WorldWideScience

Sample records for wax-patterned nc membrane

  1. Water Activated Graphene Oxide Transfer Using Wax Printed Membranes for Fast Patterning of a Touch Sensitive Device.

    Science.gov (United States)

    Baptista-Pires, Luis; Mayorga-Martínez, Carmen C; Medina-Sánchez, Mariana; Montón, Helena; Merkoçi, Arben

    2016-01-26

    We demonstrate a graphene oxide printing technology using wax printed membranes for the fast patterning and water activation transfer using pressure based mechanisms. The wax printed membranes have 50 μm resolution, longtime stability and infinite shaping capability. The use of these membranes complemented with the vacuum filtration of graphene oxide provides the control over the thickness. Our demonstration provides a solvent free methodology for printing graphene oxide devices in all shapes and all substrates using the roll-to-roll automatized mechanism present in the wax printing machine. Graphene oxide was transferred over a wide variety of substrates as textile or PET in between others. Finally, we developed a touch switch sensing device integrated in a LED electronic circuit.

  2. Comparison the Marginal and Internal Fit of Metal Copings Cast from Wax Patterns Fabricated by CAD/CAM and Conventional Wax up Techniques

    Science.gov (United States)

    Vojdani, M; Torabi, K; Farjood, E; Khaledi, AAR

    2013-01-01

    Statement of Problem: Metal-ceramic crowns are most commonly used as the complete coverage restorations in clinical daily use. Disadvantages of conventional hand-made wax-patterns introduce some alternative ways by means of CAD/CAM technologies. Purpose: This study compares the marginal and internal fit of copings cast from CAD/CAM and conventional fabricated wax-patterns. Materials and Method: Twenty-four standardized brass dies were prepared and randomly divided into 2 groups according to the wax-patterns fabrication method (CAD/CAM technique and conventional method) (n=12). All the wax-patterns were fabricated in a standard fashion by means of contour, thickness and internal relief (M1-M12: representative of CAD/CAM group, C1-C12: representative of conventional group). CAD/CAM milling machine (Cori TEC 340i; imes-icore GmbH, Eiterfeld, Germany) was used to fabricate the CAD/CAM group wax-patterns. The copings cast from 24 wax-patterns were cemented to the corresponding dies. For all the coping-die assemblies cross-sectional technique was used to evaluate the marginal and internal fit at 15 points. The Student’s t- test was used for statistical analysis (α=0.05). Results: The overall mean (SD) for absolute marginal discrepancy (AMD) was 254.46 (25.10) um for CAD/CAM group and 88.08(10.67) um for conventional group (control). The overall mean of internal gap total (IGT) was 110.77(5.92) um for CAD/CAM group and 76.90 (10.17) um for conventional group. The Student’s t-test revealed significant differences between 2 groups. Marginal and internal gaps were found to be significantly higher at all measured areas in CAD/CAM group than conventional group (pmarginal and internal fit than CAD/CAM (machine-milled) technique. All the factors for 2 groups were standardized except wax pattern fabrication technique, therefore, only the conventional group results in copings with clinically acceptable margins of less than 120um. PMID:24724133

  3. A comparison of the accuracy of patterns processed from an inlay casting wax, an auto-polymerized resin and a light-cured resin pattern material.

    Science.gov (United States)

    Rajagopal, Praveen; Chitre, Vidya; Aras, Meena A

    2012-01-01

    Traditionally, inlay casting waxes have been used to fabricate patterns for castings. Newer resin pattern materials offer greater rigidity and strength, allowing easier laboratory and intraoral adjustment without the fear of pattern damage. They also claim to possess a greater dimensional stability when compared to inlay wax. This study attempted to determine and compare the marginal accuracy of patterns fabricated from an inlay casting wax, an autopolymerized pattern resin and a light polymerized pattern resin on storage off the die for varying time intervals. Ten patterns each were fabricated from an inlay casting wax (GC Corp., Tokyo, Japan), an autopolymerized resin pattern material (Pattern resin, GC Corp, Tokyo, Japan) and a light-cured resin pattern material (Palavit GLC, Hereaus Kulzer GmbH, Germany). The completed patterns were stored off the die at room temperature. Marginal gaps were evaluated by reseating the patterns on their respective dies and observing it under a stereomicroscope at 1, 12, and 24 h intervals after pattern fabrication. The results revealed that the inlay wax showed a significantly greater marginal discrepancy at the 12 and 24 h intervals. The autopolymerized resin showed an initial (at 1 h) marginal discrepancy slightly greater than inlay wax, but showed a significantly less marginal gap (as compared to inlay wax) at the other two time intervals. The light-cured resin proved to be significantly more dimensionally stable, and showed minimal change during the storage period. The resin pattern materials studied, undergo a significantly less dimensional change than the inlay waxes on prolonged storage. They would possibly be a better alternative to inlay wax in situations requiring high precision or when delayed investment (more than 1 h) of patterns can be expected.

  4. Three-dimensional wax patterning of paper fluidic devices.

    Science.gov (United States)

    Renault, Christophe; Koehne, Jessica; Ricco, Antonio J; Crooks, Richard M

    2014-06-17

    In this paper we describe a method for three-dimensional wax patterning of microfluidic paper-based analytical devices (μPADs). The method is rooted in the fundamental details of wax transport in paper and provides a simple way to fabricate complex channel architectures such as hemichannels and fully enclosed channels. We show that three-dimensional μPADs can be fabricated with half as much paper by using hemichannels rather than ordinary open channels. We also provide evidence that fully enclosed channels are efficiently isolated from the exterior environment, decreasing contamination risks, simplifying the handling of the device, and slowing evaporation of solvents.

  5. The deformation of wax patterns and castings in investment casting technology

    Directory of Open Access Journals (Sweden)

    A. Herman

    2012-01-01

    Full Text Available The dimensional accuracy of the final casting of Inconel alloy 738 LC is affected by many aspects. One of them is the choice of method and time of cooling wax model for precision investment casting. The main objective was to study the initial deformation of the complex shape of the casting of the rotor blades. Various approaches have been tested for cooling wax pattern. When wax models are cooling on the air, without clamping in jig for cooling, deviations from the ideal shape of the casting are very noticeable (up to 8 mm and most are in extreme positions of the model. When blade is cooled in fixing jig in water environment, the resulting deviations compared with cooling in air are significantly larger, sometimes up to 10 mm. This itself does not mean that the final shape of the casting is dimensionally more accurate with usage of wax models, which have deviations from the ideal position smaller. Another deformation occurs when shell mould is produced around wax pattern and furthermore deformations emerge while casting of blade is cooling. This paper demonstrates first steps in describing complex process of deformations of Inconel alloy blades produced with investment casting technology by comparing results from thermal imagery, simulations in foundry simulation software ProCAST 2010 and measurements from CNC scanning system Carl Zeiss MC 850. Conclusions are so far not groundbreaking, but it seems deformations of wax pattern and deformations of castings do in some cases cancel each other by having opposite directions. Describing entirely whole process of deformations will help increase precision of blade castings so that models at the beginning and blades in the end are the same.

  6. Wax-bonding 3D microfluidic chips

    KAUST Repository

    Gong, Xiuqing; Yi, Xin; Xiao, Kang; Li, Shunbo; Kodzius, Rimantas; Qin, Jianhua; Wen, Weijia

    2013-01-01

    We report a simple, low-cost and detachable microfluidic chip incorporating easily accessible paper, glass slides or other polymer films as the chip materials along with adhesive wax as the recycling bonding material. We use a laser to cut through the paper or film to form patterns and then sandwich the paper and film between glass sheets or polymer membranes . The hot-melt adhesive wax can realize bridge bonding between various materials, for example, paper, polymethylmethacrylate (PMMA) film, glass sheets, or metal plate. The bonding process is reversible and the wax is reusable through a melting and cooling process. With this process, a three-dimensional (3D) microfluidic chip is achievable by vacuating and venting the chip in a hot-water bath. To study the biocompatibility and applicability of the wax-based microfluidic chip, we tested the PCR compatibility with the chip materials first. Then we applied the wax-paper based microfluidic chip to HeLa cell electroporation (EP ). Subsequently, a prototype of a 5-layer 3D chip was fabricated by multilayer wax bonding. To check the sealing ability and the durability of the chip, green fluorescence protein (GFP) recombinant Escherichia coli (E. coli) bacteria were cultured, with which the chemotaxis of E. coli was studied in order to determine the influence of antibiotic ciprofloxacin concentration on the E. coli migration.

  7. Wax-bonding 3D microfluidic chips

    KAUST Repository

    Gong, Xiuqing

    2013-10-10

    We report a simple, low-cost and detachable microfluidic chip incorporating easily accessible paper, glass slides or other polymer films as the chip materials along with adhesive wax as the recycling bonding material. We use a laser to cut through the paper or film to form patterns and then sandwich the paper and film between glass sheets or polymer membranes . The hot-melt adhesive wax can realize bridge bonding between various materials, for example, paper, polymethylmethacrylate (PMMA) film, glass sheets, or metal plate. The bonding process is reversible and the wax is reusable through a melting and cooling process. With this process, a three-dimensional (3D) microfluidic chip is achievable by vacuating and venting the chip in a hot-water bath. To study the biocompatibility and applicability of the wax-based microfluidic chip, we tested the PCR compatibility with the chip materials first. Then we applied the wax-paper based microfluidic chip to HeLa cell electroporation (EP ). Subsequently, a prototype of a 5-layer 3D chip was fabricated by multilayer wax bonding. To check the sealing ability and the durability of the chip, green fluorescence protein (GFP) recombinant Escherichia coli (E. coli) bacteria were cultured, with which the chemotaxis of E. coli was studied in order to determine the influence of antibiotic ciprofloxacin concentration on the E. coli migration.

  8. Evaluation of experimental data for wax and diamondoids solubility in gaseous systems

    DEFF Research Database (Denmark)

    Mohammadi, Amir H.; Gharagheizi, Farhad; Eslamimanesh, Ali

    2012-01-01

    The Leverage statistical approach is herein applied for evaluation of experimental data of the paraffin waxes/diamondoids solubility in gaseous systems. The calculation steps of this algorithm consist of determination of the statistical Hat matrix, sketching the Williams Plot, and calculation......-Santiago and Teja correlations are used to calculate/estimate the solubility of paraffin waxes (including n-C24H50 to n-C33H68) and diamondoids (adamantane and diamantane) in carbon dioxide/ethane gases, respectively. It can be interpreted from the obtained results that the applied equations for calculation...

  9. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    National Research Council Canada - National Science Library

    Kim, Byung

    1997-01-01

    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  10. Twist on protein microarrays: layering wax-patterned nitrocellulose to create customizable and separable arrays of multiplexed affinity columns.

    Science.gov (United States)

    de Lange, Victoria; Vörös, János

    2014-05-06

    We developed the simple and inexpensive FoRe microarray to simultaneously test several 1 μL samples for multiple proteins. By combining forward and reverse phase microarrays into an innovative three-dimensional format, the FoRe array exploits the advantages and eliminates several drawbacks of the traditional approaches (i.e., large sample volumes, protein loss, and cross-reactivity between detection antibodies). Samples are pipetted into an array of separable, multiplexed affinity columns. Several nitrocellulose membranes, each functionalized with a different capture antibody, are stacked to create a customizable affinity column. The nitrocellulose is patterned with wax to form 25 isolated microspots on each layer, allowing us to analyze multiple samples in parallel. After running the immunoassay, the stacks are quickly disassembled, revealing 2D microarrays of different fractions from multiple samples. By combining the stack-and-separate technique with wax patterning, we keep the arrays low cost and easily tailored to a variety of applications. We successfully performed 3D multiplexing using a model system with mouse and rabbit IgG. Binding proved to be independent of the position in the stack, and the limit of detection for a mouse IgG sandwich assay was 7.3 pM in BSA and 15 pM in human plasma. The FoRe microarray makes it possible to identify protein expression patterns across several minute volume samples; for example, it could be used to analyze cell lysate in drug response studies or pricks of blood from small animal studies.

  11. Laser micromachined wax-covered plastic paper as both sputter deposition shadow masks and deep-ultraviolet patterning masks for polymethylmethacrylate-based microfluidic systems

    KAUST Repository

    Fan, Yiqiang

    2013-12-16

    We report a technically innovative method of fabricating masks for both deep-ultraviolet (UV) patterning and metal sputtering on polymethylmethacrylate (PMMA) for microfluidic systems. We used a CO2 laser system to cut the required patterns on wax-covered plastic paper; the laser-patterned wax paper will either work as a mask for deep-UV patterning or as a mask for metal sputtering. A microfluidic device was also fabricated to demonstrate the feasibility of this method. The device has two layers: the first layer is a 1-mm thick PMMA substrate that was patterned by deep-UV exposure to create microchannels. The mask used in this process was the laser-cut wax paper. The second layer, also a 1-mm thick PMMA layer, was gold sputtered with patterned wax paper as the shadow mask. These two pieces of PMMA were then bonded to form microchannels with exposed electrodes. This process is a simple and rapid method for creating integrated microfluidic systems that do not require cleanroom facilities.

  12. 21 CFR 872.6890 - Intraoral dental wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Intraoral dental wax. 872.6890 Section 872.6890...) MEDICAL DEVICES DENTAL DEVICES Miscellaneous Devices § 872.6890 Intraoral dental wax. (a) Identification. Intraoral dental wax is a device made of wax intended to construct patterns from which custom made metal...

  13. Evaluation of Physical Properties of Wax Mixtures Obtained From Recycling of Patterns Used in Precision Casting

    Directory of Open Access Journals (Sweden)

    Biernacki R.

    2015-04-01

    Full Text Available The study investigated the properties of selected certified mixtures used to make wax patterns for the production of precision castings for the aerospace industry. In addition, an assessment of the recycled mixtures consisting of certified wax materials recovered during autoclaving was carried out. Hardness was tested via a proposed method based on penetration, creep related deformation, bending strength and linear contraction. The hardness was studied on laboratory specimens and patterns made with the use of injection molding equipment. For these patterns, linear contraction was estimated at variable pressure and for different temperature injection parameters. Deformations connected with creep and resistance were evaluated on cylindrical specimens. Differences in creep resistance in relation to the hardness were observed depending on the type of pattern mixtures. Recycled mixture has a greater resistance and smaller linear contraction than certified mixtures used for making sprue, raisers and other parts of filler system.

  14. Polarized luminescence of nc-Si-SiO x nanostructures on silicon substrates with patterned surface

    Science.gov (United States)

    Michailovska, Katerina; Mynko, Viktor; Indutnyi, Ivan; Shepeliavyi, Petro

    2018-05-01

    Polarization characteristics and spectra of photoluminescence (PL) of nc-Si-SiO x structures formed on the patterned and plane c-Si substrates are studied. The interference lithography with vacuum chalcogenide photoresist and anisotropic wet etching are used to form a periodic relief (diffraction grating) on the surface of the substrates. The studied nc-Si-SiO x structures were produced by oblique-angle deposition of Si monoxide in vacuum and the subsequent high-temperature annealing. The linear polarization memory (PM) effect in PL of studied structure on plane substrate is manifested only after the treatment of the structures in HF and is explained by the presence of elongated Si nanoparticles in the SiO x nanocolumns. But the PL output from the nc-Si-SiO x structure on the patterned substrate depends on how this radiation is polarized with respect to the grating grooves and is much less dependent on the polarization of the exciting light. The measured reflection spectra of nc-Si-SiO x structure on the patterned c-Si substrate confirmed the influence of pattern on the extraction of polarized PL.

  15. Ear wax

    Science.gov (United States)

    See your provider if your ears are blocked with wax and you are unable to remove the wax. Also call if you have an ear wax blockage and you develop new symptoms, such as: Drainage from the ear Ear pain Fever Hearing loss that continues after you clean the wax

  16. Laser micromachined wax-covered plastic paper as both sputter deposition shadow masks and deep-ultraviolet patterning masks for polymethylmethacrylate-based microfluidic systems

    KAUST Repository

    Fan, Yiqiang; Li, Huawei; Yi, Ying; Foulds, Ian G.

    2013-01-01

    We report a technically innovative method of fabricating masks for both deep-ultraviolet (UV) patterning and metal sputtering on polymethylmethacrylate (PMMA) for microfluidic systems. We used a CO2 laser system to cut the required patterns on wax

  17. Gluconeogenesis from storage wax in the cotyledons of jojoba seedlings.

    Science.gov (United States)

    Moreau, R A; Huang, A H

    1977-08-01

    The cotyledons of jojoba (Simmondsia chinensis) seeds contained 50 to 60% of their weight as intracellular wax esters. During germination there was a gradual decrease in the wax content with a concomitant rise in soluble carbohydrates, suggesting that the wax played the role of a food reserve. Thin layer chromatography revealed that both the fatty alcohol and fatty acid were metabolized. The disappearance of wax was matched with an increase of catalase, a marker enzyme of the gluconeogenic process in other fatty seedlings. Subcellular organelles were isolated by sucrose gradient centrifugation from the cotyledons at the peak stage of germination. The enzymes of the beta oxidation of fatty acid and of the glyoxylate cycle were localized in the glyoxysomes but not in the mitochondria. The glyoxysomes had specific activities of individual enzymes similar to those of the castor bean glyoxysomes. An active alkaline lipase was detected in the wax bodies at the peak stage of germination but not in the ungerminated seeds. No lipase was detected in glyoxysomes or mitochondria. After the wax in the wax bodies had been extracted with diethyl ether, the organelle membrane was isolated and it still retained the alkaline lipase. The gluconeogenesis from wax in the jojoba seedling appears to be similar, but with modification, to that from triglyceride in other fatty seedlings.

  18. Effects of cuticular wax on the postharvest quality of blueberry fruit.

    Science.gov (United States)

    Chu, Wenjing; Gao, Haiyan; Chen, Hangjun; Fang, Xiangjun; Zheng, Yonghua

    2018-01-15

    The blueberry fruit has a light-blue appearance because its blue-black skin is covered with a waxy bloom. This layer is easily damaged or removed during fruit harvesting and postharvest handling. We investigated the effects of wax removal on the postharvest quality of blueberry fruit and their possible mechanisms. The removal of natural wax on the fruit was found to accelerate the postharvest water loss and decay, reduce the sensory and nutritional qualities, and shorten the shelf-life. Wax removal decreased the activities of antioxidant enzymes and contents of antioxidants, and accelerated accumulation of ROS and lipid peroxidation, especially at the later period of storage. Moreover, the organellar membrane structure was disrupted in fruit with wax removed. These results indicate that cuticular wax plays an important role in maintaining the postharvest quality and delaying fruit senescence. The results should improve our understanding for better preservation of postharvest quality of blueberry fruit. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Statistical Optimization of Sustained Release Venlafaxine HCI Wax Matrix Tablet.

    Science.gov (United States)

    Bhalekar, M R; Madgulkar, A R; Sheladiya, D D; Kshirsagar, S J; Wable, N D; Desale, S S

    2008-01-01

    The purpose of this research was to prepare a sustained release drug delivery system of venlafaxine hydrochloride by using a wax matrix system. The effects of bees wax and carnauba wax on drug release profile was investigated. A 3(2) full factorial design was applied to systemically optimize the drug release profile. Amounts of carnauba wax (X(1)) and bees wax (X(2)) were selected as independent variables and release after 12 h and time required for 50% (t(50)) drug release were selected as dependent variables. A mathematical model was generated for each response parameter. Both waxes retarded release after 12 h and increases the t(50) but bees wax showed significant influence. The drug release pattern for all the formulation combinations was found to be approaching Peppas kinetic model. Suitable combination of two waxes provided fairly good regulated release profile. The response surfaces and contour plots for each response parameter are presented for further interpretation of the results. The optimum formulations were chosen and their predicted results found to be in close agreement with experimental findings.

  20. Gluconeogenesis from Storage Wax in the Cotyledons of Jojoba Seedlings 1

    Science.gov (United States)

    Moreau, Robert A.; Huang, Anthony H. C.

    1977-01-01

    The cotyledons of jojoba (Simmondsia chinensis) seeds contained 50 to 60% of their weight as intracellular wax esters. During germination there was a gradual decrease in the wax content with a concomitant rise in soluble carbohydrates, suggesting that the wax played the role of a food reserve. Thin layer chromatography revealed that both the fatty alcohol and fatty acid were metabolized. The disappearance of wax was matched with an increase of catalase, a marker enzyme of the gluconeogenic process in other fatty seedlings. Subcellular organelles were isolated by sucrose gradient centrifugation from the cotyledons at the peak stage of germination. The enzymes of the β oxidation of fatty acid and of the glyoxylate cycle were localized in the glyoxysomes but not in the mitochondria. The glyoxysomes had specific activities of individual enzymes similar to those of the castor bean glyoxysomes. An active alkaline lipase was detected in the wax bodies at the peak stage of germination but not in the ungerminated seeds. No lipase was detected in glyoxysomes or mitochondria. After the wax in the wax bodies had been extracted with diethyl ether, the organelle membrane was isolated and it still retained the alkaline lipase. The gluconeogenesis from wax in the jojoba seedling appears to be similar, but with modification, to that from triglyceride in other fatty seedlings. Images PMID:16660087

  1. A comparative evaluation of the marginal adaptation of a thermoplastic resin, a light cured wax and an inlay casting wax on stone dies: An in vitro study.

    Science.gov (United States)

    Gopalan, Reji P; Nair, Vivek V; Harshakumar, K; Ravichandran, R; Lylajam, S; Viswambaran, Prasanth

    2018-01-01

    Different pattern materials do not produce copings with satisfactory, marginal accuracy when used on stone dies at varying time intervals. The purpose of this study was to evaluate and compare the vertical marginal accuracy of patterns formed from three materials, namely, thermoplastic resin, light cured wax and inlay casting wax at three-time intervals of 1, 12, and 24 h. A master die (zirconia abutment mimicking a prepared permanent maxillary central incisor) and metal sleeve (direct metal laser sintering crown #11) were fabricated. A total of 30 stone dies were obtained from the master die. Ten patterns were made each from the three materials and stored off the die at room temperature. The vertical marginal gaps were measured using digital microscope at 1, 12, and 24 h after reseating with gentle finger pressure. The results revealed a significant statistical difference in the marginal adaptation of three materials at all the three-time intervals. Light cured wax was found to be most accurate at all time intervals, followed by thermoplastic resin and inlay casting wax. Furthermore, there was a significant difference between all pairs of materials. The change in vertical marginal gap from 1 to 24 h between thermoplastic resin and light cured wax was not statistically significant. The marginal adaptation of all the three materials used, was well within the acceptable range of 25-70 μm. The resin pattern materials studied revealed significantly less dimensional change than inlay casting wax on storage at 1, 12, and 24 h time intervals. They may be employed in situations where high precision and delayed investing is expected.

  2. Micro-and/or nano-scale patterned porous membranes, methods of making membranes, and methods of using membranes

    KAUST Repository

    Wang, Xianbin; Chen, Wei; Wang, Zhihong; Zhang, Xixiang; Yue, Weisheng; Lai, Zhiping

    2015-01-01

    Embodiments of the present disclosure provide for materials that include a pre-designed patterned, porous membrane (e.g., micro- and/or nano-scale patterned), structures or devices that include a pre-designed patterned, porous membrane, methods of making pre-designed patterned, porous membranes, methods of separation, and the like.

  3. Micro-and/or nano-scale patterned porous membranes, methods of making membranes, and methods of using membranes

    KAUST Repository

    Wang, Xianbin

    2015-01-22

    Embodiments of the present disclosure provide for materials that include a pre-designed patterned, porous membrane (e.g., micro- and/or nano-scale patterned), structures or devices that include a pre-designed patterned, porous membrane, methods of making pre-designed patterned, porous membranes, methods of separation, and the like.

