model of Corrugated Wire Mesh Laminate (CWML capturing all its complexities such as nonlinear material properties, nonlinear geometry and large deformation behaviour, and frictional behaviour. Development of such a model will facilitate numerical simulation of the mechanical behaviour of the wire mesh structure under various types of loading as well as the variation of the CWML configuration parameters to tailor its mechanical properties to suit the intended application. Starting with a single strand truss model consisting of four waves with a bilinear stress-strain model to represent the plastic behaviour of stainless steel, the finite element model is gradually built up to study single-layer structures with 18 strands of corrugated wire meshes consistency and double- and quadruple-layered laminates with alternating crossply orientations. The compressive behaviour of the CWML model is simulated using contact elements to model friction and is compared to the load-deflection behaviour determined experimentally in uniaxial compression tests. The numerical model of the CWML is then employed to conduct the aim of establishing the upper and lower bounds of stiffness and load capacity achievable by such structures.

  4. Contact conductance between graphene and quantum wires

    International Nuclear Information System (INIS)

    Li Haidong; Zheng Yisong

    2009-01-01

    The contact conductance between graphene and two quantum wires which serve as the leads to connect graphene and electron reservoirs is theoretically studied. Our investigation indicates that the contact conductance depends sensitively on the graphene-lead coupling configuration. When each quantum wire couples solely to one carbon atom, the contact conductance vanishes at the Dirac point if the two carbon atoms coupling to the two leads belong to the same sublattice of graphene. We find that such a feature arises from the chirality of the Dirac electron in graphene. Such a chirality associated with conductance zero disappears when a quantum wire couples to multiple carbon atoms. The general result irrelevant to the coupling configuration is that the contact conductance decays rapidly with the increase of the distance between the two leads. In addition, in the weak graphene-lead coupling limit, when the distance between the two leads is much larger than the size of the graphene-lead contact areas and the incident electron energy is close to the Dirac point, the contact conductance is proportional to the square of the product of the two graphene-lead contact areas, and inversely proportional to the square of the distance between the two leads

  5. Results of the Fermilab wire production program

    International Nuclear Information System (INIS)

    Strauss, B.P.; Remsbottom, R.H.; Reardon, P.J.; Curtis, C.W.; McDonald, W.K.

    1976-01-01

    In examining the various schedules of wire drawing and heat treating, the Critchlow type of schedule provided the highest and most uniform data from billet to billet. It consists of a long anneal at 400 +- 20 0 C at a cold work point giving about 99 percent reduction in area from the extrusion size. Several quick copper anneals at 300 0 C may be interspersed to aid in fabrication. A final anneal at finished size both peaks up the resistivity ratio of the copper as well as the critical current of the alloy by moving dislocations to subcell walls. Using this method, critical currents of 1.7 x 10 5 A/cm 2 could be maintained in all billets. The copper cladding and sinking method looks promising and should save production costs. In spite of this, it was important to attain good packing density in the billets to assure uniform filament pattern and reduce breakage in wire drawing. Overall, a procedure was found for fabricating wire in large production lots that would be acceptable for constructing dipole magnets. It is felt that this method could be peaked up with time

  6. Reliability of the wire drawing dies

    International Nuclear Information System (INIS)

    Sheikh, A.K.; Khany, S.E.

    1993-01-01

    A wear based model is proposed for the dies used in wire drawing process. Using this wear model, it is possible to predict life of the die corresponding to a wear limit criterion. Since various quantities in the model are random in nature the resulting die life will also be random quantity characterized by an appropriate distribution. Using a probabilistic characterization of the parameters of the predictive model, Monte Carlo simulations were conducted to establish the die life distribution. To asses the sensitivity of life distribution with respect to various contributing variables (parameters), the simulation runs were conducted at different levels of these variables (parameters). It is shown that wire drawing die life is Weibull distributed. To compare the simulated results with actual time to failure, data of dies was obtained from a large wire drawing company and was compared with corresponding scenario generated by Monte Carlo simulation. Results obtained by Monte Carlo simulations were very close to the actual time to failure data. (author)

  7. NA48: Wiring up for Change

    CERN Multimedia

    2001-01-01

    The NA48 Collaboration is rebuilding its drift chambers ready for the experiment to start up again this coming July. An intricate task involving the soldering of over 24,000 wires! The future of the NA48 experiment is coming right down to the wire, that is, the wires which the Collaboration is installing in the clean room of Hall 887 on the Prévessin site. Six days a week, technicians are working in shifts to rebuild the experiment's drift chambers. The original chambers were damaged when a section of a vacuum tube imploded at the end of 1999. A year ago, CERN gave the green light for this essential part of the spectrometer to be rebuilt, so the NA48 experiment, which studies CP violation (see box), still has a bright future ahead of it. Three years of data-taking ahead The NA48 experiment aims to penetrate the secrets of CP (Charge Parity) violation. Charge and parity are two parameters which distinguish a particle from an antiparticle. In other words, an electron possesses a negative electric ...