  4. Investigation of liquid wax components of Egyptian jojoba seeds.

    Science.gov (United States)

    El-Mallah, Mohammed Hassan; El-Shami, Safinaz Mohammed

    2009-01-01

    Egyptian jojoba seeds newly cultivated in Ismailia desert in Egypt promoted us to determine its lipid components. Fatty alcohols, fatty acids, wax esters and sterols patterns were determined by capillary GLC whereas, tocopherols profile, isopropenoid alcohols and sterylglycosides were determined by HPLC. The Egyptian seeds are rich in wax esters (55 %) with fatty alcohols C20:1 and C22:1 as major components and amounted to 43.0 % and 45.6 % respectively followed by C24:1 and C18:1(9.6 % and 1.3 % respectively). The fatty acids profile showed that C20:1 is the major constituent (60 %) followed by C18:1 and C22:1 (14.5 and 11.8 % respectively) whereas C24:1 was present at low concentration amounted to 1.6 %. In addition, the Egyptian jojoba wax contained C18:2 fatty acid at a level of 8.7 %. Wax esters composition showed that the local wax had C42 and C40 esters as major components amounted to 51.1 and 30.1 % respectively. Also, it had C44 and C38 at reasonable amounts (10.0 and 6.3 % respectively). Whereas C36 and C46 were present at lower concentrations amounted to 1.4 and 1.1 respectively. The sterols analysis showed the presence of campe-, stigma-, beta-sito-, and isofuco- sterol amounting to 18.4 %, 6.9 %, 68.7 %, and 6.0 % respectively. The tocopherols pattern revealed that the local seed wax contained gamma-tocopherol as major constituent (79.2 %) followed by alpha-tocopherol (20.3 %). beta-tocopherol as well as delta-tocopherol were found as minor constituents. The isopropenoid alcohols and the sterylglycosides (free and acylated) were not detected. The wax is proposed to be used in oleo chemistry and cosmetics.

  5. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  6. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  7. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  8. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  9. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  10. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  11. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

  12. Diversity of cuticular wax among Salix species and Populus species hybrids.

    Science.gov (United States)

    Cameron, Kimberly D; Teece, Mark A; Bevilacqua, Eddie; Smart, Lawrence B

    2002-08-01

    The leaf cuticular waxes of three Salix species and two Populus species hybrids, selected for their ability to produce high amounts of biomass, were characterized. Samples were extracted in CH(2)Cl(2) three times over the growing season. Low kV SEM was utilized to observe differences in the ultrastructure of leaf surfaces from each clone. Homologous series of wax components were classified into organic groups, and the variation in wax components due to clone, sample time, and their interaction was identified. All Salix species and Populus species hybrids showed differences in total wax load at each sampling period, whereas the pattern of wax deposition over time differed only between the Salix species. A strong positive relationship was identified between the entire homologous series of alcohols and total wax load in all clones. Similarly strong relationships were observed between fatty acids and total wax load as well as fatty acids and alcohols in two Salix species and one Populus species hybrid. One Salix species, S. dasyclados, also displayed a strong positive relationship between alcohols and alkanes. These data indicate that species grown under the same environmental conditions produce measurably different cuticular waxes and that regulation of wax production appears to be different in each species. The important roles cuticular waxes play in drought tolerance, pest, and pathogen resistance, as well as the ease of wax extraction and analysis, strongly suggest that the characteristics of the cuticular wax may prove to be useful selectable traits in a breeding program.

  13. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

  14. ORF Alignment: NC_004603 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

  15. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

  16. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

  17. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

  18. Printing-assisted surface modifications of patterned ultrafiltration membranes

    International Nuclear Information System (INIS)

    Wardrip, Nathaniel C.; Dsouza, Melissa; Urgun-Demirtas, Meltem; Snyder, Seth W.

    2016-01-01

    Understanding and restricting microbial surface attachment will enhance wastewater treatment with membranes. We report a maskless lithographic patterning technique for the generation of patterned polymer coatings on ultrafiltration membranes. Polyethylene glycol, zwitterionic, or negatively charged hydrophilic polymer compositions in parallel- or perpendicular-striped patterns with respect to feed flow were evaluated using wastewater. Membrane fouling was dependent on the orientation and chemical composition of the coatings. Modifications reduced alpha diversity in the attached microbial community (Shannon indices decreased from 2.63 to 1.89) which nevertheless increased with filtration time. Sphingomonas species, which condition membrane surfaces and facilitate cellular adhesion, were depleted in all modified membranes. Microbial community structure was significantly different between control, different patterns, and different chemistries. Lastly, this study broadens the tools for surface modification of membranes with polymer coatings and for understanding and optimization of antifouling surfaces.

  19. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  20. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

  1. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  2. ORF Alignment: NC_004917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

  3. Effects of wax treatment on quality and postharvest physiology of ...

    African Journals Online (AJOL)

    ... cell membrane permeability and malondialdehyde content when compared with those in control. This waxing also improved total sugars and the contents of ascorbic acid in pineapple fruits. These results suggested that this treatment might be a useful technique to alleviate chilling injury and maintain fruit quality during ...

  4. Understanding the distribution of natural wax in starch-wax films using synchrotron-based FTIR (S-FTIR).

    Science.gov (United States)

    Muscat, Delina; Tobin, Mark J; Guo, Qipeng; Adhikari, Benu

    2014-02-15

    High amylose starch-glycerol (HAG) films were produced incorporating beeswax, candelilla wax and carnauba wax in the presence and absence of Tween-80 in order to determine the distribution of wax in the films during the film formation process. The distribution of these waxes within the film was studied using Synchrotron based Fourier Transform Infrared Spectroscopy (S-FTIR) which provided 2D mapping along the thickness of the film. The incorporation of 5% and 10% wax in HAG films produced randomly distributed wax or wax-rich domains, respectively, within these films. Consequently, the addition of these waxes to HAG increased the surface roughness and hydrophobicity of these films. The addition of Tween-80 caused variations in wax-rich bands within the films. The HAG+carnauba wax+Tween-80 films exhibited domed wax-rich domains displayed with high integrated CH2 absorption value at the interior of the films, rougher surface and higher contact angle values than the other films. The S-FTIR 2D images indicated that the distribution of wax in starch-wax films correlated with the roughness and hydrophobicity of the starch-wax films. Copyright © 2013 Elsevier Ltd. All rights reserved.

  5. Nest wax triggers worker reproduction in the bumblebee Bombus terrestris.

    Science.gov (United States)

    Rottler-Hoermann, Ann-Marie; Schulz, Stefan; Ayasse, Manfred

    2016-01-01

    Social insects are well known for their high level of cooperation. Workers of the primitively eusocial bumblebee Bombus terrestris are able to produce male offspring in the presence of a queen. Nonetheless, they only compete for reproduction, in the so-called competition phase, when the workforce is large enough to support the rearing of reproductives. So far, little is known about the proximate mechanisms underlying the shift between altruism and selfish behaviour in bumblebee workers. In this study, we have examined the influence of chemical cues from the nest wax on the onset of worker reproduction. Chemical analyses of wax extracts have revealed that the patterns and amounts of cuticular lipids change considerably during colony development. These changes in wax scent mirror worker abundance and the presence of fertile workers. In bioassays with queen-right worker groups, wax affects the dominance behaviour and ovarian development of workers. When exposed to wax from a colony in competition phase, workers start to compete for reproduction. We suggest that wax scent enables workers to time their reproduction by providing essential information concerning the social condition of the colony.

  6. Development and properties of a wax ester hydrolase in the cotyledons of jojoba seedlings.

    Science.gov (United States)

    Huang, A H; Moreau, R A; Liu, K D

    1978-03-01

    The activity of a wax ester hydrolase in the cotyledons of jojoba (Simmondsia chinensis) seedlings increased drastically during germination, parallel to the development of the gluconeogenic process. The enzyme at its peak of development was obtained in association with the wax body membrane, and its properties were studied. It had an optimal activity at alkaline pH (8.5-9). The apparent K(m) value for N-methylindoxylmyristate was 93 muM. It was stable at 40 C for 30 min but was inactivated at higher temperature. Various divalent cations and ethylenediaminetetraacetate had little effect on the activity. p-Chloromercuribenzoate was a strong inhibitor of the enzyme activity, and its effect was reversed by subsequent addition of dithiothreitol. It had a broad substrate specificity with highest activities on monoglycerides, wax esters, and the native substrate (jojoba wax).

  7. In search of low cost biological analysis: Wax or acrylic glue bonded paper microfluidic devices

    KAUST Repository

    Kodzius, Rimantas; Gong, Xiuqing; Li, Shunbo; Qin, Jianhua; Wen, Weijia; Wu, Jinbo; Xiao, Kang; Yi, Xin

    2011-01-01

    We report a simple, low-cost and detachable microfluidic chip incorporating easily accessible paper, glass slides or other polymer films as the chip materials along with adhesive wax or cyanoacrylate-based resin as the recycling bonding material. We use a laser to cut through the paper or film to form patterns and then sandwich the paper and film between glass sheets or polymer membranes. The hot-melt adhesive wax or simple cyanoacrylate-based resin can realize bridge bonding between various materials, for example, paper, polymethylmethacrylate film, glass sheets, or metal plate. The wax bonding process is reversible and the wax is reusable through a melting and cooling process. With this process, a three-dimensional (3D) microfluidic chip is achievable by evacuating the channels of adhesive material in a hot-water. We applied the wax-paper based microfluidic chip to HeLa cell electroporation. Subsequently, a prototype of a 5-layer 3D chip was fabricated by multilayer wax bonding. To check the sealing ability and the durability of the chip, green fluorescence protein recombinant E. coli bacteria were cultured, with which the chemotaxis of E. coli was studied in order to determine the influence of antibiotic ciprofloxacin concentration on the E. coli migration. The chip bonded with cyanoacrylate-based resin was tested by measuring protein concentration and carrying out DNA capillary electrophoresis. To study the biocompatibility and applicability of our microfluidic chip fabrication technology, we tested the PCR compatibility of our chip materials along with various other common materials employed in the fabrication of microfluidic chips including: silicon, several kinds of silicon oxide, glasses, plastics, wax, and adhesives, etc. Two-temperature PCR was performed with these materials to determine their PCR-inhibitory effect. In most of the cases, addition of bovine serum albumin effectively improved the reaction yield. We also studied the individual PCR components

  8. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  9. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  10. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  11. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  12. ORF Alignment: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  13. ORF Alignment: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  14. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  15. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  16. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  17. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  18. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  19. Physical properties of beeswax, sunflower wax, and candelilla wax mixtures and organogels

    Science.gov (United States)

    There is increased interest in natural waxes as alternatives to partially hydrogenated oils and saturated fats as oil structuring agents. Using relatively low concentrations (0.5-5%), natural waxes are able to form crystalline networks, or organogels, which bind liquid oil. Each natural wax is uniqu...

  20. Effect of spatial distribution of wax and PEG-isocyanate on the morphology and hydrophobicity of starch films.

    Science.gov (United States)

    Muscat, Delina; Adhikari, Raju; Tobin, Mark J; McKnight, Stafford; Wakeling, Lara; Adhikari, Benu

    2014-10-13

    This study proposes a novel method for improving surface hydrophobicity of glycerol plasticized high amylose (HAG) films. We used polyethylene glycol isocyanate (PEG-iso) crosslinker to link HAG and three natural waxes (beeswax, candelilla wax and carnauba wax) to produce HAG+wax+PEG-iso films. The spatial distributions of wax and PEG-iso across the thickness of these films were determined using Synchrotron-based Fourier transform infrared spectroscopy. The hydrophobicity and surface morphology of the films were determined using contact angle (CA) and scanning electron microscopic measurements, respectively. The distribution patterns of wax and the PEG-iso across the thickness of the film, and the nature of crystalline patterns formed on the surface of these films were found to be the key factors affecting surface hydrophobicity. The highest hydrophobicity (CA >90°) was created when the PEG-iso was primarily distributed in the interior of the films and a hierarchical circular pinnacle structure of solidified wax was formed on the surface. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479866 >1u07A 1 90 153 242 2e-32 ... ref|NP_707161.2| membrane protein, energy... transducer [Shigella flexneri 2a str. 301] ... gb|AAN42868.2| membrane protein, energy trans...ducer ... [Shigella flexneri 2a str. 301] ref|NP_836946.1| ... membrane protein, energy transd...ucer [Shigella flexneri ... 2a str. 2457T] gb|AAP16753.1| membrane protein, energy

  2. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15831006 >1u07A 1 90 153 242 2e-32 ... ref|NP_707161.2| membrane protein, energy... transducer [Shigella flexneri 2a str. 301] ... gb|AAN42868.2| membrane protein, energy trans...ducer ... [Shigella flexneri 2a str. 301] ref|NP_836946.1| ... membrane protein, energy transd...ucer [Shigella flexneri ... 2a str. 2457T] gb|AAP16753.1| membrane protein, energy

  3. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062775 >1u07A 1 90 153 242 2e-32 ... ref|NP_707161.2| membrane protein, energy... transducer [Shigella flexneri 2a str. 301] ... gb|AAN42868.2| membrane protein, energy trans...ducer ... [Shigella flexneri 2a str. 301] ref|NP_836946.1| ... membrane protein, energy transd...ucer [Shigella flexneri ... 2a str. 2457T] gb|AAP16753.1| membrane protein, energy

  4. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16129213 >1u07A 1 90 153 242 2e-32 ... ref|NP_707161.2| membrane protein, energy... transducer [Shigella flexneri 2a str. 301] ... gb|AAN42868.2| membrane protein, energy trans...ducer ... [Shigella flexneri 2a str. 301] ref|NP_836946.1| ... membrane protein, energy transd...ucer [Shigella flexneri ... 2a str. 2457T] gb|AAP16753.1| membrane protein, energy

  5. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247582 >1u07A 1 90 153 242 2e-32 ... ref|NP_707161.2| membrane protein, energy... transducer [Shigella flexneri 2a str. 301] ... gb|AAN42868.2| membrane protein, energy trans...ducer ... [Shigella flexneri 2a str. 301] ref|NP_836946.1| ... membrane protein, energy transd...ucer [Shigella flexneri ... 2a str. 2457T] gb|AAP16753.1| membrane protein, energy

  6. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51595742 >1iwlA 1 181 22 202 2e-59 ... ref|YP_069933.1| putative outer-membrane lipoproteins...tis KIM] ... ref|NP_404970.1| putative outer-membrane lipoproteins ... ... ... carrier protein [Yersinia pestis CO92] emb|CAC90206.1| ... putative outer-membrane lipoproteins c...arrier protein ... [Yersinia pestis CO92] emb|CAH20642.1| putative ... outer-membrane lipoproteins...8 probable ... outer-membrane lipoproteins carrier protein lolA ... [imported] - Yersinia pest

  7. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004088 gi|22126675 >1iwlA 1 181 22 202 2e-59 ... ref|YP_069933.1| putative outer-membrane lipoproteins...tis KIM] ... ref|NP_404970.1| putative outer-membrane lipoproteins ... ... ... carrier protein [Yersinia pestis CO92] emb|CAC90206.1| ... putative outer-membrane lipoproteins c...arrier protein ... [Yersinia pestis CO92] emb|CAH20642.1| putative ... outer-membrane lipoproteins...8 probable ... outer-membrane lipoproteins carrier protein lolA ... [imported] - Yersinia pest

  8. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121657 >1iwlA 1 181 22 202 2e-59 ... ref|YP_069933.1| putative outer-membrane lipoproteins...tis KIM] ... ref|NP_404970.1| putative outer-membrane lipoproteins ... ... ... carrier protein [Yersinia pestis CO92] emb|CAC90206.1| ... putative outer-membrane lipoproteins c...arrier protein ... [Yersinia pestis CO92] emb|CAH20642.1| putative ... outer-membrane lipoproteins...8 probable ... outer-membrane lipoproteins carrier protein lolA ... [imported] - Yersinia pest

  9. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45441043 >1iwlA 1 181 22 202 2e-59 ... ref|YP_069933.1| putative outer-membrane lipoproteins...tis KIM] ... ref|NP_404970.1| putative outer-membrane lipoproteins ... ... ... carrier protein [Yersinia pestis CO92] emb|CAC90206.1| ... putative outer-membrane lipoproteins c...arrier protein ... [Yersinia pestis CO92] emb|CAH20642.1| putative ... outer-membrane lipoproteins...8 probable ... outer-membrane lipoproteins carrier protein lolA ... [imported] - Yersinia pest

  10. Development and Properties of a Wax Ester Hydrolase in the Cotyledons of Jojoba Seedlings 1

    Science.gov (United States)

    Huang, Anthony H. C.; Moreau, Robert A.; Liu, Kitty D. F.

    1978-01-01

    The activity of a wax ester hydrolase in the cotyledons of jojoba (Simmondsia chinensis) seedlings increased drastically during germination, parallel to the development of the gluconeogenic process. The enzyme at its peak of development was obtained in association with the wax body membrane, and its properties were studied. It had an optimal activity at alkaline pH (8.5-9). The apparent Km value for N-methylindoxylmyristate was 93 μM. It was stable at 40 C for 30 min but was inactivated at higher temperature. Various divalent cations and ethylenediaminetetraacetate had little effect on the activity. p-Chloromercuribenzoate was a strong inhibitor of the enzyme activity, and its effect was reversed by subsequent addition of dithiothreitol. It had a broad substrate specificity with highest activities on monoglycerides, wax esters, and the native substrate (jojoba wax). PMID:16660288

  11. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58582167 >1iwlA 2 180 70 254 2e-49 ... ref|YP_201183.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas oryzae pv. oryzae KAC... carrier protein precursor [Xanthomonas ... oryzae pv. oryzae KACC10331] gb|AAW75798.1| ...

  12. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121570 >1iwlA 1 182 22 203 1e-59 ... ref|YP_050737.1| outer-membrane lipoproteins...oproteins carrier protein [Erwinia ... carotovora subsp. atroseptica SCRI104... carrier protein [Erwinia carotovora ... subsp. atroseptica SCRI1043] emb|CAG75546.1| ... outer-membrane lip

  13. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002505 gi|15641120 >1iwlA 6 181 22 197 4e-50 ... gb|AAF94266.1| outer membrane lipoproteins...|F82241 outer membrane ... lipoproteins carrier protein VC1107 [imported] ... carrier protein [Vibrio cholerae O1 ... biovar eltor str. N16961] ref|NP_230752.1| outer ... membrane lipopro...teins carrier protein [Vibrio cholerae ... O1 biovar eltor str. N16961] pir|

  14. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  15. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  16. Wax ester profiling of seed oil by nano-electrospray ionization tandem mass spectrometry

    Science.gov (United States)

    2013-01-01

    like cuticular lipid extracts to gain an overview on the molecular species composition. We confirm previous results from APCI-MS and GC-MS analysis, which showed that fragmentation patterns are highly dependent on the double bond distribution between the fatty alcohol and the fatty acid part of the wax ester. PMID:23829499

  17. 21 CFR 184.1978 - Carnauba wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Carnauba wax. 184.1978 Section 184.1978 Food and... Substances Affirmed as GRAS § 184.1978 Carnauba wax. (a) Carnauba wax (CAS Reg. No. 008-015-869) is obtained from the leaves and buds of the Brazilian wax palm Copernicia cerifera Martius. The wax is hard...

  18. [The influence of N-, S-containing chinasolone derivatives (NC-224) on the biochemical and physicochemical parameters of membrane endoplasmatic reticulum and nuclear chromatine fractions of rats liver cells in conditions of its injury by tetrachloromethane].

    Science.gov (United States)

    Gubs'kyî, Iu I; Goriushko, G G; Belenichev, I F; Kovalenko, S I; Litvinova, N V; Marchenko, O M; Kurapova, T M; Babenko, L P; Velychko, O M

    2010-01-01

    Using biochemical and physicochemical methods of investigation in vivo, the effect of the substance NC-224, N-, S-chinasolone-derivative, on the lipoperoxidation activity in rat liver endoplasmatic reticulum membranes and nuclear chromatin fractions under tetrachloromethane intoxication have been studied. It was shown that NC-224 has pronounced antioxidant activity which is the biochemical basis of the substance membrane- and genome-protective effects and its ability to restore physicochemical properties of the surface and hydrophobic zones of hepatocyte membranes and structural parameter nuclear chromatin fractions in the conditions of chemical liver injury.

  19. In search of low cost biological analysis: Wax or acrylic glue bonded paper microfluidic devices

    KAUST Repository

    Kodzius, Rimantas

    2011-01-22

    In this body of work we have been developing and characterizing paper based microfluidic fabrication technologies to produce low cost biological analysis. Specifically we investigated the performance of paper microfluidics that had been bonded using wax or acrylic glue, and characterized the affect of these and other microfluidic materials on the polymerase chain reaction (PCR). We report a simple, low-cost and detachable microfluidic chip incorporating easily accessible paper, glass slides or other polymer films as the chip materials along with adhesive wax or cyanoacrylate-based resin as the recycling bonding material. We use a laser to cut through the paper or film to form patterns and then sandwich the paper and film between glass sheets or polymer membranes. The hot-melt adhesive wax or simple cyanoacrylate-based resin can realize bridge bonding between various materials, for example, paper, polymethylmethacrylate film, glass sheets, or metal plate. The wax bonding process is reversible and the wax is reusable through a melting and cooling process. With this process, a three-dimensional (3D) microfluidic chip is achievable by evacuating the channels of adhesive material in a hot-water. We applied the wax-paper based microfluidic chip to HeLa cell electroporation. Subsequently, a prototype of a 5-layer 3D chip was fabricated by multilayer wax bonding. To check the sealing ability and the durability of the chip, green fluorescence protein recombinant E. coli bacteria were cultured, with which the chemotaxis of E. coli was studied in order to determine the influence of antibiotic ciprofloxacin concentration on the E. coli migration. The chip bonded with cyanoacrylate-based resin was tested by measuring protein concentration and carrying out DNA capillary electrophoresis. To study the biocompatibility and applicability of our microfluidic chip fabrication technology, we tested the PCR compatibility of our chip materials along with various other common materials

  20. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062733 >1iwmA 1 177 31 207 2e-76 ... ref|NP_707118.1| carrier of lipoproteins... to outer membrane [Shigella flexneri 2a ... str. 301] gb|AAN42825.1| carrier of lipoproteins ...to ... outer membrane [Shigella flexneri 2a str. 301] ... ref|NP_836904.1| carrier of lipoproteins...|AAP16711.1| carrier of lipoproteins to outer membrane ... [Shigella flexneri 2a str. 2457T] gb|AAA24... to outer ... membrane [Shigella flexneri 2a str. 2457T] ... gb

  1. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801438 >1iwmA 1 177 31 207 2e-76 ... ref|NP_707118.1| carrier of lipoproteins... to outer membrane [Shigella flexneri 2a ... str. 301] gb|AAN42825.1| carrier of lipoproteins ...to ... outer membrane [Shigella flexneri 2a str. 301] ... ref|NP_836904.1| carrier of lipoproteins...|AAP16711.1| carrier of lipoproteins to outer membrane ... [Shigella flexneri 2a str. 2457T] gb|AAA24... to outer ... membrane [Shigella flexneri 2a str. 2457T] ... gb

  2. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16129172 >1iwmA 1 177 31 207 2e-76 ... ref|NP_707118.1| carrier of lipoproteins... to outer membrane [Shigella flexneri 2a ... str. 301] gb|AAN42825.1| carrier of lipoproteins ...to ... outer membrane [Shigella flexneri 2a str. 301] ... ref|NP_836904.1| carrier of lipoproteins...|AAP16711.1| carrier of lipoproteins to outer membrane ... [Shigella flexneri 2a str. 2457T] gb|AAA24... to outer ... membrane [Shigella flexneri 2a str. 2457T] ... gb

  3. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24112608 >1iwmA 1 177 31 207 2e-76 ... ref|NP_707118.1| carrier of lipoproteins... to outer membrane [Shigella flexneri 2a ... str. 301] gb|AAN42825.1| carrier of lipoproteins ...to ... outer membrane [Shigella flexneri 2a str. 301] ... ref|NP_836904.1| carrier of lipoproteins...|AAP16711.1| carrier of lipoproteins to outer membrane ... [Shigella flexneri 2a str. 2457T] gb|AAA24... to outer ... membrane [Shigella flexneri 2a str. 2457T] ... gb

  4. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830968 >1iwmA 1 177 31 207 2e-76 ... ref|NP_707118.1| carrier of lipoproteins... to outer membrane [Shigella flexneri 2a ... str. 301] gb|AAN42825.1| carrier of lipoproteins ...to ... outer membrane [Shigella flexneri 2a str. 301] ... ref|NP_836904.1| carrier of lipoproteins...|AAP16711.1| carrier of lipoproteins to outer membrane ... [Shigella flexneri 2a str. 2457T] gb|AAA24... to outer ... membrane [Shigella flexneri 2a str. 2457T] ... gb

  5. Crystallography of waxes - an electron diffraction study of refined and natural products

    Science.gov (United States)

    Dorset, Douglas L.

    1997-02-01

    The crystal structure of four waxes has been investigated by electron crystallography. Two of these waxes, including a refined petroleum product (Gulfwax) and a material from lignite (montan wax), form well ordered crystals and their structure could be solved quantitatively from the observed 0022-3727/30/3/018/img1 diffraction patterns. As also found previously for simpler binary n-paraffin solid solutions, the average structure resembles that of a pure paraffin (e.g. n-0022-3727/30/3/018/img2) but with a Gaussian distribution of atomic occupancies near the chain ends to account for the statistical distribution of chain lengths within a lamella. Two other waxes from living organisms, South African bee honeycomb and the leaves of the Brazilian carnauba palm, are much less ordered, even though they share the same methylene subcell packing of the most crystalline parts of the previous materials. It appears that these waxes cannot fully separate into distinct lamellae, perhaps due to the presence of very long `tie' molecules, and are therefore `frustrated' crystal structures.