  8. Thermosonic wire bonding of gold wire onto copper pad using the saturated interfacial phenomena

    Science.gov (United States)

    Jeng, Yeau-Ren; Aoh, Jong-Hing; Wang, Chang-Ming

    2001-12-01

    Copper has been used to replace conventional aluminium interconnection to improve the performance of deep submicron integrated circuits. This study used the saturated interfacial phenomena found in thermosonic ball bonding of gold wire onto aluminium pad to investigate thermosonic ball bonding of gold wire onto copper pad. The effects of preheat temperatures and ultrasonic powers on the bonding force were investigated by using a thermosonic bonding machine and a shear tester. This work shows that under proper preheat temperatures, the bonding force of thermosonic wire bonding can be explained based on interfacial microcontact phenomena such as energy intensity, interfacial temperature and real contact area. It is clearly shown that as the energy intensity is increased, the shear force increases, reaches a maximum, and then decreases. After saturation, i.e. the establishment of maximum atomic bonding, any type of additional energy input will damage the bonding, decreasing the shear force. If the preheat temperature is not within the proper range, the interfacial saturation phenomenon does not exist. For a preload of 0.5 N and a welding time of 15 ms in thermosonic wire bonding of gold wire onto copper pads, a maximum shear force of about 0.33 N is found where the interfacial energy intensity equals 1.8×106 J m-2 for preheat temperatures of 150°C and 170°C. Moreover, the corresponding optimal ultrasonic power is about 110 units.

  9. Molecular and functional characterization of CpACS27A gene reveals its involvement in monoecy instability and other associated traits in squash (Cucurbita pepo L.).

    Science.gov (United States)

    Martínez, Cecilia; Manzano, Susana; Megías, Zoraida; Barrera, Alejandro; Boualem, Adnane; Garrido, Dolores; Bendahmane, Abdelhafid; Jamilena, Manuel

    2014-06-01

    A number of Cucurbita pepo genotypes showing instable monoecy or partial andromonoecy, i.e. an incomplete conversion of female into bisexual flowers, have been detected. Given that in melon and cucumber andromonoecy is the result of reduction of ethylene production in female floral buds, caused by mutations in the ethylene biosynthesis genes CmACS7 and CsACS2; we have cloned and characterized two related C. pepo genes, CpACS27A and CpACS27B. The molecular structure of CpACS27A and its specific expression in the carpels of female flowers during earlier stages of flower development suggests that this gene is the Cucurbita ortholog of CmACS7 and CsACS2. CpACS27B is likely to be a paralogous pseudogene since it has not been found to be expressed in any of the analyzed tissues. CpACS27A was sequenced in Bolognese (Bog) and Vegetable Spaghetti (Veg), two monoecious inbred lines whose F2 was segregating for partial andromonoecy. The Bog allele of CpACS27A carried a missense mutation that resulted in a substitution of the conserved serine residue in position 176 by an alanine. Segregation analysis indicated that this mutant variant is necessary but not sufficient to confer the andromonoecious phenotype in squash. In concordance with its involvement in stamen arrest, a reduction in CpACS27A expression has been found in bisexual flower buds at earlier stages of development. This reduction in CpACS27A expression was concomitant with a downregulation of other ethylene biosynthesis and signaling genes during earlier and later stages of ovary development. The role of CpACS27A is discussed regarding the regulation of ethylene biosynthesis and signaling genes in the control of andromonoecy-associated traits, such as the delayed maturation of corolla and stigma as well as the parthenocarpic development of the fruit.

  10. Wire-grid electromagnetic modelling of metallic cylindrical objects with arbitrary section, for Ground Penetrating Radar applications

    Science.gov (United States)

    Adabi, Saba; Pajewski, Lara

    2014-05-01

    ), pp. 409-418. [3] A.C. Ludwig, Wire grid modeling of surfaces, IEEE Trans. Antennas Propagation AP-35 (1987), pp. 1045-1048. [4] R.J. Paknys, The near field of a wire grid model, IEEE Trans. Antennas Propagation 39 (1991), pp. 994-999. [5] F. Frezza, L. Pajewski, C. Ponti, G. Schettini, Accurate wire-grid modelling of buried conducting cylindrical scatterers, Nondestructive Testing and Evaluation (2012), 27, pp. 199-207. [6] A. Giannopoulos, Modelling ground penetrating radar by GPRMAX. Construction and Building Materials (2005), 19, pp. 755-762.

  11. Carrying capacity: maintaining outdoor recreation quality

    Science.gov (United States)

    David W. Lime; George H. Stankey

    1971-01-01

    A discussion of (1) what is meant by the concept of recreational carrying capacity; (2) what is known about capacities in terms of both how resources and experience of visitors are affected by recreational use; and (3) what alternative procedures the administrator can use to manage both resources and visitors for capacity.

  12. Error propagation in energetic carrying capacity models

    Science.gov (United States)

    Pearse, Aaron T.; Stafford, Joshua D.