  6. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  7. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  8. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  9. 21 CFR 178.3710 - Petroleum wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Petroleum wax. 178.3710 Section 178.3710 Food and... and Production Aids § 178.3710 Petroleum wax. Petroleum wax may be safely used as a component of nonfood articles in contact with food, in accordance with the following conditions: (a) Petroleum wax is a...

  10. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  11. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936343 >1bxwA 4 170 45 261 3e-15 ... ref|YP_222291.1| Omp31-1, outer m...embrane protein, 31 kDa [Brucella abortus biovar 1 ... str. 9-941] gb|AAX74930.1| Omp31-1, outer mem...brane ... protein, 31 kDa [Brucella abortus biovar 1 str. 9-941] ... gb|AAS84568.1| Omp31b [

  12. Wax deposition in crude oil pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Assuncao, Pablo Morelato; Rodrigues, Lorennzo Marrochi Nolding [Universidade Federal do Espirito Santo, Sao Mateus, ES (Brazil). Centro Universitario Norte do Espirito Santo. Engenharia de Petroleo; Romero, Mao Ilich [University of Wyoming, Laramie, WY (United States). Enhanced Oil Recovery Institute], e-mail: mromerov@uwyo.edu

    2010-07-01

    Crude oil is a complex mixture of hydrocarbons which consists of aromatics, paraffins, naphthenics, resins asphaltenes, etc. When the temperature of crude oil is reduced, the heavy components, like paraffin, will precipitate and deposit on the pipe internal wall in the form of a wax-oil gel. The gel deposit consists of wax crystals that trap some amount of oil. As the temperature gets cooler, more wax will precipitate and the thickness of the wax gel will increase, causing gradual solidification of the crude and eventually the oil stop moving inside the offshore pipeline. Crude oil may not be able to be re-mobilized during re-startup. The effective diameter will be reduced with wax deposition, resulting in several problems, for example, higher pressure drop which means additional pumping energy costs, poor oil quality, use of chemical components like precipitation inhibitors or flowing facilitators, equipment failure, risk of leakage, clogging of the ducts and process equipment. Wax deposition problems can become so sever that the whole pipeline can be completely blocked. It would cost millions of dollars to remediate an offshore pipeline that is blocked by wax. Wax solubility decreases drastically with decreasing temperature. At low temperatures, as encountered in deep water production, is easy to wax precipitate. The highest temperature below which the paraffins begins to precipitate as wax crystals is defined as wax appearance temperature (WAT). Deposition process is a complex free surface problem involving thermodynamics, fluid dynamics, mass and heat transfer. In this work, a numerical analysis of wax deposition by molecular diffusion and shear dispersion mechanisms in crude oil pipeline is studied. Diffusion flux of wax toward the wall is estimated by Fick's law of diffusion, in similar way the shear dispersion; wax concentration gradient at the solid-liquid interface is obtained by the volume fraction conservation equation; and since the wax deposition

  13. THE PRODUCTION OF COMPLEX PROFILE DETAILS BY COMBINED METHOD OF LOST-WAX CASTING AND OF CONSUMABLE PATTERN MODELS

    Directory of Open Access Journals (Sweden)

    O. I. Shinsky

    2016-01-01

    Full Text Available The technological process of receiving figurine castings of a heat resisting alloy HN57KTVYuMBL brand developed and tested by authors a combined method of oflost-wax casting (pouring gate system and of consumable expanded polystyrene pattern in shell forms kompleks modify ceramics promotes decrease in crack formation of forms at the expense of correctly picked up temperature and time mode of annealing of a form with model. Besides this method allows to receive figurine castings with minimization of an allowance for machining of details, to increase their geometrical accuracy and to lower a roughness.

  14. Effects of air pollutants on epicuticular wax structure

    International Nuclear Information System (INIS)

    Huttunen, S.

    1994-01-01

    In xerophytes, like conifers, the epicuticular wax is well developed. Especially in and around stomatal entrances, a thick wax coating is present. Epicuticular waxes are modified by changes in plant growth conditions such as temperature, relative humidity, irradiance, and wind, or acid rain. The fine structure of epicuticular waxes, their chemistry, and ecophysiological function are modified, especially in evergreen, long-lived conifer needles with characteristic crystalline wax structures. During needle flushing and development, wax structure is easily modified. Acid rain-treated Scots pine needles had 50% less epicuticular waxes in early August. Pollution-induced delayed development, destruction, and disturbances have been identified in many plant species. The structural changes in wax crystals are known. Acid rain or polluted air can destroy the crystalloid epicuticular waxes in a few weeks. In Pinus sylvestris, the first sign of pollution effect is the fusion of wax tubes. In Picea abies and P. sitchensis, modifications of crystalloid wax structure are known. In Californian pine trees phenomena of recrystallization of wax tubes on second-year needles were observed after delayed epicuticular wax development in Pinus ponderosa and P. coulteri. Thus, the effects of air pollutants are modified by climate. Accelerated senescence of leaves and needles have been associated with natural and anthropogenic stresses. The accelerated erosion rate of epicuticular waxes has been measured under air pollution conditions. Many short-term air pollution experiments have failed to show any structural changes in epicuticular wax structures. The quantity and quality of needle waxes grown in open-top chambers, glass houses, or polluted air before treatment, differ from field conditions and make it difficult to detect effects of any treatment. (orig.)

  15. Refining of wax-containing oil by distillation

    Energy Technology Data Exchange (ETDEWEB)

    1930-04-28

    A continuous method is disclosed for producing low cold test oil from wax-containing mineral oil, which comprises continuously heating the oil in a tubular heater with avoidance of cracking, and fractionating the resulting liquid and vapor in a fractionating tower with reflux to produce a wax-containing fraction having therein substantially all of the amorphous wax and being sufficiently free of crystalline wax so as to be waxable by a method suitable for the removal of amorphous wax.

  16. Patterned ion exchange membranes for improved power production in microbial reverse-electrodialysis cells

    KAUST Repository

    Liu, Jia

    2014-12-01

    Power production in microbial reverse-electrodialysis cells (MRCs) can be limited by the internal resistance of the reverse electrodialysis stack. Typical MRC stacks use non-conductive spacers that block ion transport by the so-called spacer shadow effect. These spacers can be relatively thick compared to the membrane, and thus they increase internal stack resistance due to high solution (ohmic) resistance associated with a thick spacer. New types of patterned anion and cation exchange membranes were developed by casting membranes to create hemispherical protrusions on the membranes, enabling fluid flow between the membranes without the need for a non-conductive spacer. The use of the patterned membrane decreased the MRC stack resistance by ∼22 Ω, resulting in a 38% increase in power density from 2.50 ± 0.04 W m-2 (non-patterned membrane with a non-conductive spacer) to 3.44 ± 0.02 W m-2 (patterned membrane). The COD removal rate, coulombic efficiency, and energy efficiency of the MRC also increased using the patterned membranes compared to the non-patterned membranes. These results demonstrate that these patterned ion exchange membranes can be used to improve performance of an MRC. © 2014 Elsevier B.V. All rights reserved.

  17. ORF Alignment: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...

  18. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003318 gi|17989189 >1bxwA 4 170 40 240 2e-16 ... gb|AAN33618.1| outer membrane protein Omp3...1 [Brucella suis 1330] gb|AAS84567.1| ... Omp31 [Brucella cetaceae] gb|AAS84566.1| Omp31 [Br...ucella ... cetaceae] gb|AAS84565.1| Omp31 [Brucella pinnipediae] ... gb|AAS84564.1| Omp31 [Bru...nsis] ... gb|AAL27297.1| outer membrane protein Omp31 [Brucella ... melitensis biovar Neotomae...] gb|AAL27290.1| outer ... membrane protein Omp31 [Brucella melitensis biovar Suis] ... gb|AAL

  19. 21 CFR 172.888 - Synthetic petroleum wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Synthetic petroleum wax. 172.888 Section 172.888... CONSUMPTION Multipurpose Additives § 172.888 Synthetic petroleum wax. Synthetic petroleum wax may be safely used in or on foods in accordance with the following conditions: (a) Synthetic petroleum wax is a...

  20. Hydrogen isotope ratios of terrestrial leaf wax n-alkanes from the Tibetan Plateau: Controls on apparent enrichment factors, effect of vapor sources and implication for altimetry

    Science.gov (United States)

    Zhang, Xiaolong; Xu, Baiqing; Günther, Franziska; Mügler, Ines; Lange, Markus; Zhao, Huabiao; Li, Jiule; Gleixner, Gerd

    2017-08-01

    Empirical evidence suggested that the altitudinal dependence of hydrogen isotope ratios of leaf wax n-alkanes (δDwax) can be used to estimate paleoaltitudinal changes. However, the application of δDwax-based paleoaltimetry remains difficult, as the impacts of evaporative, transpirative and biosynthetic processes on hydrogen isotope fractionations in changing environments and the influence of likely changing water vapor sources are not well explored. For this study, we sampled stream waters, soils and plant leaves along two transects spanning large gradients of altitude, precipitation amount, vapor source, temperature and vegetation type on the Tibetan Plateau (TP). δD values of stream water (as an approximation for δDp), soil water (δDsw) and plant leaf water (δDlw) as well as leaf wax n-alkanes were measured in order to quantify isotopic fractionations in the formation of leaf waxes. Most interestingly, we found a strong negative correlation between the evapotranspirative enrichment of leaf water against precipitation (εlw-p), which combines the effects of soil evaporation and leaf transpiration, and the biosynthetic hydrogen isotope fractionation (εwax-lw), which describes isotopic enrichment between leaf wax and leaf water. The relationship yields a steady apparent isotopic enrichment factor (εwax-p) between leaf wax and precipitation, which is independent from climatic parameters and has an average value of -107 ± 26‰ for grasses (monocotyledons) and -77 ± 22‰ for trees (dicotyledons). Since the terrestrial n-alkanes, especially n-C27 and n-C29, in sediments are derived from trees and grasses, the likely change of the vegetation type in the uplift of mountains can change the isotopic estimates by about ±30‰, which corresponds to an altitudinal change of ∼1600 m. We, therefore, suggest that hydrogen isotope ratio of sedimentary n-C31 alkane, which is mainly derived from grasses might be better proxies to reconstruct paleoaltitudes. Our large

  1. 21 CFR 582.1978 - Carnauba wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Carnauba wax. 582.1978 Section 582.1978 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS....1978 Carnauba wax. (a) Product. Carnauba wax. (b) Conditions of use. This substance is generally...

  2. Surface patterning of polymeric separation membranes and its influence on the filtration performance

    Science.gov (United States)

    Maruf, Sajjad

    Polymeric membrane based separation technologies are crucial for addressing the global issues such as water purification. However, continuous operations of these processes are often hindered by fouling which increases mass transport resistance of the membrane to permeation and thus the energy cost, and eventually replacement of the membrane in the system. In comparison to other anti-fouling strategies, the use of controlled surface topography to mitigate fouling has not been realized mainly due to the lack of methods to create targeted topography on the porous membrane surface. This thesis aims to develop a new methodology to create surface-patterned polymeric separation membrane to improve their anti-fouling characteristics during filtration. First, successful fabrication of sub-micron surface patterns directly on a commercial ultrafiltration (UF) membrane surface using nanoimprint lithographic (NIL) technique was demonstrated. Comprehensive filtration studies revealed that the presence of these sub-micron surface patterns mitigates not only the onset of colloidal particle deposition, but also lowers the rate of growth of cake layer after initial deposition, in comparison with un-patterned membranes. The anti-fouling effects were also observed for model protein solutions. Staged filtration experiments, with backwash cleaning, revealed that the permeate flux of the patterned membrane after protein fouling was considerably higher than that of the pristine or un-patterned membrane. In addition to the surface-patterning of UF membranes, successful fabrication of a surface-patterned thin film composite (TFC) membrane was shown for the first time. A two-step fabrication process was carried out by (1) nanoimprinting a polyethersulfone (PES) support using NIL, and (2) forming a thin dense film atop the PES support via interfacial polymerization (IP). Fouling experiments suggest that the surface patterns alter the hydrodynamics at the membrane-feed interface, which is

  3. Accuracy of ringless casting and accelerated wax-elimination technique: a comparative in vitro study.

    Science.gov (United States)

    Prasad, Rahul; Al-Keraif, Abdulaziz Abdullah; Kathuria, Nidhi; Gandhi, P V; Bhide, S V

    2014-02-01

    The purpose of this study was to determine whether the ringless casting and accelerated wax-elimination techniques can be combined to offer a cost-effective, clinically acceptable, and time-saving alternative for fabricating single unit castings in fixed prosthodontics. Sixty standardized wax copings were fabricated on a type IV stone replica of a stainless steel die. The wax patterns were divided into four groups. The first group was cast using the ringless investment technique and conventional wax-elimination method; the second group was cast using the ringless investment technique and accelerated wax-elimination method; the third group was cast using the conventional metal ring investment technique and conventional wax-elimination method; the fourth group was cast using the metal ring investment technique and accelerated wax-elimination method. The vertical marginal gap was measured at four sites per specimen, using a digital optical microscope at 100× magnification. The results were analyzed using two-way ANOVA to determine statistical significance. The vertical marginal gaps of castings fabricated using the ringless technique (76.98 ± 7.59 μm) were significantly less (p castings fabricated using the conventional metal ring technique (138.44 ± 28.59 μm); however, the vertical marginal gaps of the conventional (102.63 ± 36.12 μm) and accelerated wax-elimination (112.79 ± 38.34 μm) castings were not statistically significant (p > 0.05). The ringless investment technique can produce castings with higher accuracy and can be favorably combined with the accelerated wax-elimination method as a vital alternative to the time-consuming conventional technique of casting restorations in fixed prosthodontics. © 2013 by the American College of Prosthodontists.

  4. 21 CFR 186.1555 - Japan wax.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Japan wax. 186.1555 Section 186.1555 Food and Drugs... Substances Affirmed as GRAS § 186.1555 Japan wax. (a) Japan wax (CAS Reg. No. 8001-39-6), also known as Japan... fruits of the oriental sumac, Rhus succedanea (Japan, Taiwan, and Indo-China), R. vernicifera (Japan...

  5. Structure and Biosynthesis of Branched Wax Compounds on Wild Type and Wax Biosynthesis Mutants of Arabidopsis thaliana.

    Science.gov (United States)

    Busta, Lucas; Jetter, Reinhard

    2017-06-01

    The cuticle is a waxy composite that protects the aerial organs of land plans from non-stomatal water loss. The chemical make-up of the cuticular wax mixture plays a central role in defining the water barrier, but structure-function relationships have not been established so far, in part due to gaps in our understanding of wax structures and biosynthesis. While wax compounds with saturated, linear hydrocarbon tails have been investigated in detail, very little is known about compounds with modified aliphatic tails, which comprise substantial portions of some plant wax mixtures. This study aimed to investigate the structures, abundances and biosynthesis of branched compounds on the species for which wax biosynthesis is best understood: Arabidopsis thaliana. Microscale derivatization, mass spectral interpretation and organic synthesis identified homologous series of iso-alkanes and iso-alcohols on flowers and leaves, respectively. These comprised approximately 10-15% of wild type wax mixtures. The abundances of both branched wax constituents and accompanying unbranched compounds were reduced on the cer6, cer3 and cer1 mutants but not cer4, indicating that branched compounds are in part synthesized by the same machinery as unbranched compounds. In contrast, the abundances of unbranched, but not branched, wax constituents were reduced on the cer2 and cer26 mutants, suggesting that the pathways to both types of compounds deviate in later steps of chain elongation. Finally, the abundances of branched, but not unbranched, wax compounds were reduced on the cer16 mutant, and the (uncharacterized) CER16 protein may therefore be controlling the relative abundances of iso-alkanes and iso-alcohols on Arabidopsis surfaces. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  6. Alveolar Ridge Preservation with nc-HA and d-PTFE Membrane: A Clinical, Histologic, and Histomorphometric Study.

    Science.gov (United States)

    Laurito, Domenica; Lollobrigida, Marco; Gianno, Francesca; Bosco, Sandro; Lamazza, Luca; De Biase, Alberto

    Alveolar ridge preservation has become a very common procedure following tooth extraction. This study presents a clinical, histologic, and histomorphometric analysis of postextraction bone changes using nanocrystalline hydroxyapatite (nc-HA) and exposed high-density polytetrafluoroethylene (d-PTFE) membrane. A total of 10 extraction sockets were treated. Clinical measurements were taken after tooth extraction with a customized acrylic stent to ensure the same measurement points. At 6 months, clinical measurements were repeated and bone specimens taken. An overall bone reduction was observed. The histologic and histomorphometric analysis revealed newly formed bone (25.92% ± 18.78%), soft tissue (28.55% ± 9.73%), and residual graft particles (15.43% ± 11.08%). Further studies are necessary to evaluate the efficacy of this technique over the long term.

  7. Micro-patterned Nafion membranes for direct methanol fuel cell applications

    NARCIS (Netherlands)

    Yildirim, M.H.; te Braake, J.; Aran, H.C.; Stamatialis, Dimitrios; Wessling, Matthias

    2010-01-01

    In this work, we report the direct methanol fuel cell (DMFC) performance of micro-patterned (μp) Nafion® 117 (N117) membranes prepared by hot embossing and compare them with that of normal N117 and heat and pressure treated (hp) N117 non-patterned (smooth) membranes. Our results suggest that the

  8. Sintering of wax for controlling release from pellets.

    Science.gov (United States)

    Singh, Reena; Poddar, S S; Chivate, Amit

    2007-09-14

    The purpose of the present study was to investigate incorporation of hydrophobic (ie, waxy) material into pellets using a thermal sintering technique and to evaluate the pellets in vitro for controlled release. Pellets prepared by extrusion-spheronization technology were formulated with a water-soluble drug, microcrystalline cellulose, and carnauba wax. Powdered carnauba wax (4%-20%) prepared by grinding or by emulsification was studied with an attempt to retard the drug release. The inclusion of ground or emulsified carnauba wax did not sustain the release of theophylline for more than 3 hours. Matrix pellets of theophylline prepared with various concentrations of carnauba wax were sintered thermally at various times and temperatures. In vitro drug release profiles indicated an increase in drug release retardation with increasing carnauba wax concentration. Pellets prepared with ground wax showed a higher standard deviation than did those prepared with emulsified wax. There was incomplete release at the end of 12 hours for pellets prepared with 20% ground or emulsified wax. The sintering temperature and duration were optimized to allow for a sustained release lasting at least 12 hours. The optimized temperature and duration were found to be 100 degrees C and 140 seconds, respectively. The sintered pellets had a higher hydrophobicity than did the unsintered pellets. Scanning electron micrographs indicated that the carnauba wax moved internally, thereby increasing the surface area of wax within the pellets.

  9. Porous membrane modifier as a new trend for deoiling process

    Directory of Open Access Journals (Sweden)

    Nermen H. Mohamed

    2017-09-01

    Full Text Available Porous membranes are prepared through micro phase separation of immiscible polymers consisting of hydrophobic polymer (polystyrene and hydrophilic polymer (poly(2-vinylpyridine. The greatest difficulties during petrolatum deoiling are related to the filtration stage for obtaining microcrystalline wax. The present study deals with the addition of porous membrane as modifier for the crystal structure of solid hydrocarbons, which will be the cornerstone in rearrangement and reformulation of new hard crystals in deoiling process. XRD and SEM photographs were used to evaluate the crystallinity and crystal sizes of the separated hard waxes.

  10. Dental students' preferences and performance in crown design: conventional wax-added versus CAD.

    Science.gov (United States)

    Douglas, R Duane; Hopp, Christa D; Augustin, Marcus A

    2014-12-01

    The purpose of this study was to evaluate dental students' perceptions of traditional waxing vs. computer-aided crown design and to determine the effectiveness of either technique through comparative grading of the final products. On one of twoidentical tooth preparations, second-year students at one dental school fabricated a wax pattern for a full contour crown; on the second tooth preparation, the same students designed and fabricated an all-ceramic crown using computer-aided design (CAD) and computer-aided manufacturing (CAM) technology. Projects were graded for occlusion and anatomic form by three faculty members. On completion of the projects, 100 percent of the students (n=50) completed an eight-question, five-point Likert scalesurvey, designed to assess their perceptions of and learning associated with the two design techniques. The average grades for the crown design projects were 78.3 (CAD) and 79.1 (wax design). The mean numbers of occlusal contacts were 3.8 (CAD) and 2.9(wax design), which was significantly higher for CAD (p=0.02). The survey results indicated that students enjoyed designing afull contour crown using CAD as compared to using conventional wax techniques and spent less time designing the crown using CAD. From a learning perspective, students felt that they learned more about position and the size/strength of occlusal contacts using CAD. However, students recognized that CAD technology has limits in terms of representing anatomic contours and excursive occlusion compared to conventional wax techniques. The results suggest that crown design using CAD could be considered as an adjunct to conventional wax-added techniques in preclinical fixed prosthodontic curricula.

  11. Geometrical effects of conventional and digital prosthodontic planning wax-ups on lateral occlusal contact number, contact area, and steepness.

    Science.gov (United States)

    Abduo, Jaafar

    2017-01-01

    This study evaluated and compared the effect of conventional and digital wax-ups on three lateral occlusion variables: contact number, contact area, and steepness. Dental casts of 10 patients with Angle Class I relationship were included in the study. All patients required fixed prosthodontic treatment that would affect lateral occlusion. The casts of all patients received conventional and digital wax-ups. For pretreatment, conventional wax-up, and digital wax-up casts, contact number, contact area, and occlusion steepness were measured at four lateral positions, that is, at excursions of 0.5, 1.0, 2.0, and 3.0 mm from maximal intercuspation. Lateral occlusion scheme variables were affected by use of diagnostic wax-ups. For all types of casts, contact number decreased as excursion increased. The two types of wax-ups had similar contact number patterns, and contact number was significantly greater for these casts than for pretreatment casts in the earlier stages of excursion. Similarly, contact area gradually decreased with increasing excursion in the pretreatment and conventional and digital wax-up casts. There was only a minimal decrease in occlusion steepness as excursion increased. However, lateral occlusion was generally steeper for digital wax-up casts.

  12. Two Predicted Transmembrane Domains Exclude Very Long Chain Fatty acyl-CoAs from the Active Site of Mouse Wax Synthase.

    Directory of Open Access Journals (Sweden)

    Steffen Kawelke

    Full Text Available Wax esters are used as coatings or storage lipids in all kingdoms of life. They are synthesized from a fatty alcohol and an acyl-CoA by wax synthases. In order to get insights into the structure-function relationships of a wax synthase from Mus musculus, a domain swap experiment between the mouse acyl-CoA:wax alcohol acyltransferase (AWAT2 and the homologous mouse acyl-CoA:diacylglycerol O-acyltransferase 2 (DGAT2 was performed. This showed that the substrate specificity of AWAT2 is partially determined by two predicted transmembrane domains near the amino terminus of AWAT2. Upon exchange of the two domains for the respective part of DGAT2, the resulting chimeric enzyme was capable of incorporating up to 20% of very long acyl chains in the wax esters upon expression in S. cerevisiae strain H1246. The amount of very long acyl chains in wax esters synthesized by wild type AWAT2 was negligible. The effect was narrowed down to a single amino acid position within one of the predicted membrane domains, the AWAT2 N36R variant. Taken together, we provide first evidence that two predicted transmembrane domains in AWAT2 are involved in determining its acyl chain length specificity.

  13. Effect of solvent extraction on Tunisian esparto wax composition

    Directory of Open Access Journals (Sweden)

    Saâd Inès

    2016-08-01

    Full Text Available The increase of needs for renewable and vegetable based materials will help to drive the market growth of vegetable waxes. Because of their highly variable composition and physicochemical properties, plant waxes have found numerous applications in the: food, cosmetic, candle, coating, polish etc... The aim of this project is to determine the effect of solvent extraction (petroleum ether and ethanol on Tunisian esparto wax composition. The GC-MS was applied in order to determine the waxes compositions. Then, physicochemical parameters of these two samples of waxes: acid value, saponification value, iodine value and melting point were measured in order to deduct their properties and possible fields of uses. Results showed that esparto wax composition depended on the solvent extraction and that major components of the two samples of waxes were: alkanes, esters of fatty acids and phenols. Furthermore, esparto waxes were characterized by an antioxidant and antibacterial activities but the potential of these activities depended on the solvent of wax extraction.