    2014-01-01

    Conservation objectives derived from carrying capacity models have been used to inform management of landscapes for wildlife populations. Energetic carrying capacity models are particularly useful in conservation planning for wildlife; these models use estimates of food abundance and energetic requirements of wildlife to target conservation actions. We provide a general method for incorporating a foraging threshold (i.e., density of food at which foraging becomes unprofitable) when estimating food availability with energetic carrying capacity models. We use a hypothetical example to describe how past methods for adjustment of foraging thresholds biased results of energetic carrying capacity models in certain instances. Adjusting foraging thresholds at the patch level of the species of interest provides results consistent with ecological foraging theory. Presentation of two case studies suggest variation in bias which, in certain instances, created large errors in conservation objectives and may have led to inefficient allocation of limited resources. Our results also illustrate how small errors or biases in application of input parameters, when extrapolated to large spatial extents, propagate errors in conservation planning and can have negative implications for target populations.

  13. Construction of expression vectors carrying mouse peroxisomal ...

    African Journals Online (AJOL)

    The aim of this study was to construct expression vectors carrying mouse peroxisomal protein gene (PEP-cDNA) in prokaryotic and mammalian expression vectors in ... pGEX6p2-PEP and pUcD3-FLAG-PEP constructed vectors were transformed into the one shot TOP10 and JM105 bacterial competent cells, respectively.

  14. Transgenic cassava lines carrying heterologous alternative oxidase ...

    African Journals Online (AJOL)

    Afuape

    2013-07-03

    Jul 3, 2013 ... Organized embryogenic callus development: In our experiment, somatic embryos were developed from leaf lobes collected from transgenic cassava lines carrying the AtAOX1a gene. Immature leaf lobes measuring about 1 to 6 mm obtained from about six weeks old in vitro derived plants were used.

  15. Magnetoacoustic waves in current-carrying plasmas

    International Nuclear Information System (INIS)

    Brennan, M.H.

    1980-04-01

    The results of theoretical and experimental investigations of the characteristics of magnetoacoustic waves in non-uniform, current-carrying plasmas are reviewed. Dissipative MHD and collisionless theories are considered. Also discussed is the use of magnetoacoustic waves in plasma diagnostics and plasma heating

  16. Microfluidic device for carrying out a reaction

    NARCIS (Netherlands)

    Iordanov, V.; Bastemeijer, J.; Bossche, A.; Sarro, P.M.

    2005-01-01

    A device for carrying out a reaction, which device comprises a wafer provided with a group of at least two wells. The wells are thermally separate from each other by means of a groove in a layer of the device, while parts separated by the groove are locally connected by bridges. In this way a device

  17. Transgenic cassava lines carrying heterologous alternative oxidase ...

    African Journals Online (AJOL)

    Messenger RNA was extracted from selected PCR-positive lines for reverse transcription-PCR analysis for gene expression. To screen positive lines for gene function, leaf lobes from two transgenic lines with a line carrying an empty vector and the wild type were subjected to somatic embryogenesis (SE), a known oxidative ...

  18. Development of Oxygen-Carrying Compounds

    Science.gov (United States)

    1942-10-16

    lth-ugh nc suggestion w:.s nude th t the oxygen in tiu compounds night be carried reversibly they c.ppeared worth investig. ting. The - llylamine...revolution every nine- teen minutes. The accompanying diagram ehovs the machine in its first form. The driv~ and Rear reduction mechanism of this

  19. Test Measurements of a 20 ms-1 Carbon Wire Beam Scanner

    CERN Document Server

    De Freitas, J; Emery, J; Herranz Alvarez, J F; Koujili, M; Ramos, D; Sapinski, M; Ait-Amira, Y; Djerdir, A

    2011-01-01

    This paper pre­sents the de­sign of the ac­tu­a­tor for the fast and high ac­cu­ra­cy Wire Scan­ner sys­tem. The ac­tu­a­tor con­sists of a ro­tary brushless syn­chronous motor with the per­ma­nent mag­net rotor in­stalled in­side the vac­u­um cham­ber and the sta­tor in­stalled out­side. The fork, per­ma­nent mag­net rotor and two an­gu­lar po­si­tion sen­sors are mount­ed on the same axis and lo­cat­ed in­side the beam vac­u­um cham­ber. The system has to re­sist a bake-out tem­per­a­ture of 200 C and ion­iz­ing radi­a­tion up to tenths of kGy/year. Max­i­mum wire trav­el­ling speed of 20 m/s and a po­si­tion mea­sure­ment ac­cu­ra­cy of 4 um is re­quired. Therefore, the sys­tem must avoid gen­er­at­ing vi­bra­tion and electromagnet­ic in­ter­fer­ence. A dig­i­tal feed­back con­troller will allow max­i­mum flex­i­bil­i­ty for the loop pa­ram­e­ters and feeds the 3-phase lin­ear power driv­er. The per­for­mance of the pr...

  20. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...