  14. Natural oils and waxes: studies on stick bases.

    Science.gov (United States)

    Budai, Lívia; Antal, István; Klebovich, Imre; Budai, Marianna

    2012-01-01

    The objective of the present article was to examine the role of origin and quantity of selected natural oils and waxes in the determination of the thermal properties and hardness of stick bases. The natural oils and waxes selected for the study were sunflower, castor, jojoba, and coconut oils. The selected waxes were yellow beeswax, candelilla wax, and carnauba wax. The hardness of the formulations is a critical parameter from the aspect of their application. Hardness was characterized by the measurement of compression strength along with the softening point, the drop point, and differential scanning calorimetry (DSC). It can be concluded that coconut oil, jojoba oil, and carnauba wax have the greatest influence on the thermal parameters of stick bases.

  15. Increased production of wax esters in transgenic tobacco plants by expression of a fatty acid reductase:wax synthase gene fusion.

    Science.gov (United States)

    Aslan, Selcuk; Hofvander, Per; Dutta, Paresh; Sun, Chuanxin; Sitbon, Folke

    2015-12-01

    Wax esters are hydrophobic lipids consisting of a fatty acid moiety linked to a fatty alcohol with an ester bond. Plant-derived wax esters are today of particular concern for their potential as cost-effective and sustainable sources of lubricants. However, this aspect is hampered by the fact that the level of wax esters in plants generally is too low to allow commercial exploitation. To investigate whether wax ester biosynthesis can be increased in plants using transgenic approaches, we have here exploited a fusion between two bacterial genes together encoding a single wax ester-forming enzyme, and targeted the resulting protein to chloroplasts in stably transformed tobacco (Nicotiana benthamiana) plants. Compared to wild-type controls, transgenic plants showed both in leaves and stems a significant increase in the total level of wax esters, being eight-fold at the whole plant level. The profiles of fatty acid methyl ester and fatty alcohol in wax esters were related, and C16 and C18 molecules constituted predominant forms. Strong transformants displayed certain developmental aberrations, such as stunted growth and chlorotic leaves and stems. These negative effects were associated with an accumulation of fatty alcohols, suggesting that an adequate balance between formation and esterification of fatty alcohols is crucial for a high wax ester production. The results show that wax ester engineering in transgenic plants is feasible, and suggest that higher yields may become achieved in the near future.

  16. Membrane interaction of retroviral Gag proteins

    Directory of Open Access Journals (Sweden)

    Robert Alfred Dick

    2014-04-01

    Full Text Available Assembly of an infectious retroviral particle relies on multimerization of the Gag polyprotein at the inner leaflet of the plasma membrane. The three domains of Gag common to all retroviruses-- MA, CA, and NC-- provide the signals for membrane binding, assembly, and viral RNA packaging, respectively. These signals do not function independently of one another. For example, Gag multimerization enhances membrane binding and is more efficient when NC is interacting with RNA. MA binding to the plasma membrane is governed by several principles, including electrostatics, recognition of specific lipid head groups, hydrophobic interactions, and membrane order. HIV-1 uses many of these principles while Rous sarcoma virus (RSV appears to use fewer. This review describes the principles that govern Gag interactions with membranes, focusing on RSV and HIV-1 Gag. The review also defines lipid and membrane behavior, and discusses the complexities in determining how lipid and membrane behavior impact Gag membrane binding.

  17. Ice formation in model biological membranes in the presence of cryoprotectors

    Energy Technology Data Exchange (ETDEWEB)

    Kiselev, M.A. E-mail: kiselev@nf.jinr.ru; Lesieur, P.; Kisselev, A.M.; Ollivon, M

    2000-06-21

    Ice formation in model biological membranes is studied by SAXS and WAXS in the presence of cryoprotectors: dimethyl sulfoxide and glycerol. Three types of phospholipid membranes: DPPC, DMPC, DSPC are chosen for the investigation as well-studied model biological membranes. A special cryostat is used for sample cooling from 14.1 deg. C to -55.4 deg. C. The ice formation is detected only by WAXS in binary phospholipid/water and ternary phospholipid/cryoprotector/water systems in the condition of excess solvent. Ice formation in a binary phospholipid/water system creates an abrupt decrease of the membrane repeat distance by {delta}d, the so-called ice-induced dehydration of intermembrane space. The value of {delta}d decreases as the cryoprotector concentration increases. The formation of ice does not influence the membrane structure ({delta}d=0) for cryoprotector mole fractions higher than 0.05.

  18. SoftWAXS: a computational tool for modeling wide-angle X-ray solution scattering from biomolecules.

    Science.gov (United States)

    Bardhan, Jaydeep; Park, Sanghyun; Makowski, Lee

    2009-10-01

    This paper describes a computational approach to estimating wide-angle X-ray solution scattering (WAXS) from proteins, which has been implemented in a computer program called SoftWAXS. The accuracy and efficiency of SoftWAXS are analyzed for analytically solvable model problems as well as for proteins. Key features of the approach include a numerical procedure for performing the required spherical averaging and explicit representation of the solute-solvent boundary and the surface of the hydration layer. These features allow the Fourier transform of the excluded volume and hydration layer to be computed directly and with high accuracy. This approach will allow future investigation of different treatments of the electron density in the hydration shell. Numerical results illustrate the differences between this approach to modeling the excluded volume and a widely used model that treats the excluded-volume function as a sum of Gaussians representing the individual atomic excluded volumes. Comparison of the results obtained here with those from explicit-solvent molecular dynamics clarifies shortcomings inherent to the representation of solvent as a time-averaged electron-density profile. In addition, an assessment is made of how the calculated scattering patterns depend on input parameters such as the solute-atom radii, the width of the hydration shell and the hydration-layer contrast. These results suggest that obtaining predictive calculations of high-resolution WAXS patterns may require sophisticated treatments of solvent.

  19. Modal radiation patterns of baffled circular plates and membranes.

    Science.gov (United States)

    Christiansen, Thomas Lehrmann; Hansen, Ole; Thomsen, Erik Vilain; Jensen, Jørgen Arendt

    2014-05-01

    The far field velocity potential and radiation pattern of baffled circular plates and membranes are found analytically using the full set of modal velocity profiles derived from the corresponding equation of motion. The derivation is valid for a plate or membrane subjected to an external excitation force, which is used as a sound receiver in any medium or as a sound transmitter in a gaseous medium. A general, concise expression is given for the radiation pattern of any mode of the membrane and the plate with arbitrary boundary conditions. Specific solutions are given for the four special cases of a plate with clamped, simply supported, and free edge boundary conditions as well as for the membrane. For all non-axisymmetric modes, the velocity potential along the axis of the radiator is found to be strictly zero. In the long wavelength limit, the radiation pattern of all axisymmetric modes approaches that of a monopole, while the non-axisymmetric modes exhibit multipole behavior. Numerical results are also given, demonstrating the implications of having non-axisymmetric excitation using both a point excitation with varying eccentricity and a homogeneous excitation acting on half of the circular radiator.

  20. Impact of the antimicrobial peptide Novicidin on membrane structure and integrity

    DEFF Research Database (Denmark)

    Nielsen, Søren B; Otzen, Daniel Erik

    2010-01-01

    We have studied the impact of an 18-residue cationic antimicrobial peptide Novicidin (Nc) on the structure and integrity of partially anionic lipid membranes using oriented circular dichroism (OCD), quartz crystal microbalance with dissipation (QCM-D), dual polarization interferometry (DPI......), calcein dye leakage and fluorescence spectroscopy. OCD consistently showed that Nc is bound in an alpha-helical, surface bound state over a range of peptide to lipid (P/L) ratios up to approximately 1:15. Realignment of Nc at higher P/L ratios correlates to loss of membrane integrity as shown by Laurdan...... concentration, probably through formation of transient pores or transient disruption of the membrane integrity, followed by more extensive membrane disintegration at higher P/L ratios....

  1. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502485 >1bxwA 4 170 45 261 5e-15 ... gb|AAN30527.1| outer membrane protein Omp3...1 [Brucella suis 1330] gb|AAS84575.1| ... Omp31b [Brucella cetaceae] gb|AAS84574.1| Omp31b ... ... ... [Brucella cetaceae] gb|AAS84573.1| Omp31b [Brucella ... cetaceae] gb|AAS84572.1| Omp31b [Br...ucella pinnipediae] ... gb|AAS84571.1| Omp31b [Brucella melitensis biovar ... ... Neotomae] ref|NP_698612.1| outer membrane protein Omp31 ... [Brucella suis 1330] ...

  2. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  3. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  4. Aplikasi Wax Sebagai Salah Satu Material Di Bidang Kedokteran Gigi

    OpenAIRE

    Rika Jamilah Israwati Lubis

    2008-01-01

    Wax merupakan salah satu bahan termoplastik yang terdiri dari berbagai bahan organis dan bahan alami sehingga membuatnya sebagai bahan dengan sifat-sifat yang sangat berguna. Unsur-unsur pokok dental wax terdiri dari 3 suraber utama, yaitu : mineral, serangga (hewani), dan sayur-sayuran (tumbuh-tumbuhan). Wax yang berasal dari bahan mineral diantaranya adalah paraffin wax dan microcrystallin wax yang diperoleh dari hasil residu petroleum melalui proses destilasi. Wax yang berasal dari serangg...

  5. Chemical composition of raw and deresinated peat waxes

    Energy Technology Data Exchange (ETDEWEB)

    Bel' kevich, P I; Ivanova, L A; Piskunova, T A; Tserlyukevich, Ya V; Yurkevich, E A

    1980-01-01

    Research was conducted using absorption chromatography and spectroscopy to study the changes in the chemical composition of raw peat wax taking place in the deresination process. Characteristics of the raw, deresinated waxes and resins removed are given. The fractions obtained showed that both raw and deresinated wax contain the same basic compound classes: hydrocarbons, alcohols, complex ether and acids; but their proportions in the waxes are different. After deresination most of the dark-colored polyfunctional compounds, a portion of the soluble unsaturated hydrocarbons and alcohols, and all the sterenes transfer into the resin. This causes the light color and specific physical properties of deresinated wax. (13 refs.) (In Russian)

  6. Effects of air pollutants on epicuticular wax chemical composition

    International Nuclear Information System (INIS)

    Percy, K.E.; McQuattie, C.J.; Rebbeck, J.A.

    1994-01-01

    There are numerous reports in the literature of modifications to epicuticular wax structure as a consequence of exposure to air pollutants. Most authors have used scanning electron microscopy (SEM) to describe changes in wax crystallite morphology or distribution. ''Erosion'' or ''weathering'' of crystalline structure into an amorphous state is the most common observation, particularly in the case of conifer needles having the characteristic tube crystallites comprised of nonacosan-10-ol. Wax structure is largely determined by its chemical composition. Therefore, many of the reported changes in wax structure due to air pollutants probably arise from direct interactions between pollutants such as ozone and wax biosynthesis. The literature describing changes in wax composition due to pollutants is briefly reviewed. New evidence is introduced in support of the hypothesis for a direct interaction between air pollutants and epicuticular wax Biosynthesis. (orig.)

  7. 75 FR 63200 - Petroleum Wax Candles From China

    Science.gov (United States)

    2010-10-14

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-282 (Third Review)] Petroleum Wax Candles... five-year review concerning the antidumping duty order on petroleum wax candles from China. SUMMARY... antidumping duty order on petroleum wax candles from China would be likely to lead to continuation or...

  8. 75 FR 80843 - Petroleum Wax Candles From China

    Science.gov (United States)

    2010-12-23

    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-282 (Third Review)] Petroleum Wax Candles... Tariff Act of 1930 (19 U.S.C. 1675(c)), that revocation of the antidumping duty order on petroleum wax... contained in USITC Publication 4207 (December 2010), entitled Petroleum Wax Candles from China...

  9. Dental wax decreases calculus accumulation in small dogs.

    Science.gov (United States)

    Smith, Mark M; Smithson, Christopher W

    2014-01-01

    A dental wax was evaluated after unilateral application in 20 client-owned, mixed and purebred small dogs using a clean, split-mouth study model. All dogs had clinical signs of periodontal disease including plaque, calculus, and/or gingivitis. The wax was randomly applied to the teeth of one side of the mouth daily for 30-days while the contralateral side received no treatment. Owner parameters evaluated included compliance and a subjective assessment of ease of wax application. Gingivitis, plaque and calculus accumulation were scored at the end of the study period. Owners considered the wax easy to apply in all dogs. Compliance with no missed application days was achieved in 8 dogs. The number of missed application days had no effect on wax efficacy. There was no significant difference in gingivitis or plaque accumulation scores when comparing treated and untreated sides. Calculus accumulation scores were significantly less (22.1 %) for teeth receiving the dental wax.

  10. Development of the cuticular wax during growth of Kalanchoe daigremontiana (Hamet et Perr. de la Bathie) leaves.

    Science.gov (United States)

    Van Maarseveen, Clare; Han, Hong; Jetter, Reinhard

    2009-01-01

    The goal of the present study was to monitor cuticular wax accumulation during leaf development of Kalanchoe daigremontiana. Leaves expanded linearly until they were 40-60 d old. Wax coverages of leaves on the third node increased steadily during initial leaf development, from 6.5 microg x cm(-2) on day 22 to 15.3 microg x cm(-2) on day 53, and then levelled off. Triterpenoids dominated the wax mixture throughout leaf development, but decreased from 74 to 40-45% in mature leaves, while very long-chain fatty acid (VLCFA) derivatives increased from 19 to 39-44%. The major VLCFA derivatives were alkanes, accompanied by fatty acids, primary alcohols, aldehydes and alkyl esters. In all compound classes, either C(34) or C(33) homologs predominated during leaf development. Eight different triterpenoids were identified, with glutinol constituting 70% of the fraction, and friedelin (20%) and germanicol (10%) as further major components of the young leaf wax. The glutinol percentage decreased, while the relative amounts of epifriedelanol and glutanol increased during development. Various leaf pairs upwards from the third node showed similar growth patterns and developmental time courses of cuticular wax amounts and composition. Based on these surface chemical analyses, the relative activities of biosynthetic pathways leading to various wax components can be assessed.

  11. Print-to-pattern dry film photoresist lithography

    International Nuclear Information System (INIS)

    Garland, Shaun P; Murphy, Terrence M Jr; Pan, Tingrui

    2014-01-01

    Here we present facile microfabrication processes, referred to as print-to-pattern dry film photoresist (DFP) lithography, that utilize the combined advantages of wax printing and DFP to produce micropatterned substrates with high resolution over a large surface area in a non-cleanroom setting. The print-to-pattern methods can be performed in an out-of-cleanroom environment making microfabrication much more accessible to minimally equipped laboratories. Two different approaches employing either wax photomasks or wax etchmasks from a solid ink desktop printer have been demonstrated that allow the DFP to be processed in a negative tone or positive tone fashion, respectively, with resolutions of 100 µm. The effect of wax melting on resolution and as a bonding material was also characterized. In addition, solid ink printers have the capacity to pattern large areas with high resolution, which was demonstrated by stacking DFP layers in a 50 mm × 50 mm woven pattern with 1 mm features. By using an office printer to generate the masking patterns, the mask designs can be easily altered in a graphic user interface to enable rapid prototyping. (technical note)

  12. Mechanical properties of carving wax with various Ca-bentolite filter composition

    Directory of Open Access Journals (Sweden)

    Widjijono Widjijono

    2009-09-01

    Full Text Available Background: The carving wax is used as a medium in dental anatomy study. This wax composes of many waxes and sometimes a filler is added. Carving wax is not sold in Indonesian market. Whereas the gradients of carving wax such as beeswax, paraffin and bentonite are abundant in Indonesia. Based on that fact, to make high quality and standard,the exact composition if this carving wax should be known. Purpose: The aim of this study was to investigate the effect of carving wax composition with Ca-bentonite filler on the melting point, hardness, and thermal expansion. Methods: Five carving wax compositions were made with paraffin, Ca-bentonite, carnauba wax, and beeswax in ratio (% weight: 50:20:25:5 (KI, 55:15:25:5 (KII, 60:10:25:5 (KIII, 65:5:25:5 (KIV, 70:0:25:5(KV. All components were melted, then poured into the melting point, hardness, and thermal expansion moulds (n = 5. Three carving wax properties were tested: melting point by melting point apparatus; hardness by penetrometer; thermal expansion by digital sliding caliper. The data were analyzed statistically using One-Way ANOVA and LSD0.05. Result: The Ca-bentonite addition influenced the melting point and thermal expansion of carving wax with significant differences between KI and other groups (p < 0.05. Ca-bentonite addition influenced the carving wax hardness and the mean differences among the groups were significant (p < 0.05. Conclusion: Ca-bentonite filler addition on the composition of carving wax influenced the physical and mechanical properties. The carving wax with high Ca-bentonite concentration had high melting point and hardness, but low thermal expansion.

  13. In vivo evaluation of insect wax for hair growth potential

    Science.gov (United States)

    Ma, Jinju

    2018-01-01

    Insect wax is secreted by Ericerus pela Chavanness. It has been traditionally used to treat hair loss in China, but few reports have been published on the hair growth-promoting effect of insect wax. In this work, we examined the hair growth-promoting effects of insect wax on model animals. Different concentrations of insect wax were topically applied to the denuded backs of mice, and 5% minoxidil was applied topically as a positive control. We found that insect wax significantly promoted hair growth in a dose-dependent manner, 45% and 30% insect wax both induced hair to regrow, while less visible hair growth was observed in blank controls on the 16th day. The experimental areas treated with 45% and 30% insect wax exhibited significant differences in hair scores compared to blank controls, and hair lengths in the 45% and 30% insect wax group was significantly longer than in blank controls on the 16th and 20th days. There were no new hair follicles forming in the treated areas, and the hair follicles were prematurely converted to the anagen phase from the telogen phase in experimental areas treated with 45% and 30% insect wax. Both 45% and 30% insect wax upregulated vascular endothelial growth factor expression. The results indicated that 45% and 30% insect wax showed hair growth-promoting potential approximately as potent as 5% minoxidil by inducing the premature conversion of telogen-to-anagen and by prolonging the mature anagen phase rather than increasing the number of hair follicles, which was likely related to the upregulation of VEGF expression. The dissociative policosanol in insect wax was considered the key ingredient most likely responsible for the hair growth promoting potential. PMID:29438422

  14. In vivo evaluation of insect wax for hair growth potential.

    Directory of Open Access Journals (Sweden)

    Jinju Ma

    Full Text Available Insect wax is secreted by Ericerus pela Chavanness. It has been traditionally used to treat hair loss in China, but few reports have been published on the hair growth-promoting effect of insect wax. In this work, we examined the hair growth-promoting effects of insect wax on model animals. Different concentrations of insect wax were topically applied to the denuded backs of mice, and 5% minoxidil was applied topically as a positive control. We found that insect wax significantly promoted hair growth in a dose-dependent manner, 45% and 30% insect wax both induced hair to regrow, while less visible hair growth was observed in blank controls on the 16th day. The experimental areas treated with 45% and 30% insect wax exhibited significant differences in hair scores compared to blank controls, and hair lengths in the 45% and 30% insect wax group was significantly longer than in blank controls on the 16th and 20th days. There were no new hair follicles forming in the treated areas, and the hair follicles were prematurely converted to the anagen phase from the telogen phase in experimental areas treated with 45% and 30% insect wax. Both 45% and 30% insect wax upregulated vascular endothelial growth factor expression. The results indicated that 45% and 30% insect wax showed hair growth-promoting potential approximately as potent as 5% minoxidil by inducing the premature conversion of telogen-to-anagen and by prolonging the mature anagen phase rather than increasing the number of hair follicles, which was likely related to the upregulation of VEGF expression. The dissociative policosanol in insect wax was considered the key ingredient most likely responsible for the hair growth promoting potential.

  15. Quality-grade evaluation of petroleum waxes using an electronic nose with a TGS gas sensor array

    International Nuclear Information System (INIS)

    Wang, Ji; Gao, Daqi; Wang, Zejian

    2015-01-01

    In this paper, the potential of an improved electronic nose to discriminate the quality of petroleum waxes based on their volatile profile was analyzed. Two datasets at 25 and 50 °C were collected from an experiment in order to compare influence by temperature. More fine-grained levels were further labeled for classification to meet various purposes. As petroleum waxes with lower odor levels are more difficult and important to identify than those with higher odor levels, we focus on the discrimination task for low-level ones. Principal component analysis was used for dimensionality reduction and data visualization. k-nearest neighbors, support vector machine, and multilayer perceptron were employed to classify among different qualities of petroleum waxes. The leave-one-out cross-validation method was employed due to the small sample sizes. Results showed good performance on both datasets, and at a temperature of 50 °C all pattern recognition methods showed improved classification rates. The improved electronic nose can potentially be applied to discriminate the quality of petroleum wax. (paper)

  16. A comparative evaluation of the marginal adaptation of a thermoplastic resin, a light cured wax and an inlay casting wax on stone dies: An in vitro study

    Directory of Open Access Journals (Sweden)

    Reji P Gopalan

    2018-01-01

    Conclusion: The marginal adaptation of all the three materials used, was well within the acceptable range of 25–70 μm. The resin pattern materials studied revealed significantly less dimensional change than inlay casting wax on storage at 1, 12, and 24 h time intervals. They may be employed in situations where high precision and delayed investing is expected.

  17. Effects of UV-B radiation on wax biosynthesis

    International Nuclear Information System (INIS)

    Barnes, J.; Paul, N.; Percy, K.; Broadbent, P.; McLaughlin, C.; Mullineaux, P.; Creissen, G.; Wellburn, A.

    1994-01-01

    Two genotypes of tobacco (Nicotiana tabacum L.) were exposed in controlled environment chambers to three levels of biologically effective ultraviolet-B radiation (UV-B BE ; 280-320nm): 0, 4.54 (ambient) and 5.66 (∼ 25% enhancement) kJ m -2 d -1 . After 28 days, the quantity of wax deposited on leaf surfaces was determined gravimetrically; epicuticular wax chemical composition was determined by capillary gas chromatography with homologue assignments confirmed by gas chromatography-mass spectrometry. Leaf wettability was assessed by measuring the contact angle of water droplets placed on leaf surfaces. Tobacco wax consisted of three major hydrocarbon classes: Straight-chain alkanes (C 27 -C 33 ) which comprised ∼ 59% of the hydrocarbon fraction, containing a predominance of odd-chain alkanes with C 31 as the most abundant homologue; branched-chain alkanes (C 25 -C 32 ) which comprised ∼38% of the hydrocarbon fraction with anteiso 3-methyltriacontane (C 30 ) as the predominant homologue; and fatty acids (C 14 -C 18 ) which comprised ∼ 3% of the wax. Exposure to enhanced UV-B radiation reduced the quantity of wax on the adaxial surface of the transgenic mutant, and resulted in marked changes in the chemical composition of the wax on the exposed leaf surface. Enhanced UV-B decreased the quantity of straight-chain alkanes, increased the quantity of branched-chain alkanes and fatty acids, and resulted in shifts toward shorter straight-chain lengths. Furthermore, UV-B-induced changes in wax composition were associated with increased wettability of tobacco leaf surfaces. Overall, the data are consistent with the view that UV-B radiation has a direct and fundamental effect on wax biosynthesis. Relationships between the physico-chemical nature of the leaf surface and sensitivity to UV-B radiation are discussed. (orig.)

  18. Axial ion channeling patterns from ultra-thin silicon membranes

    International Nuclear Information System (INIS)

    Motapothula, M.; Dang, Z.Y.; Venkatesan, T.; Breese, M.B.H.; Rana, M.A.; Osman, A.

    2012-01-01

    We present channeling patterns produced by MeV protons transmitted through 55 nm thick [0 0 1] silicon membranes showing the early evolution of the axially channeled beam angular distribution for small tilts away from the [0 0 1], [0 1 1] and [1 1 1] axes. Instead of a ring-like “doughnut” distribution previously observed at small tilts to major axes in thicker membranes, geometric shapes such as squares and hexagons are observed along different axes in ultra-thin membranes. The different shapes arise because of the highly non-equilibrium transverse momentum distribution of the channeled beam during its initial propagation in the crystal and the reduced multiple scattering which allows the fine angular structure to be resolved. We describe a simple geometric construction of the intersecting planar channels at an axis to gain insight into the origin of the geometric shapes observed in such patterns and how they evolve into the ‘doughnut’ distributions in thicker crystals.

  19. Microencapsulation of flavors in carnauba wax.

    Science.gov (United States)

    Milanovic, Jelena; Manojlovic, Verica; Levic, Steva; Rajic, Nevenka; Nedovic, Viktor; Bugarski, Branko

    2010-01-01

    The subject of this study is the development of flavor wax formulations aimed for food and feed products. The melt dispersion technique was applied for the encapsulation of ethyl vanillin in wax microcapsules. The surface morphology of microparticles was investigated using scanning electron microscope (SEM), while the loading content was determined by HPLC measurements. This study shows that the decomposition process under heating proceeds in several steps: vanilla evaporation occurs at around 200 °C, while matrix degradation starts at 250 °C and progresses with maxima at around 360, 440 and 520 °C. The results indicate that carnauba wax is an attractive material for use as a matrix for encapsulation of flavours in order to improve their functionality and stability in products.

  20. Microencapsulation of Flavors in Carnauba Wax

    Directory of Open Access Journals (Sweden)

    Branko Bugarski

    2010-01-01

    Full Text Available The subject of this study is the development of flavor wax formulations aimed for food and feed products. The melt dispersion technique was applied for the encapsulation of ethyl vanillin in wax microcapsules. The surface morphology of microparticles was investigated using scanning electron microscope (SEM, while the loading content was determined by HPLC measurements. This study shows that the decomposition process under heating proceeds in several steps: vanilla evaporation occurs at around 200 °C, while matrix degradation starts at 250 °C and progresses with maxima at around 360, 440 and 520 °C. The results indicate that carnauba wax is an attractive material for use as a matrix for encapsulation of flavours in order to improve their functionality and stability in products.

  1. Phototransformation of the herbicide sulcotrione on maize cuticular wax.

    Science.gov (United States)

    Ter Halle, Alexandra; Drncova, Daniela; Richard, Claire

    2006-05-01

    Vegetation plays a key role in environmental cycling and the fate of many organic pollutants. This is especially the case for pesticides because plant leaves are their first reaction environment after application. It is commonly accepted that photochemical reactions of pollutants on plants predominantly take place in the cuticular wax coating of the leaves. Thus, we used films made of either cuticular wax extracted from maize or carnauba gray wax as a model support. Under simulated sunlight irradiation, sulcotrione (a new class of triketone herbicides) sorbed on cuticular wax films was photolyzed and mainly underwent an intramolecular cyclization. The photoproduct is a chromone derivative which was isolated and fully characterized. It is reported for the first time as a sulcotrione degradation product. The photoreactivity of formulated sulcotrione at the surface of cuticular waxes was investigated too. It photodegraded more rapidly than nonformulated sulcotrione. This study also shows that the rate of sulcotrione photolysis was much faster than the rate of penetration into the wax; photolysis should be, thus, a relevant process in real conditions.

  2. Development of Wax-Incorporated Emulsion Gel Beads for the Encapsulation and Intragastric Floating Delivery of the Active Antioxidant from Tamarindus indica L.

    Directory of Open Access Journals (Sweden)

    Sitthiphong Soradech

    2016-03-01

    Full Text Available In this study, tamarind (Tamarindus indica L. seed extracts with potential antioxidant activity and toxicity to cancer cells were developed as functional foods and nutraceutical ingredients in the form of emulsion gel beads. Three extracts were obtained from ethanol and water: TSCH50, TSCH95 and TSCH. All extracts exhibited high potential for superoxide anion scavenging activity over the IC50 range < 5–11 µg/mL and had no toxic effects on normal cells, however, the water extract (TSCH was the most effective due to its free radical scavenging activity and toxicity in mitochondrial membranes of cancer cells. Next a study was designed to develop a new formulation for encapsulation and intragastric floating delivery of tamarind seed extract (TSCH using wax-incorporated emulsion gel beads, which were prepared using a modified ionotropic gelation technique. Tamarind seed extract at 1% (w/w was used as the active ingredient in all formulations. The effect of the types and amounts of wax on the encapsulation efficiency and percentage of the active release of alginate gel beads was also investigated. The results demonstrated that the incorporation of both waxes into the gel beads had an effect on the percentage of encapsulation efficiency (% and the percentage of the active ingredient release. Furthermore, the addition of water insoluble waxes (carnauba and bee wax significantly retarded the release of the active ingredient. The addition of both waxes had a slight effect on drug release behavior. Nevertheless, the increase in incorporated waxes in all formulations could sustain the percentage of active ingredient release. In conclusion, wax-incorporated emulsion gel beads using a modified ionotropic gelation technique could be applied for the intragastric floating delivery and controlled release of functional food and nutraceutical products for their antioxidant and anticancer capacity.

  3. Anti-inflammatory effects of jojoba liquid wax in experimental models.

    Science.gov (United States)

    Habashy, Ramy R; Abdel-Naim, Ashraf B; Khalifa, Amani E; Al-Azizi, Mohammed M

    2005-02-01

    Jojoba [Simmondsia chinensis (Link 1822) Schneider 1907] is an arid perennial shrub grown in several American and African countries. Jojoba seeds, which are rich in liquid wax, were used in folk medicine for diverse ailments. In the current study, the potential anti-inflammatory activity of jojoba liquid wax (JLW) was evaluated in a number of experimental models. Results showed that JLW caused reduction of carrageenin-induced rat paw oedema in addition to diminishing prostaglandin E2 (PGE2) level in the inflammatory exudates. In a test for anti-inflammatory potential utilizing the chick's embryo chroioallantoic membrane (CAM), JLW also caused significant lowering of granulation tissue formation. Topical application of JLW reduced ear oedema induced by croton oil in rats. In the same animal model, JLW also reduced neutrophil infiltration, as indicated by decreased myeloperoxidase (MPO) activity. In addition, JLW ameliorated histopathological changes affected by croton oil application. In the lipopolysaccharide (LPS)-induced inflammation in air pouch in rats, JLW reduced nitric oxide (NO) level and tumor necrosis factor-alpha (TNF-alpha) release. In conclusion, this study demonstrates the effectiveness of JLW in combating inflammation in several experimental models. Further investigations are needed to identify the active constituents responsible for the anti-inflammatory property of JLW.

  4. Preliminary evaluation of an aqueous wax emulsion for controlled-release coating.

    Science.gov (United States)

    Walia, P S; Stout, P J; Turton, R

    1998-02-01

    The purpose of this work was to evaluate the use of an aqueous carnauba wax emulsion (Primafresh HS, Johnson Wax) in a spray-coating process. This involved assessing the effectiveness of the wax in sustaining the release of the drug, theophylline. Second, the process by which the drug was released from the wax-coated pellets was modeled. Finally, a method to determine the optimum blend of pellets with different wax thicknesses, in order to yield a zero-order release profile of the drug, was addressed. Nonpareil pellets were loaded with theophylline using a novel powder coating technique. These drug-loaded pellets were then coated with different levels of carnauba wax in a 6-in. diameter Plexiglas fluid bed with a 3.5-in. diameter Wurster partition. Drug release was measured using a spin-filter dissolution device. The study resulted in continuous carnauba wax coatings which showed sustained drug release profile characteristics typical of a barrier-type, diffusion-controlled system. The effect of varying wax thickness on the release profiles was investigated. It was observed that very high wax loadings would be required to achieve long sustained-release times. The diffusion model, developed to predict the release of the drug, showed good agreement with the experimental data. However, the data exhibited an initial lag-time for drug release which could not be predicted a priori based on the wax coating thickness. A method of mixing pellets with different wax thicknesses was proposed as a way to approximate zero-order release.

  5. Structural-mechanical model of wax crystal networks—a mesoscale cellular solid approach

    International Nuclear Information System (INIS)

    Miyazaki, Yukihiro; Marangoni, Alejandro G

    2014-01-01

    Mineral waxes are widely used materials in industrial applications; however, the relationship between structure and mechanical properties is poorly understood. In this work, mineral wax-oil networks were characterized as closed-cell cellular solids, and differences in their mechanical response predicted from structural data. The systems studied included straight-chain paraffin wax (SW)-oil mixtures and polyethylene wax (PW)-oil mixtures. Analysis of cryogenic-SEM images of wax-oil networks allowed for the determination of the length (l) and thickness (t) of the wax cell walls as a function of wax mass fraction (Φ). A linear relationship between t/l and Φ (t/l ∼ Φ 0.89 ) suggested that wax-oil networks were cellular solids of the closed-cell type. However, the scaling behavior of the elastic modulus with the volume fraction of solids did not agree with theoretical predictions, yielding the same scaling exponent, μ = 0.84, for both waxes. This scaling exponent obtained from mechanical measurements could be predicted from the scaling behavior of the effective wax cell size as a function of wax mass fraction in oil obtained by cryogenic scanning electron microscopy. Microscopy studies allowed us to propose that wax-oil networks are structured as an ensemble of close-packed spherical cells filled with oil, and that it is the links between cells that yield under simple uniaxial compression. Thus, the Young’s moduli for the links between cells in SW and PW wax systems could be estimated as E L (SW) = 2.76 × 10 9 Pa and E L (PW) = 1.64 × 10 9 Pa, respectively. The structural parameter responsible for the observed differences in the mechanical strength between the two wax-oil systems is the size of the cells. Polyethylene wax has much smaller cell sizes than the straight chain wax and thus displays a higher Young’s modulus and yield stress. (papers)

  6. Plant surface wax affects parasitoid's response to host footprints

    Science.gov (United States)

    Rostás, Michael; Ruf, Daniel; Zabka, Vanessa; Hildebrandt, Ulrich

    2008-10-01

    The plant surface is the substrate upon which herbivorous insects and natural enemies meet and thus represents the stage for interactions between the three trophic levels. Plant surfaces are covered by an epicuticular wax layer which is highly variable depending on species, cultivar or plant part. Differences in wax chemistry may modulate ecological interactions. We explored whether caterpillars of Spodoptera frugiperda, when walking over a plant surface, leave a chemical trail (kairomones) that can be detected by the parasitoid Cotesia marginiventris. Chemistry and micromorphology of cuticular waxes of two barley eceriferum wax mutants ( cer-za.126, cer-yp.949) and wild-type cv. Bonus (wt) were assessed. The plants were then used to investigate potential surface effects on the detectability of caterpillar kairomones. Here we provide evidence that C. marginiventris responds to chemical footprints of its host. Parasitoids were able to detect the kairomone on wild-type plants and on both cer mutants but the response to cer-yp.949 (reduced wax, high aldehyde fraction) was less pronounced. Experiments with caterpillar-treated wt and mutant leaves offered simultaneously, confirmed this observation: no difference in wasp response was found when wt was tested against cer-za.126 (reduced wax, wt-like chemical composition) but wt was significantly more attractive than cer-yp.949. This demonstrates for the first time that the wax layer can modulate the detectability of host kairomones.

  7. Process for separating liquid hydrocarbons from waxes

    Energy Technology Data Exchange (ETDEWEB)

    Sowa, F J

    1948-03-08

    A process is described for the separation of liquid hydrocarbons from waxes comprising adding to a mixture of liquid hydrocarbons and waxes a sufficient quantity of an organo-silicon compound to cause the separation of the hydrocarbon and wax. The organo-silicon compounds are selected from the class of organic silicanes and their hydrolysis products and polymers. The silicanes have the formula R/sub y/SiX/sub z/, in which R is a saturated or unsaturated hydrocarbon radical, X is a halogen or another hydrocarbon radical or an -OR group, y has a value 1, 2, or 3 and z has a value 1, 2, or 3.

  8. 21 CFR 155.120 - Canned green beans and canned wax beans.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned green beans and canned wax beans. 155.120... Vegetables § 155.120 Canned green beans and canned wax beans. (a) Identity—(1) Definition. Canned green beans and canned wax beans are the foods prepared from succulent pods of fresh green bean or wax bean plants...

  9. Wax-incorporated emulsion gel beads of calcium pectinate for intragastric floating drug delivery.

    Science.gov (United States)

    Sriamornsak, Pornsak; Asavapichayont, Panida; Nunthanid, Jurairat; Luangtana-Anan, Manee; Limmatvapirat, Sontaya; Piriyaprasarth, Suchada

    2008-01-01

    The purpose of this study was to prepare wax-incorporated pectin-based emulsion gel beads using a modified emulsion-gelation method. The waxes in pectin-olive oil mixtures containing a model drug, metronidazole, were hot-melted, homogenized and then extruded into calcium chloride solution. The beads formed were separated, washed with distilled water and dried for 12 h. The influence of various types and amounts of wax on floating and drug release behavior of emulsion gel beads of calcium pectinate was investigated. The drug-loaded gel beads were found to float on simulated gastric fluid if the sufficient amount of oil was used. Incorporation of wax into the emulsion gel beads affected the drug release. Water-soluble wax (i.e. polyethylene glycol) increased the drug release while other water-insoluble waxes (i.e. glyceryl monostearate, stearyl alcohol, carnauba wax, spermaceti wax and white wax) significantly retarded the drug release. Different waxes had a slight effect on the drug release. However, the increased amount of incorporated wax in the formulations significantly sustained the drug release while the beads remained floating. The results suggest that wax-incorporated emulsion gel beads could be used as a carrier for intragastric floating drug delivery.

  10. Microencapsulation of Flavors in Carnauba Wax

    OpenAIRE

    Milanovic, Jelena; Manojlovic, Verica; Levic, Steva; Rajic, Nevenka; Nedovic, Viktor; Bugarski, Branko

    2010-01-01

    The subject of this study is the development of flavor wax formulations aimed for food and feed products. The melt dispersion technique was applied for the encapsulation of ethyl vanillin in wax microcapsules. The surface morphology of microparticles was investigated using scanning electron microscope (SEM), while the loading content was determined by HPLC measurements. This study shows that the decomposition process under heating proceeds in several steps: vanilla evaporation occurs at aroun...

  11. Lateral Membrane Waves Constitute a Universal Dynamic Pattern of Motile Cells

    Science.gov (United States)

    Döbereiner, Hans-Günther; Dubin-Thaler, Benjamin J.; Hofman, Jake M.; Xenias, Harry S.; Sims, Tasha N.; Giannone, Grégory; Dustin, Michael L.; Wiggins, Chris H.; Sheetz, Michael P.

    2006-07-01

    We have monitored active movements of the cell circumference on specifically coated substrates for a variety of cells including mouse embryonic fibroblasts and T cells, as well as wing disk cells from fruit flies. Despite having different functions and being from multiple phyla, these cell types share a common spatiotemporal pattern in their normal membrane velocity; we show that protrusion and retraction events are organized in lateral waves along the cell membrane. These wave patterns indicate both spatial and temporal long-range periodic correlations of the actomyosin gel.

  12. Combined hydrogen and carbon isotopes of plant waxes as an indicator of drought impacts on ancient Maya agriculture

    Science.gov (United States)

    Douglas, P. M.; Pagani, M.; Eglinton, T. I.; Brenner, M.; Hodell, D. A.; Curtis, J. H.

    2012-12-01

    There is increasing evidence suggesting that a series of droughts in the Yucatan Peninsula coincided with the Terminal Classic decline of the Classic Maya civilization (ca. 1250 to 1000 years BP). However, there is little evidence directly linking climatic change and changes in human activities in this region. In this study we combine plant-wax δD, δ13C, and Δ14C analyses in two lake sediment cores from southeastern Mexico and northern Guatemala to develop coupled records of hydroclimate variability and human-driven vegetation change. Plant-wax specific Δ14C ages indicate a large input of pre-aged plant waxes into lake sediment. Comparison of plant-wax δD records with other regional hydroclimate proxy records suggest that plant-wax ages are evenly distributed around plant-wax radiocarbon ages, and that applying an age model based on plant-wax radiocarbon ages is appropriate for these lake sediments. We evaluate how differences in plant-wax age distributions influence stable isotope records to assess the age uncertainty associated with records of climate and vegetation change derived from plant-wax stable isotopes. In this low-elevation tropical environment plant-wax δ13C is largely controlled by the relative abundance of C3 and C4 plants. The ancient Maya practiced widespread maize (C4) agriculture and strongly influenced regional C3-C4 vegetation dynamics. Under natural conditions C4 plant coverage and plant-wax δ13C would tend to co-vary positively since C4 plants are well adapted for dry conditions. Under ancient Maya land-use, however, this relationship is likely to be decoupled, since drought would have disrupted C4 agriculture. Combined analysis of plant-wax δD and δ13C from both lakes indicates increasingly divergent trends following ca. 3500 years BP, around the onset of widespread ancient Maya agriculture. After this time high plant-wax δD values tend to correspond with low plant-wax δ13C values and vice versa. This pattern is consistent with

  13. Geometric accuracy of wax bade models manufactured in silicon moulds

    Directory of Open Access Journals (Sweden)

    G. Budzik

    2010-01-01

    Full Text Available The article presents the test results of the geometric accuracy of wax blade models manufactured in silicon moulds in the Rapid Tooling process, with the application of the Vacuum Casting technology. In batch production casting waxes are designed for the manufacture of models and components of model sets through injection into a metal die. The objective of the tests was to determine the possibility of using traditional wax for the production of casting models in the rapid prototyping process. Blade models made of five types of casting wax were measured. The definition of the geometric accuracy of wax blade models makes it possible to introduce individual modifications aimed at improving their shape in order to increase the dimensional accuracy of blade models manufactured in the rapid prototyping process.

  14. The dynamic interplay of plasma membrane domains and cortical microtubules in secondary cell wall patterning

    Directory of Open Access Journals (Sweden)

    Yoshihisa eOda

    2013-12-01

    Full Text Available Patterning of the cellulosic cell wall underlies the shape and function of plant cells. The cortical microtubule array plays a central role in the regulation of cell wall patterns. However, the regulatory mechanisms by which secondary cell wall patterns are established through cortical microtubules remain to be fully determined. Our recent study in xylem vessel cells revealed that a mutual inhibitory interaction between cortical microtubules and distinct plasma membrane domains leads to distinctive patterning in secondary cell walls. Our research revealed that the recycling of active and inactive ROP proteins by a specific GAP and GEF pair establishes distinct de novo plasma membrane domains. Active ROP recruits a plant-specific microtubule-associated protein, MIDD1, which mediates the mutual interaction between cortical microtubules and plasma membrane domains. In this mini review, we summarize recent research regarding secondary wall patterning, with a focus on the emerging interplay between plasma membrane domains and cortical microtubules through MIDD1 and ROP.

  15. Phase Change Insulation for Energy Efficiency Based on Wax-Halloysite Composites

    International Nuclear Information System (INIS)

    Zhao, Yafei; Thapa, Suvhashis; Weiss, Leland; Lvov, Yuri

    2014-01-01

    Phase change materials (PCMs) have gained extensive attention in thermal energy storage. Wax can be used as a PCM in solar storage but it has low thermal conductivity. Introducing 10% halloysite admixed into wax yields a novel composite (wax-halloysite) which has a thermal conductivity of 0.5 W/mK. To increase the base conductivity, graphite and carbon nanotubes were added into the PCM composite improving its thermal energy storage. Thermal conductivity of wax-halloysite-graphite (45/45/10%) composite showed increased conductivity of 1.4 W/mK (3 times higher than the base wax-halloysite composite). Wax- halloysite-graphite-carbon nanotubes (45/45/5/5%) composite showed conductivity of 0.85 W/mK while maintaining the original shape perfectly until 91 °C (above the original wax melting point). Thermal conductivity can be further increased with higher doping of carbon nanotubes. This new composites are promising heat storage material due to good thermal stability, high thermal/electricity conductivity and ability to preserve its shape during phase transitions

  16. Immunochemical and autoantigenic properties of the globular domain of basement membrane collagen (type IV).

    Science.gov (United States)

    von der Mark, H; Oberbäumer, I; Timpl, R; Kemler, R; Wick, G

    1985-02-01

    Polyclonal rabbit antibodies raised against the globular domain NC1 of collagen IV from human placenta and a mouse tumor react with conformational antigenic determinants present on the NC1 hexamers and also with the three major subunits obtained after dissociation. The antibodies recognized unique structures within basement membranes and showed a broad tissue reactivity but only limited species cross-reactivity. Using these antibodies, it was possible to detect small amounts of collagen IV antigens from cell cultures and in serum. Monoclonal rat antibodies against mouse NC1 revealed a similar reaction potential. Autoantibodies could be produced in mice against mouse NC1 which react with kidney and lung basement membranes in a pathological manner, mimicking Goodpasture syndrome.

  17. Surfactants and Desensitizing Wax Substitutes for TNT-Based Systems.

    Science.gov (United States)

    1994-10-01

    greatly with the source of crude oil. Some crudes contain little wax. The U.S. crudes from Pennsylvania and the midcontinent areas contain high...years ago in Egypt for many different purposes. The term wax comes to us from the Anglo-Saxon "weax," the name given to material from the bee ...usually produced in the wild and not by large scale cultivation. Although plants produce small amounts of waxes in their tissues, seeds and pollen

  18. Absorption and distribution of orally administered jojoba wax in mice.

    Science.gov (United States)

    Yaron, A; Samoiloff, V; Benzioni, A

    1982-03-01

    The liquid wax obtained from the seeds of the arid-land shrub jojoba (Simmondsia chinensis) is finding increasing use in skin treatment preparations. The fate of this wax upon reaching the digestive tract was studied. 14C-Labeled wax was administered intragastrically to mice, and the distribution of the label in the body was determined as a function of time. Most of the wax was excreted, but a small amount was absorbed, as was indicated by the distribution of label in the internal organs and the epididymal fat. The label was incorporated into the body lipids and was found to diminish with time.

  19. Simple Synthesis Hydrogenated Castor Oil Fatty Amide Wax and Its Coating Characterization.

    Science.gov (United States)

    Yu, Xiuzhu; Wang, Ning; Zhang, Rui; Zhao, Zhong

    2017-07-01

    A simple method for incorporating amine groups in hydrogenated castor oil (HCO) to produce wax for beeswax or carnauba wax substitution in packaging and coating was developed. From the conversion rate of the products, HCO was reacted with ethanolamine at 150°C for 5 h, and the molar ratio of HCO and ethanolamine was 1:4. The hardness of the final product was seven times higher than that of beeswax, the cohesiveness of the final product was 1.3 times higher than that of beeswax and approximately one half of that of carnauba wax, and the melting point of the final product is 98°C. The Fourier transform Infrared spectroscopy showed that the amide groups were incorporated to form the amide products. In coating application, the results showed that the force of the final product coating cardboard was higher than that of beeswax and paraffin wax and less than that of carnauba wax. After 24 h soaking, the compression forces were decreased. HCO fatty acid wax can be an alternative wax for carnauba wax and beeswax in coating applications.

  20. ASPHALT-RESIN-WAX DEPOSITS ANALYSIS WITH PETROLEUM REFINERY EQUIPMENT USAGE

    Directory of Open Access Journals (Sweden)

    Nadejda Bondar

    2013-12-01

    Full Text Available The methodology and analysis of wax deposits formed in-water-cooling tower, cistern and tank from wax petroleum were developed. It was shown, that deposits consist of organic (>90% and inorganic components – the first one was enriched by high molecular wax hydrocarbons, the second one – by mechanical impurities. The methods of deposits utilization were proposed

  1. [Computation of the K+, Na+ and Cl- fluxes through plasma membrane of animal cell with Na+/K+ pump, NKCC, NC cotransporters, and ionic channels with and without non-Goldman rectification in K+ channels. Norma and apoptosis].

    Science.gov (United States)

    Rubashkin, A A; Iurinskaia, V E; Vereninov, A A

    2010-01-01

    The balance of K+, Na+ and Cl- fluxes through cell membrane with the Na+/K+ pump, ion channels and NKCC and NC cotransporters is considered. It is shown that all unidirectional K+, Na+ and Cl- fluxes through cell membrane, permeability coefficients of ion channels and membrane potential can be computed for balanced ion distribution between cell and the medium if K+, Na+ and Cl- concentration in cell water and three fluxes are known: total Cl- flux, total K+ influx and ouabain-inhibitable "pump" component of the K+ influx. Changes in the mortovalent ion balance in lymphoid cells U937 induced to apoptosis by 1 microM staurosporine are analyzed as an example. It is found that the apoptotic shift in ion and water balance in studied cells is caused by a decrease in the pump activity which is accompanied by a decrease in the integral permeability of Na+ channels without significant increase in K+ and Cl- channel permeabilities. Computation shows that only a small part of the total fluxes of K+, Na+ and Cl- accounts for the fluxes via NKCC and NC cotransporters. Therefore, cotransport fluxes can not be studied using inhibitors.

  2. Wax combs mediate nestmate recognition by guard honeybees

    DEFF Research Database (Denmark)

    D'Ettorre, Patrizia; Wenseleers, Tom; Dawson, Jenny

    2006-01-01

    Research has shown that the wax combs are important in the acquisition of colony odour in the honeybee, Apis mellifera. However, many of these studies were conducted in the laboratory or under artificial conditions. We investigated the role of the wax combs in nestmate recognition in the natural...

  3. Wax Point Determinations Using Acoustic Resonance Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Bostick, D.T.; Jubin, R.T.; Schmidt, T.W.

    2001-06-01

    The thermodynamic characterization of the wax point of a given crude is essential in order to maintain flow conditions that prevent plugging of undersea pipelines. This report summarizes the efforts made towards applying an Acoustic Cavity Resonance Spectrometer (ACRS) to the determination of pressures and temperatures at which wax precipitates from crude. Phillips Petroleum Company, Inc., the CRADA participant, supplied the ACRS. The instrumentation was shipped to Dr. Thomas Schmidt of ORNL, the CRADA contractor, in May 2000 after preliminary software development performed under the guidance of Dr. Samuel Colgate and Dr. Evan House of the University of Florida, Gainesville, Fl. Upon receipt it became apparent that a number of modifications still needed to be made before the ACRS could be precisely and safely used for wax point measurements. This report reviews the sequence of alterations made to the ACRS, as well as defines the possible applications of the instrumentation once the modifications have been completed. The purpose of this Cooperative Research and Development Agreement (CRADA) between Phillips Petroleum Company, Inc. (Participant) and Lockheed Martin Energy Research Corporation (Contractor) was the measurement of the formation of solids in crude oils and petroleum products that are commonly transported through pipelines. This information is essential in the proper design, operation and maintenance of the petroleum pipeline system in the United States. Recently, new petroleum discoveries in the Gulf of Mexico have shown that there is a potential for plugging of undersea pipeline because of the precipitation of wax. It is important that the wax points of the expected crude oils be well characterized so that the production facilities for these new wells are capable of properly transporting the expected production. The goal of this work is to perform measurements of solids formation in crude oils and petroleum products supplied by the Participant. It is

  4. wax matrix tablets and its implication on dissolution prof

    African Journals Online (AJOL)

    acetaminophen-wax matrix tablet and hence its implication on dissolution profile. Acetaminophen-wax ... inertness, cost effectiveness, non- toxicity and more importantly their ... Liver Poole, England) at constant load (30 arbitrary units on the ...

  5. Characterization and chemical composition of epicuticular wax from banana leaves grown in Northern Thailand

    Directory of Open Access Journals (Sweden)

    Suporn Charumanee

    2017-08-01

    Full Text Available This study aimed to investigate the physicochemical properties and chemical composition of epicuticular wax extracted from leaves of Kluai Namwa, a banana cultivar which is widely grown in Northern Thailand. Its genotype was identified by a botanist. The wax was extracted using solvent extraction. The fatty acid profiles and physicochemical properties of the wax namely melting point, congealing point, crystal structures and polymorphism, hardness, color, and solubility were examined and compared to those of beeswax, carnauba wax and paraffin wax. The results showed that the genotype of Kluai Namwa was Musa acuminata X M. balbisiana (ABB group cv. Pisang Awak. The highest amount of wax extracted was 274 μg/cm2 surface area. The fatty acid composition and the physicochemical properties of the wax were similar to those of carnauba wax. It could be suggested that the banana wax could be used as a replacement for carnauba wax in various utilizing areas.

  6. Development of a Parafin Wax deposition Unit for Fused Deposition Modelling (FDM)

    DEFF Research Database (Denmark)

    D'Angelo, Greta; Hansen, Hans Nørgaard; Pedersen, David Bue

    2014-01-01

    . This project illustrates the redesign of an extrusion unit for the deposition of paraffin wax in Fused Deposition Modelling (FDM) instead of the conventional polymeric materials. Among the benefits and brought by the use of paraffin wax in such system are: the possibility to make highly complex and precise...... parts to subsequently use in a Lost Wax Casting process, multi-material Additive Manufacturing and the use of wax as support material during the production of complicated parts. Moreover it is believed that including waxes among the materials usable in FDM would promote new ways of using and exploring...

  7. Policosanol fabrication from insect wax and optimization by response surface methodology.

    Science.gov (United States)

    Ma, Jinju; Ma, Liyi; Zhang, Hong; Zhang, Zhongquan; Wang, Youqiong; Li, Kai; Chen, Xiaoming

    2018-01-01

    Insect wax is a famous biological resource for the role in economic production in China. Insect wax is a good source of policosanol, which may is a candidate supplement in foodstuff and pharmaceuticals that has important physiological activities. Therefore, this work aims to investigate a high-yield and rapid method for policosanol fabrication from insect wax. The conditions for policosanol fabrication were optimized as follows: an oil bath temperature of 112.7°C and reductant dosage of 0.97 g (used for the reduction of 10.00 g of insect wax). The yield of policosanol reached 83.20%, which was 4 times greater than that of existing methods, such as saponification. The total content of policosanol obtained under the optimal conditions reached 87%. In other words, a high yield of policosanol was obtained from insect wax (723.84 mg/g), that was 55 times higher than that generated from beeswax-brown via saponification. The concentrations of metal residues in policosanol were within the limits of the European Union regulations and EFSA stipulation. The LD50 values for oral doses of insect wax and policosanol were both > 5 g/kg. Policosanol was fabricated via solvent-free reduction from insect wax using LiAlH4 at a high yield. The fabrication conditions were optimized. Policosanol and insect wax showed high security, which made them potential candidates as supplements in foods, pharmaceuticals and cosmetics. The rapid and high-yield method has great potential for commercial manufacturing of policosanol.

  8. Content of Wax during Dewaxing Process: Adopting a DOE Method

    Directory of Open Access Journals (Sweden)

    Mohammad Hosein Eghbali

    2013-01-01

    Full Text Available The oil content of the wax produced in a dewaxing process is the key economic parameter that should be reduced as much as possible. Some factors such as the type of solvents, cooling rate, temperature, and solvent to oil ratio influence the dewaxing process. Due to the fact that crude oil differs from place to place and since the operational conditions for wax extraction vary for different types of crude oil, the objective of this work is to study the operational conditions for wax production from an Iranian raffinate sample used in Sepahan Oil Company. All the experiments are conducted based on a design of experiment (DOE technique for minimizing the oil content of the wax produced. The effects of five factors have been determined quantitatively and appropriate levels are suggested for reducing the oil content. The results show that the solvent ratio, solvent composition, and cooling rate play the most important role in minimizing the oil content of the produced wax.

  9. Pickering emulsions stabilized by paraffin wax and Laponite clay particles.

    Science.gov (United States)

    Li, Caifu; Liu, Qian; Mei, Zhen; Wang, Jun; Xu, Jian; Sun, Dejun

    2009-08-01

    Emulsions containing wax in dispersed droplets stabilized by disc-like Laponite clay particles are prepared. Properties of the emulsions prepared at different temperatures are examined using stability, microscopy and droplet-size analysis. At low temperature, the wax crystals in the oil droplets can protrude through the interface, leading to droplet coalescence. But at higher temperatures, the droplet size decreases with wax concentration. Considering the viscosity of the oil phase and the interfacial tension, we conclude that the wax is liquid-like during the high temperature emulsification process, but during cooling wax crystals appear around the oil/water interface and stabilize the droplets. The oil/water ratio has minimal effect on the emulsions between ratios of 3:7 and 7:3. The Laponite is believed to stabilize the emulsions by increasing the viscosity of the continuous phase and also by adsorbing at the oil/water interface, thus providing a physical barrier to coalescence.

  10. Evaluation of Wax Deposition and Its Control During Production of Alaska North Slope Oils

    Energy Technology Data Exchange (ETDEWEB)

    Tao Zhu; Jack A. Walker; J. Liang

    2008-12-31

    Due to increasing oil demand, oil companies are moving into arctic environments and deep-water areas for oil production. In these regions of lower temperatures, wax deposits begin to form when the temperature in the wellbore falls below wax appearance temperature (WAT). This condition leads to reduced production rates and larger pressure drops. Wax problems in production wells are very costly due to production down time for removal of wax. Therefore, it is necessary to develop a solution to wax deposition. In order to develop a solution to wax deposition, it is essential to characterize the crude oil and study phase behavior properties. The main objective of this project was to characterize Alaskan North Slope crude oil and study the phase behavior, which was further used to develop a dynamic wax deposition model. This report summarizes the results of the various experimental studies. The subtasks completed during this study include measurement of density, molecular weight, viscosity, pour point, wax appearance temperature, wax content, rate of wax deposition using cold finger, compositional characterization of crude oil and wax obtained from wax content, gas-oil ratio, and phase behavior experiments including constant composition expansion and differential liberation. Also, included in this report is the development of a thermodynamic model to predict wax precipitation. From the experimental study of wax appearance temperature, it was found that wax can start to precipitate at temperatures as high as 40.6 C. The WAT obtained from cross-polar microscopy and viscometry was compared, and it was discovered that WAT from viscometry is overestimated. From the pour point experiment it was found that crude oil can cease to flow at a temperature of 12 C. From the experimental results of wax content, it is evident that the wax content in Alaskan North Slope crude oil can be as high as 28.57%. The highest gas-oil ratio for a live oil sample was observed to be 619.26 SCF

  11. WAX ActiveLibrary: a tool to manage information overload.

    Science.gov (United States)

    Hanka, R; O'Brien, C; Heathfield, H; Buchan, I E

    1999-11-01

    WAX Active-Library (Cambridge Centre for Clinical Informatics) is a knowledge management system that seeks to support doctors' decision making through the provision of electronic books containing a wide range of clinical knowledge and locally based information. WAX has been piloted in several regions in the United Kingdom and formally evaluated in 17 GP surgeries based in Cambridgeshire. The evaluation has provided evidence that WAX Active-Library significantly improves GPs' access to relevant information sources and by increasing appropriate patient management and referrals this might also lead to an improvement in clinical outcomes.

  12. Reproduction and subchronic feeding study of carnauba wax in rats.

    Science.gov (United States)

    Parent, R A; Re, T A; Babish, J G; Cox, G E; Voss, K A; Becci, P J

    1983-02-01

    The reproductive performance of Wistar rats fed carnauba wax at levels of 0.1, 0.3 or 1% in the diet and the effects of subchronic administration of carnauba wax at these dose levels on the resultant progeny were studied. Reproductive indices, body-weight gain, food consumption, haematological and clinical chemical data, ophthalmic, gross and histopathological examinations were used to study the possible toxic or pathological effects. Serum free fatty acid levels were found to be decreased in male and female rats fed carnauba wax at dietary levels of 0.3 and 1.0%. No other effects of feeding carnauba wax at levels up to 1.0% of the diet were observed.

  13. Molecular and Evolutionary Mechanisms of Cuticular Wax for Plant Drought Tolerance

    Directory of Open Access Journals (Sweden)

    Dawei Xue

    2017-04-01

    Full Text Available Cuticular wax, the first protective layer of above ground tissues of many plant species, is a key evolutionary innovation in plants. Cuticular wax safeguards the evolution from certain green algae to flowering plants and the diversification of plant taxa during the eras of dry and adverse terrestrial living conditions and global climate changes. Cuticular wax plays significant roles in plant abiotic and biotic stress tolerance and has been implicated in defense mechanisms against excessive ultraviolet radiation, high temperature, bacterial and fungal pathogens, insects, high salinity, and low temperature. Drought, a major type of abiotic stress, poses huge threats to global food security and health of terrestrial ecosystem by limiting plant growth and crop productivity. The composition, biochemistry, structure, biosynthesis, and transport of plant cuticular wax have been reviewed extensively. However, the molecular and evolutionary mechanisms of cuticular wax in plants in response to drought stress are still lacking. In this review, we focus on potential mechanisms, from evolutionary, molecular, and physiological aspects, that control cuticular wax and its roles in plant drought tolerance. We also raise key research questions and propose important directions to be resolved in the future, leading to potential applications of cuticular wax for water use efficiency in agricultural and environmental sustainability.

  14. Uncovered secret of a Vasseur-Tramond wax model.

    Science.gov (United States)

    Pastor, J F; Gutiérrez, B; Montes, J M; Ballestriero, R

    2016-01-01

    The technique of anatomical wax modelling reached its heyday in Italy during the 18th century, through a fruitful collaboration between sculptors and anatomists. It soon spread to other countries, and prestigious schools were created in England, France, Spain and Austria. Paris subsequently replaced Italy as the major centre of manufacture, and anatomical waxes were created there from the mid-19th century in workshops such as that of Vasseur-Tramond. This workshop began to sell waxes to European Faculties of Medicine and Schools of Surgery around 1880. Little is known of the technique employed in the creation of such artefacts as this was deemed a professional secret. To gain some insight into the methods of construction, we have studied a Vasseur-Tramond wax model in the Valladolid University Anatomy Museum, Spain, by means of multi-slice computerised tomography and X-ray analysis by means of environmental scanning electron microscopy. Scanning electron microscopy was used to examine the hair. These results have revealed some of the methods used to make these anatomical models and the materials employed. © 2015 Anatomical Society.

  15. Wax encapsulation of water-soluble compounds for application in foods.

    Science.gov (United States)

    Mellema, M; Van Benthum, W A J; Boer, B; Von Harras, J; Visser, A

    2006-11-01

    Water-soluble ingredients have been successfully encapsulated in wax using two preparation techniques. The first technique ('solid preparation') leads to relatively large wax particles. The second technique ('liquid preparation') leads to relatively small wax particles immersed in vegetable oil. On the first technique: stable encapsulation of water-soluble colourants (dissolved at low concentration in water) has been achieved making use of beeswax and PGPR. The leakage from the capsules, for instance of size 2 mm, is about 30% after 16 weeks storage in water at room temperature. To form such capsules a minimum wax mass of 40% relative to the total mass is needed. High amounts of salt or acids at the inside water phase causes more leaking, probably because of the osmotic pressure difference. Osmotic matching of inner and outer phase can lead to a dramatic reduction in leakage. Fat capsules are less suitable to incorporate water soluble colourants. The reason for this could be a difference in crystal structure (fat is less ductile and more brittle). On the second technique: stable encapsulation of water-soluble colourants (encapsulated in solid wax particles) has been achieved making use of carnauba wax. The leakage from the capsules, for instance of size 250 mm, is about 40% after 1 weeks storage in water at room temperature.

  16. Design of flow-field patterns for proton exchange membrane fuel cell application

    International Nuclear Information System (INIS)

    Rosli, M.I.; Wan Ramli Wan Daud; Kamaruzzaman Sopian; Jaafar Sahari

    2006-01-01

    Fuel cells are electrochemical devices that produce electricity at high efficiency without combustion. Fuel cells are emerging as viable candidates as power sources in many applications, including road vehicles, small-scale power stations, and possibly even portable electronics. This paper addresses the design of flow-field patterns for proton exchange membrane fuel cell (PEMFC). The PEMFC is a low-temperature fuel cell, in which a proton conductive polymer membrane is used as the electrolyte. In PEMFC, flow-field pattern is one important thing that effects the performance of PEMFC. This paper present three types of flow-field pattern that will be consider to be testing using CFD analysis and by experimental. The design look detail on to their shape and dimension to get the best pattern in term of more active electrode area compare to electrode area that will be used. Another advantage and disadvantage for these three type of flow-field patterns from literature also compared in this paper

  17. Bone density of defects treated with lyophilized amniotic membrane versus colagen membrane: a tomographic and histomorfogenic study in a rabbi´s femur.

    Directory of Open Access Journals (Sweden)

    Liz Ríos

    2014-09-01

    Full Text Available The aim of this study was to compare the bone density of bone defects treated with lyophilizated amniotic membrane (LAM and collagen Membrane (CM, at 3 and 5 weeks. Two bone defects of 4mm in diameter and 6mm deep were created in left distal femoral diaphysis of New Zealand rabbits (n=12. The animals were randomly divided into 2 groups. One of the defects was covered with lyophilized amniotic membrane (Rosa Chambergo Tissue Bank/National Institute of Child Health-IPEN, Lima, Peru or collagen Membrane (Dentium Co, Seoul, Korea. The second was left uncovered (NC. The rabbits were killed after 3 and 5 weeks (3 rabbits/period. The results showed a high bone density and repair of the defect by new bone. The tomographic study revealed that the bone density of the defects treated with LAM at 3 weeks was equivalent to the density obtained with CM and higher density compared with NC (p0.05. The results show that lyophilizated amniotic membrane provides bone density equal or higher to the collagen membrane.

  18. Accuracy of Digitally Fabricated Wax Denture Bases and Conventional Completed Complete Dentures

    Directory of Open Access Journals (Sweden)

    Bogna Stawarczyk

    2017-12-01

    Full Text Available The purpose of this investigation was to analyze the accuracy of digitally fabricated wax trial dentures and conventionally finalized complete dentures in comparison to a surface tessellation language (STL-dataset. A generated data set for the denture bases and the tooth sockets was used, converted into STL-format, and saved as reference. Five mandibular and 5 maxillary denture bases were milled from wax blanks and denture teeth were waxed into their tooth sockets. Each complete denture was checked on fit, waxed onto the dental cast, and digitized using an optical laboratory scanning device. The complete dentures were completed conventionally using the injection method, finished, and scanned. The resulting STL-datasets were exported into the three-dimensional (3D software GOM Inspect. Each of the 5 mandibular and 5 maxillary complete dentures was aligned with the STL- and the wax trial denture dataset. Alignment was performed based on a best-fit algorithm. A three-dimensional analysis of the spatial divergences in x-, y- and z-axes was performed by the 3D software and visualized in a color-coded illustration. The mean positive and negative deviations between the datasets were calculated automatically. In a direct comparison between maxillary wax trial dentures and complete dentures, complete dentures showed higher deviations from the STL-dataset than the wax trial dentures. The deviations occurred in the area of the teeth as well as in the distal area of the denture bases. In contrast, the highest deviations in both the mandibular wax trial dentures and the mandibular complete dentures were observed in the distal area. The complete dentures showed higher deviations on the occlusal surfaces of the teeth compared to the wax dentures. Computer-aided design/computer-aided manufacturing (CAD/CAM-fabricated wax dentures exhibited fewer deviations from the STL-reference than the complete dentures. The deviations were significantly greater in the

  19. Studies on Hydrotreating Process of Microcrystalline Wax Produced from Marine Belayim Crude Oil

    International Nuclear Information System (INIS)

    EI Karashi, S.; Marawan, H.

    2004-01-01

    Abstract Microcrystalline wax was produced from solvent dewaxing process of vacuum residue raffinate produced from Marine Belayim origin. The untreated microcrystalline wax contains trace amounts of sulfur, oxygen, nitrogen and organometallic compounds as well as heavy aromatics which affect the properties of wax applications in pharmaceutical and technical fields . Microcrystalline wax hydrotreating process was studied using digital controlled unit and Ni O-MoO 3 / Al 2 O 3 catalyst, where operating parameters that controlled the efficiency of the hydrotreated wax were studied separately at different values including reactor temperature, reactor pressure, liquid hourly space velocity and hydrogen to hydrocarbon ratio . Hydrotreated microcrystalline wax at operating conditions (temperature 300 degree C, pressure 73 kg/cm 2 , LHS V 0.52 h-l and H 2 /HC ratio 266.6 Nm 3 /m 3 ) has the best quality to be used as food grade wax

  20. Characterization of glycosylphosphatidylinositol-anchored lipid transfer protein 2 (LTPG2) and overlapping function between LTPG/LTPG1 and LTPG2 in cuticular wax export or accumulation in Arabidopsis thaliana.

    Science.gov (United States)

    Kim, Hyojin; Lee, Saet Buyl; Kim, Hae Jin; Min, Myung Ki; Hwang, Inhwan; Suh, Mi Chung

    2012-08-01

    Cuticular waxes are synthesized by the extensive export of intracellular lipids from epidermal cells. However, it is still not known how hydrophobic cuticular lipids are exported to the plant surface through the hydrophilic cell wall. The LTPG2 gene was isolated based on Arabidopsis microarray analysis; this gene is predominantly expressed in stem epidermal peels as compared with in stems. The expression of LTPG2 transcripts was observed in various organs, including stem epidermis and silique walls. The composition of the cuticular wax was significantly altered in the stems and siliques of the ltpg2 mutant and ltpg1 ltpg2 double mutant. In particular, the reduced level of the C29 alkane, which is the major component of cuticular waxes in ltpg1 ltpg2 stems and siliques, was similar to the sum of reduced values of either parent. The total cuticular wax load was reduced by approximately 13% and 20% in both ltpg2 and ltpg1 ltpg2 siliques, respectively, and by approximately 14% in ltpg1 ltpg2 stems when compared with the wild-type. Similarly, severe alterations in the cuticular layer structure of epidermal cells of ltpg2 and ltpg1 ltpg2 stems and silique walls were observed. In tobacco epidermal cells, intracellular trafficking of the fluorescent LTPG/LTPG1 and LTPG2 to the plasma membrane was prevented by a dominant-negative mutant form of ADP-ribosylation factor 1, ARF1(T31N). Taken together, these results indicate that LTPG2 is functionally overlapped with LTPG/LTPG1 during cuticular wax export or accumulation and LTPG/LTPG1 and LTPG2 are targeted to the plasma membrane via the vesicular trafficking system.

  1. Investigation of Surface Enhanced Coherent Raman Scattering on Nano-patterned Insect Wings

    Science.gov (United States)

    Ujj, Laszlo; Lawhead, Carlos

    2015-03-01

    Many insect wings (cicadas, butterflies, mosquitos) poses nano-patterned surface structure. Characterization of surface morphology and chemical composition of insect wings is important to understand the extreme mechanical properties and the biophysical functionalities of the wings. We have measured the image of the membrane of a cicada's wing with the help of Scanning Electron Microscopy (SEM). The results confirm the existing periodic structure of the wing measured previously. In order to identify the chemical composition of the wing, we have deposited silver nanoparticles on it and applied Coherent anti-Stokes Raman Spectroscopy to measure the vibrational spectra of the molecules comprising the wing for the first time. The measured spectra are consistent with the original assumption that the wing membrane is composed of protein, wax, and chitin. The results of these studies can be used to measure other nano-patterned surfaces and to make artificial materials in the future. Authors grateful for financial support from the Department of Physics of the College of Sciences Engineering and Health of UWF and the Pall Corporation for SEM imaging.

  2. Replication of specifically microstructured surfaces in A356-alloy via lost wax investment casting

    International Nuclear Information System (INIS)

    Ivanov, Todor; Bührig-Polaczek, Andreas; Vroomen, Uwe; Hartmann, Claudia; Holtkamp, Jens; Gillner, Arnold; Bobzin, Kirsten; Bagcivan, Nazlim; Theiss, Sebastian

    2011-01-01

    A common way of realizing microstructural features on metallic surfaces is to generate the designated pattern on each single part by means of microstructuring technologies such as e.g. laser ablation, electric discharge machining or micromilling. The disadvantage of these process chains is the limited productivity due to the additional processing of each part. The approach of this work is to replicate microstructured surfaces from a master pattern via lost wax investment casting in order to reach a higher productivity. We show that microholes of different sizes ( 15–22 µm at depths of 6–14 µm) can be replicated in AlSi7Mg-alloy from a laser-structured master pattern via investment casting. However, some loss of molding accuracy during the multi-stage molding process occurs. Approximately 50% of the original microfeature's heights are lost during the wax injection step. In the following process step of manufacturing a gypsum-bonded mold, a further loss in the surface quality of the microfeatures can be observed. In the final process step of casting the aluminum melt, the microfeatures are filled without any loss of molding accuracy and replicate the surface quality of the gypsum mold. The contact angle measurements of ultrapure water on the cast surfaces show a decrease in wettability on the microstructured regions (75°) compared to the unstructured region (60°)

  3. Oils; lubricants; paraffin-wax compositions; hydrocarbon condensation products

    Energy Technology Data Exchange (ETDEWEB)

    1934-04-04

    Petroleum hydrocarbons such as gasoline, kerosene, Diesel fuel oil, lubricating-oil, and paraffin wax, and like hydrocarbons such as are obtainable from shale oil and by the hydrogenation of carbonaceous materials, are improved by addition of products obtained by condensing a cyclic hydrocarbon with a saturated dihalogen derivative of an aliphatic hydrocarbon containing less than five carbon atoms. The addition of the condensation products increases the viscosity of the hydrocarbon oils specified, and is particularly useful in the case of lubricating-oils; addition of the condensation products to paraffin wax increases the transparency and adherent properties of the wax, and is useful in the manufacture of moulded articles such as candles; the products may also be used in solid lubricating-compositions.

  4. Epicuticular wax on cherry laurel (Prunus laurocerasus) leaves does not constitute the cuticular transpiration barrier.

    Science.gov (United States)

    Zeisler, Viktoria; Schreiber, Lukas

    2016-01-01

    Epicuticular wax of cherry laurel does not contribute to the formation of the cuticular transpiration barrier, which must be established by intracuticular wax. Barrier properties of cuticles are established by cuticular wax deposited on the outer surface of the cuticle (epicuticular wax) and in the cutin polymer (intracuticular wax). It is still an open question to what extent epi- and/or intracuticular waxes contribute to the formation of the transpiration barrier. Epicuticular wax was mechanically removed from the surfaces of isolated cuticles and intact leaf disks of cherry laurel (Prunus laurocerasus L.) by stripping with different polymers (collodion, cellulose acetate and gum arabic). Scanning electron microscopy showed that two consecutive treatments with all three polymers were sufficient to completely remove epicuticular wax since wax platelets disappeared and cuticle surfaces appeared smooth. Waxes in consecutive polymer strips and wax remaining in the cuticle after treatment with the polymers were determined by gas chromatography. This confirmed that two treatments of the polymers were sufficient for selectively removing epicuticular wax. Water permeability of isolated cuticles and cuticles covering intact leaf disks was measured using (3)H-labelled water before and after selectively removing epicuticular wax. Cellulose acetate and its solvent acetone led to a significant increase of cuticular permeability, indicating that the organic solvent acetone affected the cuticular transpiration barrier. However, permeability did not change after two subsequent treatments with collodion and gum arabic or after treatment with the corresponding solvents (diethyl ether:ethanol or water). Thus, in the case of P. laurocerasus the epicuticular wax does not significantly contribute to the formation of the cuticular transpiration barrier, which evidently must be established by the intracuticular wax.

  5. Method for the determination of natural ester-type gum bases used as food additives via direct analysis of their constituent wax esters using high-temperature GC/MS.

    Science.gov (United States)

    Tada, Atsuko; Ishizuki, Kyoko; Yamazaki, Takeshi; Sugimoto, Naoki; Akiyama, Hiroshi

    2014-07-01

    Natural ester-type gum bases, which are used worldwide as food additives, mainly consist of wax esters composed of long-chain fatty acids and long-chain fatty alcohols. There are many varieties of ester-type gum bases, and thus a useful method for their discrimination is needed in order to establish official specifications and manage their quality control. Herein is reported a rapid and simple method for the analysis of different ester-type gum bases used as food additives by high-temperature gas chromatography/mass spectrometry (GC/MS). With this method, the constituent wax esters in ester-type gum bases can be detected without hydrolysis and derivatization. The method was applied to the determination of 10 types of gum bases, including beeswax, carnauba wax, lanolin, and jojoba wax, and it was demonstrated that the gum bases derived from identical origins have specific and characteristic total ion chromatogram (TIC) patterns and ester compositions. Food additive gum bases were thus distinguished from one another based on their TIC patterns and then more clearly discriminated using simultaneous monitoring of the fragment ions corresponding to the fatty acid moieties of the individual molecular species of the wax esters. This direct high-temperature GC/MS method was shown to be very useful for the rapid and simple discrimination of varieties of ester-type gum bases used as food additives.

  6. Method for the determination of natural ester-type gum bases used as food additives via direct analysis of their constituent wax esters using high-temperature GC/MS

    Science.gov (United States)

    Tada, Atsuko; Ishizuki, Kyoko; Yamazaki, Takeshi; Sugimoto, Naoki; Akiyama, Hiroshi

    2014-01-01

    Natural ester-type gum bases, which are used worldwide as food additives, mainly consist of wax esters composed of long-chain fatty acids and long-chain fatty alcohols. There are many varieties of ester-type gum bases, and thus a useful method for their discrimination is needed in order to establish official specifications and manage their quality control. Herein is reported a rapid and simple method for the analysis of different ester-type gum bases used as food additives by high-temperature gas chromatography/mass spectrometry (GC/MS). With this method, the constituent wax esters in ester-type gum bases can be detected without hydrolysis and derivatization. The method was applied to the determination of 10 types of gum bases, including beeswax, carnauba wax, lanolin, and jojoba wax, and it was demonstrated that the gum bases derived from identical origins have specific and characteristic total ion chromatogram (TIC) patterns and ester compositions. Food additive gum bases were thus distinguished from one another based on their TIC patterns and then more clearly discriminated using simultaneous monitoring of the fragment ions corresponding to the fatty acid moieties of the individual molecular species of the wax esters. This direct high-temperature GC/MS method was shown to be very useful for the rapid and simple discrimination of varieties of ester-type gum bases used as food additives. PMID:25473499

  7. The maize glossy13 gene, cloned via BSR-Seq and Seq-walking encodes a putative ABC transporter required for the normal accumulation of epicuticular waxes.

    Directory of Open Access Journals (Sweden)

    Li Li

    Full Text Available Aerial plant surfaces are covered by epicuticular waxes that among other purposes serve to control water loss. Maize glossy mutants originally identified by their "glossy" phenotypes exhibit alterations in the accumulation of epicuticular waxes. By combining data from a BSR-Seq experiment and the newly developed Seq-Walking technology, GRMZM2G118243 was identified as a strong candidate for being the glossy13 gene. The finding that multiple EMS-induced alleles contain premature stop codons in GRMZM2G118243, and the one knockout allele of gl13, validates the hypothesis that gene GRMZM2G118243 is gl13. Consistent with this, GRMZM2G118243 is an ortholog of AtABCG32 (Arabidopsis thaliana, HvABCG31 (barley and OsABCG31 (rice, which encode ABCG subfamily transporters involved in the trans-membrane transport of various secondary metabolites. We therefore hypothesize that gl13 is involved in the transport of epicuticular waxes onto the surfaces of seedling leaves.

  8. Development and Performance Evaluation of Image-Based Robotic Waxing System for Detailing Automobiles.

    Science.gov (United States)

    Lin, Chi-Ying; Hsu, Bing-Cheng

    2018-05-14

    Waxing is an important aspect of automobile detailing, aimed at protecting the finish of the car and preventing rust. At present, this delicate work is conducted manually due to the need for iterative adjustments to achieve acceptable quality. This paper presents a robotic waxing system in which surface images are used to evaluate the quality of the finish. An RGB-D camera is used to build a point cloud that details the sheet metal components to enable path planning for a robot manipulator. The robot is equipped with a multi-axis force sensor to measure and control the forces involved in the application and buffing of wax. Images of sheet metal components that were waxed by experienced car detailers were analyzed using image processing algorithms. A Gaussian distribution function and its parameterized values were obtained from the images for use as a performance criterion in evaluating the quality of surfaces prepared by the robotic waxing system. Waxing force and dwell time were optimized using a mathematical model based on the image-based criterion used to measure waxing performance. Experimental results demonstrate the feasibility of the proposed robotic waxing system and image-based performance evaluation scheme.

  9. Electrically conductive carbon nanofiber/paraffin wax composites for electric thermal storage

    International Nuclear Information System (INIS)

    Zhang Kun; Han Baoguo; Yu Xun

    2012-01-01

    Highlights: ► Carbon nanofiber (CNF)/paraffin wax composite is found to be a promising electric thermal storage material. ► The thermal storage capacity of CNF/paraffin wax composite is five times of traditional electric thermal storage material. ► CNF is shown to be an effective conductive filler for the composite. - Abstract: The research of electric thermal storage (ETS) has attracted a lot of attention recently, which converts off-peak electrical energy into thermal energy and release it later at peak hours. In this study, new electric thermal storage composites are developed by employing paraffin wax as thermal storage media and carbon nanofiber (CNF) as conductive fillers. Electric heating and thermal energy release performances of the CNF/paraffin wax composites are experimentally investigated. Experimental results show that, when the composites are heated to about 70 °C, the developed electrically conductive CNF/paraffin wax composites present a thermal storage capacity of about 280 kJ/kg, which is five times of that of traditional thermal storage medium such as ceramic bricks (54 kJ/kg). The CNF/paraffin wax composites can also effectively store the thermal energy and release the thermal energy in later hours.

  10. Marginal adaptation of four inlay casting waxes on stone, titanium, and zirconia dies.

    Science.gov (United States)

    Michalakis, Konstantinos X; Kapsampeli, Vassiliki; Kitsou, Aikaterini; Kirmanidou, Yvone; Fotiou, Anna; Pissiotis, Argirios L; Calvani, Pasquale Lino; Hirayama, Hiroshi; Kudara, Yukio

    2014-07-01

    Different inlay casting waxes do not produce copings with satisfactory marginal accuracy when used on different die materials. The purpose of this study was to evaluate the marginal accuracy of 4 inlay casting waxes on stone dies and titanium and zirconia abutments and to correlate the findings with the degree of wetting between the die specimens and the inlay casting waxes. The inlay casting waxes tested were Starwax (Dentaurum), Unterziehwachs (Bredent), SU Esthetic wax (Schuler), and Sculpturing wax (Renfert). The marginal opening of the waxes was measured with a stereomicroscope on high-strength stone dies and on titanium and zirconia abutments. Photographic images were obtained, and the mean marginal opening for each specimen was calculated. A total of 1440 measurements were made. Wetting between die materials and waxes was determined after fabricating stone, titanium, and zirconia rectangular specimens. A calibrated pipette was used to place a drop of molten wax onto each specimen. The contact angle was calculated with software after an image of each specimen had been made with a digital camera. Collected data were subjected to a 2-way analysis of variance (α=.05). Any association between marginal accuracy and wetting of different materials was found by using the Pearson correlation. The wax factor had a statistically significant effect both on the marginal discrepancy (F=158.31, P<.001) and contact angle values (F=68.09, P<.001). A statistically significant effect of the die material factor both on the marginal adaptation (F=503.47, P<.001) and contact angle values (F=585.02, P<.001) was detected. A significant correlation between the marginal accuracy and the contact angle values (Pearson=0.881, P=.01) was also found. Stone dies provided wax copings with the best marginal integrity, followed by titanium and zirconia abutments. Unterziehwachs (Bredent), wax produced the best marginal adaptation on different die materials. A significant correlation was found

  11. Composition of the epicuticular waxes coating the adaxial side of Phyllostachys aurea leaves: Identification of very-long-chain primary amides.

    Science.gov (United States)

    Racovita, Radu C; Jetter, Reinhard

    2016-10-01

    The present study presents comprehensive chemical analyses of cuticular wax mixtures of the bamboo Phyllostachys aurea. The epicuticular and intracuticular waxes were sampled selectively from the adaxial side of leaves on young and old plants and investigated by gas chromatography-mass spectrometry and flame ionization detection. The epi- and intracuticular layers on young and old leaves had wax loads ranging from 1.7 μg/cm(2) to 1.9 μg/cm(2). Typical very-long-chain aliphatic wax constituents were found with characteristic chain length patterns, including alkyl esters (primarily C48), alkanes (primarily C29), fatty acids (primarily C28 and C16), primary alcohols (primarily C28) and aldehydes (primarily C30). Alicyclic wax components were identified as tocopherols and triterpenoids, including substantial amounts of triterpenoid esters. Alkyl esters, alkanes, fatty acids and aldehydes were found in greater amounts in the epicuticular layer, while primary alcohols and most terpenoids accumulated more in the intracuticular wax. Alkyl esters occurred as mixtures of metamers, combining C20 alcohol with various acids into shorter ester homologs (C36C40), and a wide range of alcohols with C22 and C24 acids into longer esters (C42C52). Primary amides were identified, with a characteristic chain length profile peaking at C30. The amides were present exclusively in the epicuticular layer and thus at or near the surface, where they may affect plant-herbivore or plant-pathogen interactions. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  13. Tectonic microplates in a wax model of sea-floor spreading

    International Nuclear Information System (INIS)

    Katz, Richard F; Ragnarsson, Rolf; Bodenschatz, Eberhard

    2005-01-01

    Rotating, growing microplates are observed in a wax analogue model of sea-floor spreading. Wax microplates are kinematically similar to sea-floor tectonic microplates in terms of spreading rate and growth rate. Furthermore, their spiral pseudofault geometry is quantitatively consistent with Schouten's oceanic microplate model. These results suggest that Schouten's edge-driven microplate model captures the kinematics of tectonic microplate evolution on Earth. Based on the wax observations, a theory for the nucleation of overlapping spreading centres, the precursors of tectonic microplates, is developed

  14. Epicuticular wax on stomata of damaged silver fir trees (Abies alba Mili.

    Directory of Open Access Journals (Sweden)

    Tomislav Bačić

    2011-01-01

    Full Text Available Condition of epistomatal wax on the abaxial surface of the current and previous-year needles of damaged silver fir trees (Abies alba Mill., both from the polluted Risnjak and "clean" Donja Dobra sites in Gorski Kotar region, both influenced by pollutants coming from Europe, during two years, three times a year, were examined with Scanning Electron Microscope. In the course of time the wax tubules on the epistomatal rims of stomata in polluted, but also in "clean" needles surface, become fused and agglomerated rapidly to various extents of morphologically different types of amorphous wax crusts, primarily compact and particulate ones. This process begins very early, especially in polluted Risnjak site, and may be interpreted as a possible result of air pollution. However, the recrystalization, or production of new tubules, also appears relatively quickly in mostly cases. Quantitative estimations indicate a very large total amount of amorphous wax crusts in the current-year needles, and a very high percentage of the same wax in previous-year needles. Amorphous wax crusts cover stomatal pores, as well as the rims, disturbing the normal gas exchange. Statistically there is a signicant tendency of increase in wax degradation in the needles of the polluted site in comparison with those of the unpolluted one, but there is an insignificant wax degradation among the needles of damaged trees within each site. These results confirmed most of the research done in our preliminary report.

  15. Biochemical response of sweet potato to bemul-wax coating ...

    African Journals Online (AJOL)

    Sweet potato (Ipomoea batatas Linn) tuber is a very nutritious but highly perishable crop that is subject to high wastages due to non-availability of appropriate storage techniques. This work assessed the effectiveness of treating the tubers with calcium chloride dip (CCD), bemul-wax (B-wax) and their combinations ...

  16. Unheimlich. From Wax Figures to the Uncanny Valley

    Directory of Open Access Journals (Sweden)

    Pietro Conte

    2012-01-01

    Full Text Available In his pioneering History of Portraiture in Wax, Julius von Schlosser traced back the age-old history of a material which at that time seemed to be already antiquated, if not obsolete. Wax sculptures were rejected and ousted from art history because of their excessive similarity and adherence to models. One hundred years later, however, hyperrealism got its revenge with Maurizio Cattelan’s celebrated hanging children. Moving from that controversial artwork and focusing on the heated polemics over it, my paper will address the question of the well-known Unheimlichkeit of wax figures, investigated by Ernst Jentsch and Sigmund Freud in the early Twentieth Century and nowadays becoming increasingly topical thanks to the recent debate about the existence and nature of the so called Uncanny Valley.

  17. Composition and morphology of cuticular wax in blueberry (Vaccinium spp.) fruits.

    Science.gov (United States)

    Chu, Wenjing; Gao, Haiyan; Cao, Shifeng; Fang, Xiangjun; Chen, Hangjun; Xiao, Shangyue

    2017-03-15

    The chemical composition and morphology of cuticular wax in mature fruit of nine blueberry cultivars were investigated using gas chromatography-mass spectrometry (GC-MS) and scanning electron microscope (SEM). Triterpenoids and β-diketones were the most prominent compounds, accounting for on average 64.2% and 16.4% of the total wax, respectively. Ursolic or oleanolic acid was identified as the most abundant triterpenoids differing in cultivars. Two β-diketones, hentriacontan-10,12-dione and tritriacontan-12,14-dione, were detected in cuticular wax of blueberry fruits for the first time. Notably, hentriacontan-10,12-dione and tritriacontan-12,14-dione were only detected in highbush (V. corymbosum) and rabbiteye (V. ashei) blueberries, respectively. The results of SEM showed that a large amount of tubular wax deposited on the surface of blueberry fruits. There was no apparent difference in wax morphology among the nine cultivars. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Characterization of a plant leaf cuticle model wax, phase behaviour of model wax–water systems

    International Nuclear Information System (INIS)

    Fagerström, Anton; Kocherbitov, Vitaly; Westbye, Peter; Bergström, Karin; Mamontova, Varvara; Engblom, Johan

    2013-01-01

    Highlights: • Four individual crystalline phases were discovered in the model wax–water system. • Eutectic melting occurred in both dry and hydrated model wax. • The total transition enthalpy is smaller for the cuticle wax than for the model wax. • Water has a large plasticizing effect on cuticle wax. • The thermotropic transitions of model wax fit in the window of extracted leaf waxes. - Abstract: We investigated the thermotropic phase behaviour of plant leaf intracuticular wax and two representatives of its main components, 1-docosanol (C 22 H 45 OH) and dotriacontane (C 32 H 66 ), in dry and hydrated state. One objective was to obtain a model wax, which can be used to estimate formulations effects on cuticle diffusivity in vitro. The two wax components were chosen based on results from Gas Chromatography coupled to Mass Spectrometry analysis of cuticular wax. The wax was extracted from Clivia Miniata Regel leaves and contained 68% primary alcohols (C 16 –C 32 ) and 16% n-alkanes (C 21 –C 33 ). Differential Scanning Calorimetry, Polarized Light Microscopy and Small- and Wide Angle X-ray Diffraction were used to characterize the cuticular extract and the phase behaviour of the C 22 H 45 OH/C 32 H 66 /H 2 O model system. Four individual crystalline phases were discovered in the model wax–water system and eutectic melting occurred in both dry and hydrated state. The thermotropic transitions of the model wax occur within the broader transition region of the extracted leaf wax

  19. Methods for separating boron from borated paraffin wax and its determination by ion chromatography

    International Nuclear Information System (INIS)

    Jeyakumar, S.

    2015-01-01

    Boron compounds are found to be useful in shielding against high-energy neutrons. In radiotherapy treatments, in order to protect occupational workers and patients from the undesirable neutron and gamma doses, paraffin wax containing B 4 C/boric acid is used. Low-level borate wastes generated from the nuclear power plants have been immobilized with paraffin wax using a concentrate waste drying system (CWDS). Borated paraffin waxes are prepared by mixing calculated amounts of either boric acid or boron carbide with the molten wax. This necessitates the determination of boron at different locations in order to check the homogeneous distribution of B over the borated wax. The determination of boron in nuclear materials is inevitable due to its high neutron absorption cross section. For the determination of boron in borated waxes, not many methods have been reported. A method based on the pyrohydrolysis extraction of boron and its quantification with ion chromatography was proposed for paraffin waxes borated with H 3 BO 3 and B 4 C. The B 4 C optimum pyrohydrolysis conditions were identified. Wax samples were mixed with U 3 O 8 , which prevents the sample from flare up, and also accelerates the extraction of boron. Pyrohydrolysis was carried out with moist O 2 at 950℃ for 60 and 90 min for wax with H 3 BO 3 and wax with B 4 C, respectively. Two simple methods of separation based on alkali extraction and melting wax in alkali were also developed exclusively for wax with H 3 BO 3 . In all the separations, the recovery of B was above 98%. During IC separation, B was separated as boron-mannitol anion complex. Linear calibration was obtained between 0.1 and 50 ppm of B, and LOD was calculated as 5 ppb (S/N=3). The reproducibility was better than 5% (RSD)

  20. Copper recovery in a bench-scale carrier facilitated tubular supported liquid membrane system

    Directory of Open Access Journals (Sweden)

    Makaka S.

    2010-01-01

    Full Text Available The extraction of copper ions in a tubular supported liquid membrane using LIX 984NC as a mobile carrier was studied, evaluating the effect of the feed characteristics (flowrate, density, viscosity on the feedside laminar layer of the membrane. A vertical countercurrent, double pipe perspex benchscale reactor consisting of a single hydrophobic PVDF tubular membrane mounted inside was used in all test work. The membrane was impregnated with LIX 984NC and became the support for this organic transport medium. Dilute Copper solution passed through the centre pipe and sulphuric acid as strippant passed through the shell side. Copper was successfully transported from the feedside to the stripside and from the data obtained, a relationship between Schmidt, Reynolds and Sherwood number was achieved of.

  1. Problems in interpreting effects of air pollutants on spruce epicuticular waxes

    International Nuclear Information System (INIS)

    Bermadinger-Stabentheiner, E.

    1994-01-01

    Spruce needles are covered with rod-like crystals, which also fill the antechambers of the stomata with a dense meshwork. The scanning electron microscope (SEM) is very useful for studying epicuticular wax structure; with no intricate or laborious preparation, it is possible to obtain valuable information about the needle surface. Because the epicuticular wax layer forms a barrier between the plant and its environment, all influences that reach the surface from outside impact on this layer and, therefore, changes in epicuticular wax structure serve as diagnostic criteria for damage caused by air pollutants. This pollution influence begins as fusion of wax rods at the tips and results finally in total loss of the crystalline structure. Despite the simplicity of SEM investigations, alterations (artefacts) can occur to wax structures that may be confused with alterations caused by air pollutants (i.e., a too dense layer of twigs and needles, or careless handling with tweezers, results in mechanical damage that often influences the entire surface). Overheating occurring during transport or preparation and/or incorrect storage also produce artefacts. If the occurrence of such artefacts is taken into consideration, several contradictory interpretations of effects of air pollutants on epicuticular waxes can be explained. (orig.)

  2. Exploiting lipopolysaccharide-induced deformation of lipid bilayers to modify membrane composition and generate two-dimensional geometric membrane array patterns

    Energy Technology Data Exchange (ETDEWEB)

    Adams, Peter G. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Swingle, Kirstie L. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of New Mexico, Albuquerque, NM (United States); Paxton, Walter F. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Nogan, John J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Stromberg, Loreen R. [Univ. of New Mexico, Albuquerque, NM (United States); Firestone, Millicent A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mukundan, Harshini [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); New Mexico Consortium, Los Alamos, NM (United States); Montaño, Gabriel A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-05-27

    Supported lipid bilayers have proven effective as model membranes for investigating biophysical processes and in development of sensor and array technologies. The ability to modify lipid bilayers after their formation and in situ could greatly advance membrane technologies, but is difficult via current state-of-the-art technologies. Here we demonstrate a novel method that allows the controlled post-formation processing and modification of complex supported lipid bilayer arrangements, under aqueous conditions. We exploit the destabilization effect of lipopolysaccharide, an amphiphilic biomolecule, interacting with lipid bilayers to generate voids that can be backfilled to introduce desired membrane components. We further demonstrate that when used in combination with a single, traditional soft lithography process, it is possible to generate hierarchically-organized membrane domains and microscale 2-D array patterns of domains. Significantly, this technique can be used to repeatedly modify membranes allowing iterative control over membrane composition. This approach expands our toolkit for functional membrane design, with potential applications for enhanced materials templating, biosensing and investigating lipid-membrane processes.

  3. Influence of Different Waxes on the Physical Properties of Linear ...

    African Journals Online (AJOL)

    NJD

    2005-12-22

    Dec 22, 2005 ... viscosity of a polymer melt. In many instances it ... amounts of different waxes on the viscosity (melt flow) of ..... Since the MFI is a direct measure of the viscosity .... melt flow index increasing with increasing wax content. There.

  4. Wax Impaction in Nigerian School Children. | Eziyi | East and ...

    African Journals Online (AJOL)

    Background: Impacted wax has been classified as an ear disease. It can cause pain, itching, tinnitus hearing loss or otitis externa. The prevalence of cerumen impaction varies. The aim of this study was to determine the prevalence of impacted ear wax in primary school children and to determine, if there is any association ...

  5. Oil-structuring characterization of natural waxes in canola oil oleogels: Rheological, thermal, and oxidative properties

    Science.gov (United States)

    Natural waxes (candelilla wax, carnauba wax, and beeswax) were utilized as canola oil structurants to produce oleogels and their physicochemical properties were evaluated from rheological, thermal, and oxidative points of view. The oleogels with candelilla wax exhibited the highest hardness, followe...

  6. Characterization of a plant leaf cuticle model wax, phase behaviour of model wax–water systems

    Energy Technology Data Exchange (ETDEWEB)

    Fagerström, Anton, E-mail: anton.fagerstrom@mah.se [Biomedical Science, Faculty of Health and Society, Malmö University, Malmö (Sweden); Kocherbitov, Vitaly [Biomedical Science, Faculty of Health and Society, Malmö University, Malmö (Sweden); Westbye, Peter; Bergström, Karin [Agro Applications Europe, AkzoNobel Surface Chemistry AB, Stenungsund (Sweden); Mamontova, Varvara [Ecological and Chemical Research, St. Petersburg Scientific Research Center for Ecological Safety, Russian Academy of Sciences, St. Petersburg (Russian Federation); Engblom, Johan [Biomedical Science, Faculty of Health and Society, Malmö University, Malmö (Sweden)

    2013-11-10

    Highlights: • Four individual crystalline phases were discovered in the model wax–water system. • Eutectic melting occurred in both dry and hydrated model wax. • The total transition enthalpy is smaller for the cuticle wax than for the model wax. • Water has a large plasticizing effect on cuticle wax. • The thermotropic transitions of model wax fit in the window of extracted leaf waxes. - Abstract: We investigated the thermotropic phase behaviour of plant leaf intracuticular wax and two representatives of its main components, 1-docosanol (C{sub 22}H{sub 45}OH) and dotriacontane (C{sub 32}H{sub 66}), in dry and hydrated state. One objective was to obtain a model wax, which can be used to estimate formulations effects on cuticle diffusivity in vitro. The two wax components were chosen based on results from Gas Chromatography coupled to Mass Spectrometry analysis of cuticular wax. The wax was extracted from Clivia Miniata Regel leaves and contained 68% primary alcohols (C{sub 16}–C{sub 32}) and 16% n-alkanes (C{sub 21}–C{sub 33}). Differential Scanning Calorimetry, Polarized Light Microscopy and Small- and Wide Angle X-ray Diffraction were used to characterize the cuticular extract and the phase behaviour of the C{sub 22}H{sub 45}OH/C{sub 32}H{sub 66}/H{sub 2}O model system. Four individual crystalline phases were discovered in the model wax–water system and eutectic melting occurred in both dry and hydrated state. The thermotropic transitions of the model wax occur within the broader transition region of the extracted leaf wax.

  7. Anatomical models and wax Venuses: art masterpieces or scientific craft works?

    Science.gov (United States)

    Ballestriero, R

    2010-02-01

    The art of wax modelling has an ancient origin but rose to prominence in 14th century Italy with the cult of votive artefacts. With the advent of Neoclassicism this art, now deemed repulsive, continued to survive in a scientific environment, where it flourished in the study of normal and pathological anatomy, obstetrics, zoology and botany. The achievement of having originated the creation of anatomical models in coloured wax must be ascribed to a joint effort undertaken by the Sicilian wax modeller Gaetano Giulio Zumbo and the French surgeon Guillaume Desnoues in the late 17th century. Interest in anatomical wax models spread throughout Europe during the 18th century, first in Bologna with Ercole Lelli, Giovanni Manzolini and Anna Morandi, and then in Florence with Felice Fontana and Clemente Susini. In England, the art of anatomical ceroplastics was brought to London from Florence by the sculptor Joseph Towne. Throughout the centuries many anatomical artists preferred this material due to the remarkable mimetic likeness obtained, far surpassing any other material. Independent of the material used, whether wood, wax or clay, anatomical models were always considered merely craft works confined to hospitals or faculties of medicine and have survived to this day only because of their scientific interest. Italian and English waxes are stylistically different but the remarkable results obtained by Susini and Towne, and the fact that some contemporary artists are again representing anatomical wax bodies in their works, makes the border that formerly separated art and craft indistinguishable.

  8. Highlighting nonlinear patterns in population genetics datasets

    KAUST Repository

    Alanis Lobato, Gregorio

    2015-01-30

    Detecting structure in population genetics and case-control studies is important, as it exposes phenomena such as ecoclines, admixture and stratification. Principal Component Analysis (PCA) is a linear dimension-reduction technique commonly used for this purpose, but it struggles to reveal complex, nonlinear data patterns. In this paper we introduce non-centred Minimum Curvilinear Embedding (ncMCE), a nonlinear method to overcome this problem. Our analyses show that ncMCE can separate individuals into ethnic groups in cases in which PCA fails to reveal any clear structure. This increased discrimination power arises from ncMCE\\'s ability to better capture the phylogenetic signal in the samples, whereas PCA better reflects their geographic relation. We also demonstrate how ncMCE can discover interesting patterns, even when the data has been poorly pre-processed. The juxtaposition of PCA and ncMCE visualisations provides a new standard of analysis with utility for discovering and validating significant linear/nonlinear complementary patterns in genetic data.

  9. Highlighting nonlinear patterns in population genetics datasets

    KAUST Repository

    Alanis Lobato, Gregorio; Cannistraci, Carlo Vittorio; Eriksson, Anders; Manica, Andrea; Ravasi, Timothy

    2015-01-01

    Detecting structure in population genetics and case-control studies is important, as it exposes phenomena such as ecoclines, admixture and stratification. Principal Component Analysis (PCA) is a linear dimension-reduction technique commonly used for this purpose, but it struggles to reveal complex, nonlinear data patterns. In this paper we introduce non-centred Minimum Curvilinear Embedding (ncMCE), a nonlinear method to overcome this problem. Our analyses show that ncMCE can separate individuals into ethnic groups in cases in which PCA fails to reveal any clear structure. This increased discrimination power arises from ncMCE's ability to better capture the phylogenetic signal in the samples, whereas PCA better reflects their geographic relation. We also demonstrate how ncMCE can discover interesting patterns, even when the data has been poorly pre-processed. The juxtaposition of PCA and ncMCE visualisations provides a new standard of analysis with utility for discovering and validating significant linear/nonlinear complementary patterns in genetic data.

  10. Sintering of wax for controlling release from pellets

    OpenAIRE

    Singh, Reena; Poddar, S. S.; Chivate, Amit

    2007-01-01

    The purpose of the present study was to investigate incorporation of hydrophobic (ie, waxy) material into pellets using a thermal sintering technique and to evaluate the pellets in vitro for controlled release. Pellets prepared by extrusion-spheronization technology were formulated with a water-soluble drug, microcrystalline cellulose, and carnauba wax. Powdered carnauba wax (4%–20%) prepared by grinding or by emulsification was studied with an attempt to retard the drug release. The inclusio...

  11. Development of formulations and processes to incorporate wax oleogels in ice cream.

    Science.gov (United States)

    Zulim Botega, Daniele C; Marangoni, Alejandro G; Smith, Alexandra K; Goff, H Douglas

    2013-12-01

    The objective of this study was to investigate the influence of emulsifiers, waxes, fat concentration, and processing conditions on the application of wax oleogel to replace solid fat content and create optimal fat structure in ice cream. Ice creams with 10% or 15% fat were formulated with rice bran wax (RBW), candelilla wax (CDW), or carnauba wax (CBW) oleogels, containing 10% wax and 90% high-oleic sunflower oil. The ice creams were produced using batch or continuous freezing processes. Transmission electron microscopy (TEM) and cryo-scanning electron microscopy were used to evaluate the microstructure of ice cream and the ultrastructure of oleogel droplets in ice cream mixes. Among the wax oleogels, RBW oleogel had the ability to form and sustain structure in 15% fat ice creams when glycerol monooleate (GMO) was used as the emulsifier. TEM images revealed that the high degree of fat structuring observed in GMO samples was associated with the RBW crystal morphology within the fat droplet, which was characterized by the growth of crystals at the outer edge of the droplet. Continuous freezing improved fat structuring compared to batch freezing. RBW oleogels established better structure compared to CDW or CBW oleogels. These results demonstrate that RBW oleogel has the potential to develop fat structure in ice cream in the presence of GMO and sufficiently high concentrations of oleogel. © 2013 Institute of Food Technologists®

  12. Physico-chemical properties and efficacy of silk fibroin fabric coated with different waxes as wound dressing.

    Science.gov (United States)

    Kanokpanont, Sorada; Damrongsakkul, Siriporn; Ratanavaraporn, Juthamas; Aramwit, Pornanong

    2013-04-01

    Silk fibroin (SF) has been widely used as a wound dressing material due to its suitable physical and biological characteristics. In this study, a non-adhesive wound dressing which applies to cover the wound surface as an absorbent pad that would absorb wound fluid while accelerate wound healing was developed. The modification of SF fabrics by wax coating was purposed to prepare the non-adhesive wound dressing that is required in order to minimize pain and risk of repeated injury. SF woven fabrics were coated with different types of waxes including shellac wax, beeswax, or carnauba wax. Physical and mechanical properties of the wax-coated SF fabrics were characterized. It was clearly observed that all waxes could be successfully coated on the SF fabrics, possibly due to the hydrophobic interactions between hydrophobic domains of SF and waxes. The wax coating improved tensile modulus and percentage of elongation of the SF fabrics due to the denser structure and the thicker fibers coated. The in vitro degradation study demonstrated that all wax-coated SF fabrics remained up to 90% of their original weights after 7 weeks of incubation in lysozyme solution under physiological conditions. The wax coating did not affect the degradation behavior of the SF fabrics. A peel test of the wax-coated SF fabrics was carried out in the partial- and full-thickness wounds of porcine skin in comparison to that of the commercial wound dressing. Any wax-coated SF fabrics were less adhesive than the control, as confirmed by less number of cells attached and less adhesive force. This might be that the wax-coated SF fabrics showed the hydrophobic property, allowing the loosely adherence to the hydrophilic wound surface. In addition, the in vivo biocompatibility test of the wax-coated SF fabrics was performed in Sprague-Dawley rats with subcutaneous model. The irritation scores indicated that the carnauba wax-coated SF fabric was not irritant while the shellac wax or beeswax-coated SF

  13. Synthesis of oleyl oleate wax esters in Arabidopsis thaliana and Camelina sativa seed oil.

    Science.gov (United States)

    Iven, Tim; Hornung, Ellen; Heilmann, Mareike; Feussner, Ivo

    2016-01-01

    Seed oil composed of wax esters with long-chain monoenoic acyl moieties represents a high-value commodity for industry. Such plant-derived sperm oil-like liquid wax esters are biodegradable and can have excellent properties for lubrication. In addition, wax ester oil may represent a superior substrate for biodiesel production. In this study, we demonstrate that the low-input oil seed crop Camelina sativa can serve as a biotechnological platform for environmentally benign wax ester production. Two biosynthetic steps catalysed by a fatty alcohol-forming acyl-CoA reductase (FAR) and a wax ester synthase (WS) are sufficient to achieve wax ester accumulation from acyl-CoA substrates. To produce plant-derived sperm oil-like liquid wax esters, the WS from Mus musculus (MmWS) or Simmondsia chinensis (ScWS) were expressed in combination with the FAR from Mus musculus (MmFAR1) or Marinobacter aquaeolei (MaFAR) in seeds of Arabidopsis thaliana and Camelina sativa. The three analysed enzyme combinations Oleo3:mCherry:MmFAR1∆c/Oleo3:EYFP:MmWS, Oleo3:mCherry:MmFAR1∆c/ScWS and MaFAR/ScWS showed differences in the wax ester molecular species profiles and overall biosynthetic performance. By expressing MaFAR/ScWS in Arabidopsis or Camelina up to 59% or 21% of the seed oil TAGs were replaced by wax esters, respectively. This combination also yielded wax ester molecular species with highest content of monounsaturated acyl moieties. Expression of the enzyme combinations in the Arabidopsis fae1 fad2 mutant background high in oleic acid resulted in wax ester accumulation enriched in oleyl oleate (18:1/18:1 > 60%), suggesting that similar values may be obtained with a Camelina high oleic acid line. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  14. QUALITATIVE ANALYSIS METHOD OF DETECTION OF WAX CONTENT IN GORENGAN USING SMARTPHONE

    Directory of Open Access Journals (Sweden)

    Yulia Yulia

    2018-05-01

    Full Text Available Wax is one of the compounds that can be misused to be added to Gorengan, Indonesian fritter, to keep them crispy. Gorengan containing wax is difficult to identify visually, so a quick and easy method of detecting wax content is required. The purpose of this research is to develop and evaluate the analytical performance of detecting wax content in gorengan using smartphone. Gorengan sample was dissolved with hexane and then added reagent that will give discoloration followed by analysis using smartphone. Some analysis performance parameters were evaluated in terms of linearity and detection limit, qualitative analysis capability, precision, and selectivity test. The developed method was also applied in some gorengan samples. The result shows that the detection of wax content in gorengan can be conducted by using reagent consisting of NaOH, Schift, and curcumin (1 : 2 : 2. Performance analysis shows that the linearity measurement at concentration between 10% and 25% has correlation coefficient (r of 0.9537 with detection limit at concentration of 2% and precision (%RSD less than 3%. The developed method can be applied for the detection of wax content in gorengan in the market.

  15. Purification of a jojoba embryo wax synthase, cloning of its cDNA, and production of high levels of wax in seeds of transgenic arabidopsis.

    Science.gov (United States)

    Lardizabal, K D; Metz, J G; Sakamoto, T; Hutton, W C; Pollard, M R; Lassner, M W

    2000-03-01

    Wax synthase (WS, fatty acyl-coenzyme A [coA]: fatty alcohol acyltransferase) catalyzes the final step in the synthesis of linear esters (waxes) that accumulate in seeds of jojoba (Simmondsia chinensis). We have characterized and partially purified this enzyme from developing jojoba embryos. A protein whose presence correlated with WS activity during chromatographic fractionation was identified and a cDNA encoding that protein was cloned. Seed-specific expression of the cDNA in transgenic Arabidopsis conferred high levels of WS activity on developing embryos from those plants. The WS sequence has significant homology with several Arabidopsis open reading frames of unknown function. Wax production in jojoba requires, in addition to WS, a fatty acyl-CoA reductase (FAR) and an efficient fatty acid elongase system that forms the substrates preferred by the FAR. We have expressed the jojoba WS cDNA in Arabidopsis in combination with cDNAs encoding the jojoba FAR and a beta-ketoacyl-CoA synthase (a component of fatty acid elongase) from Lunaria annua. (13)C-Nuclear magnetic resonance analysis of pooled whole seeds from transgenic plants indicated that as many as 49% of the oil molecules in the seeds were waxes. Gas chromatography analysis of transmethylated oil from individual seeds suggested that wax levels may represent up to 70% (by weight) of the oil present in those seeds.

  16. The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems.

    Science.gov (United States)

    Lee, Hong Gil; Kim, Juyoung; Suh, Mi Chung; Seo, Pil Joon

    2017-07-01

    Cuticular wax is an important hydrophobic layer that covers the plant aerial surface. Cuticular wax biosynthesis is shaped by multiple layers of regulation. In particular, a pair of R2R3-type MYB transcription factors, MYB96 and MYB30, are known to be the main participants in cuticular wax accumulation. Here, we report that the MYB30-INTERACTING E3 LIGASE 1 (MIEL1) E3 ubiquitin ligase controls the protein stability of the two MYB transcription factors and thereby wax biosynthesis in Arabidopsis. MIEL1-deficient miel1 mutants exhibit increased wax accumulation in stems, with up-regulation of wax biosynthetic genes targeted by MYB96 and MYB30. Genetic analysis reveals that wax accumulation of the miel1 mutant is compromised by myb96 or myb30 mutation, but MYB96 is mainly epistatic to MIEL1, playing a predominant role in cuticular wax deposition. These observations indicate that the MIEL1-MYB96 module is important for balanced cuticular wax biosynthesis in developing inflorescence stems. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  17. Inverse gradients in leaf wax δD and δ13C values along grass blades of Miscanthus sinensis: implications for leaf wax reproduction and plant physiology.

    Science.gov (United States)

    Gao, Li; Huang, Yongsong

    2013-06-01

    Compound specific hydrogen and carbon isotopic ratios of higher plant leaf waxes have been extensively used in paleoclimate and paleoenvironmental reconstructions. However, studies so far have focused on the comparison of leaf wax isotopic differences in bulk leaf samples between different plant species. We sampled three different varieties of tall grasses (Miscanthus sinensis) in six segments from base to tip and determined hydrogen and carbon isotopic ratios of leaf waxes, as well as hydrogen and oxygen isotopic ratios of leaf water samples. We found an increasing, base-to-tip hydrogen isotopic gradient along the grass blades that can probably be attributed to active leaf wax regeneration over the growth season. Carbon isotopic ratios, on the other hand, show opposite trends to hydrogen isotopic ratios along the grass blades, which may reflect different photosynthetic efficiencies at different blade locales.

  18. Antioxidant effect of 4-nerolidylcatechol and α-tocopherol in erythrocyte ghost membranes and phospholipid bilayers

    International Nuclear Information System (INIS)

    Fernandes, K.S.; Silva, A.H.M.; Mendanha, S.A.; Rezende, K.R.; Alonso, A.

    2013-01-01

    4-Nerolidylcatechol (4-NC) is found in Pothomorphe umbellata root extracts and is reported to have a topical protective effect against UVB radiation-induced skin damage, toxicity in melanoma cell lines, and antimalarial activity. We report a comparative study of the antioxidant activity of 4-NC and α-tocopherol against lipid peroxidation initiated by two free radical-generating systems: 2,2′-azobis(2-aminopropane) hydrochloride (AAPH) and FeSO 4 /H 2 O 2 , in red blood cell ghost membranes and in egg phosphatidylcholine (PC) vesicles. Lipid peroxidation was monitored by membrane fluidity changes assessed by electron paramagnetic resonance spectroscopy of a spin-labeled lipid and by the formation of thiobarbituric acid-reactive substances. When lipoperoxidation was initiated by the hydroxyl radical in erythrocyte ghost membranes, both 4-NC and α-tocopherol acted in a very efficient manner. However, lower activities were observed when lipoperoxidation was initiated by the peroxyl radical; and, in this case, the protective effect of α-tocopherol was lower than that of 4-NC. In egg PC vesicles, malondialdehyde formation indicated that 4-NC was effective against lipoperoxidation initiated by both AAPH and FeSO 4 /H 2 O 2 , whereas α-tocopherol was less efficient in protecting against lipoperoxidation by AAPH, and behaved as a pro-oxidant for FeSO 4 /H 2 O 2 . The DPPH (2,2-diphenyl-1-picrylhydrazyl) free-radical assay indicated that two free radicals were scavenged per 4-NC molecule, and one free radical was scavenged per α-tocopherol molecule. These data provide new insights into the antioxidant capacity of 4-NC, which may have therapeutic applications for formulations designed to protect the skin from sunlight irradiation

  19. Properties of made by different methods of RP impeller foundry patterns

    Directory of Open Access Journals (Sweden)

    G. Budzik

    2007-04-01

    Full Text Available This article presents the tests of properties of foundry patterns of turbocharger turbine impeller. Impellers prototypes were predestinated for casting by method losing patterns. There were carried out tests of these prototypes made by different methods of Rapid Prototyping (RP. Two impeller were made by growth methods: stereolitography (SLA and three dimensional printing (3DP. One prototype was made by the method of Vacuum Casting as a wax casting. Tests were executed in the Department of Machine Design of Rzeszow University of Technology in cooperation with WSK PZL Rzeszow and Car Technology Krakow. First impeller was carried out by method of stereolitography on SLA 250 plant. That pattern was also used to carry out silicon matrix for casting of wax pattern. Next pattern was printed by three dimensional printer Z510 from the powder ZP14. Good removability of the pattern from the mould is particularly essential for impellers of small turbines with blades of small thickness of their section. All pattern were tested on their removability from the ceramic mould. The best melting properties had the wax pattern. Patterns made from resin SL5170 (SLA and powder ZP14 (3DP were removed in the process of burning but about 1% of soot was left in the mould.

  20. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  1. Analysis of the constituents in jojoba wax used as a food additive by LC/MS/MS.

    Science.gov (United States)

    Tada, Atsuko; Jin, Zhe-Long; Sugimoto, Naoki; Sato, Kyoko; Yamazaki, Takeshi; Tanamoto, Kenichi

    2005-10-01

    Jojoba wax is a natural gum base used as a food additive in Japan, and is obtained from jojoba oil with a characteristically high melting point. Although the constituents of jojoba oil have been reported, the quality of jojoba wax used as a food additive has not yet been clarified. In order to evaluate its quality as a food additive and to obtain basic information useful for setting official standards, we investigated the constituents and their concentrations in jojoba wax. LC/MS analysis of the jojoba wax showed six peaks with [M+H]+ ions in the range from m/z 533.6 to 673.7 at intervals of m/z 28. After isolation of the components of the four main peaks by preparative LC/MS, the fatty acid and long chain alcohol moieties of the wax esters were analyzed by methanolysis and hydrolysis, followed by GC/MS. The results indicated that the main constituents in jojoba wax were various kinds of wax esters, namely eicosenyl octadecenoate (C20:1-C18:1) (1), eicosenyl eicosenoate (C20:1-C20:1) (II), docosenyl eicosenoate (C22:1-C20:1) (III), eicosenyl docosenoate (C20:1-C22:1) (IV) and tetracosenyl eiosenoate (C24:1-C20:1) (V). To confirm and quantify the wax esters in jojoba wax directly, LC/MS/MS analysis was performed. The product ions corresponding to the fatty acid moieties of the wax esters were observed, and by using the product ions derived from the protonated molecular ions of wax esters the fatty acid moieties were identified by MRM analysis. The concentrations of the wax esters I, II and III, in jojoba wax were 5.5, 21.4 and 37.8%, respectively. In summary, we clarified the main constituents of jojoba wax and quantified the molecular species of the wax esters without hydrolysis by monitoring their product ions, using a LC/MS/MS system.

  2. SEPARATION OF FISCHER-TROPSCH WAX PRODUCTS FROM ULTRAFINE IRON CATALYST PARTICLES

    Energy Technology Data Exchange (ETDEWEB)

    James K. Neathery; Gary Jacobs; Burtron H. Davis

    2004-03-31

    In this reporting period, a fundamental filtration study was started to investigate the separation of Fischer-Tropsch Synthesis (FTS) liquids from iron-based catalyst particles. Slurry-phase FTS in slurry bubble column reactor systems is the preferred mode of production since the reaction is highly exothermic. Consequently, heavy wax products must be separated from catalyst particles before being removed from the reactor system. Achieving an efficient wax product separation from iron-based catalysts is one of the most challenging technical problems associated with slurry-phase FTS. The separation problem is further compounded by catalyst particle attrition and the formation of ultra-fine iron carbide and/or carbon particles. Existing pilot-scale equipment was modified to include a filtration test apparatus. After undergoing an extensive plant shakedown period, filtration tests with cross-flow filter modules using simulant FTS wax slurry were conducted. The focus of these early tests was to find adequate mixtures of polyethylene wax to simulate FTS wax. Catalyst particle size analysis techniques were also developed. Initial analyses of the slurry and filter permeate particles will be used by the research team to design improved filter media and cleaning strategies.

  3. Prediction of wax buildup in 24 inch cold, deep sea oil loading line

    Energy Technology Data Exchange (ETDEWEB)

    Asperger, R.G.; Sattler, R.E.; Tolonen, W.J.; Pitchford, A.C.

    1981-10-01

    When designing pipelines for cold environments, it is important to know how to predict potential problems due to wax deposition on the pipeline's inner surface. The goal of this work was to determine the rate of wax buildup and the maximum, equlibrium wax thickness for a North Sea field loading line. The experimental techniques and results used to evaluate the waxing potential of the crude oil (B) are described. Also, the theoretic model which was used for predicting the maximum wax deposit thickness in the crude oil (B) loading pipeline at controlled temperatures of 40 F (4.4 C) and 100 F (38 C), is illustrated. Included is a recommendation of a procedure for using hot oil at the end of a tanker loading period in order to dewax the crude oil (B) line. This technique would give maximum heating of the pipeline and should be followed by shutting the hot oil into the pipeline at the end of the loading cycle which will provide a hot oil soaking to help soften existing wax. 14 references.

  4. Laboratory Deposition Apparatus to Study the Effects of Wax Deposition on Pipe Magnetic Field Leakage Signals

    Directory of Open Access Journals (Sweden)

    Karim Mohd Fauzi Abd

    2014-07-01

    Full Text Available Accurate technique for wax deposition detection and severity measurement on cold pipe wall is important for pipeline cleaning program. Usually these techniques are validated by conventional techniques on laboratory scale wax deposition flow loop. However conventional techniques inherent limitations and it is difficult to reproduce a predetermine wax deposit profile and hardness at designated location in flow loop. An alternative wax deposition system which integrates modified pour casting method and cold finger method is presented. This system is suitable to reproduce high volume of medium hard wax deposit in pipe with better control of wax deposit profile and hardness.

  5. Effect of waste wax and chain structure on the mechanical and physical properties of polyethylene

    Directory of Open Access Journals (Sweden)

    M.A. AlMaadeed

    2015-05-01

    The wax dispersion in the matrix strongly depends on the percentage of wax added to the polymer and the molecular structure of the polymer. It was found that increasing the wax content enhances the phase separation. LDPE undergoes less phase separation due to its highly branched structure composed of a network of short and long chain branches. The wax has no pronounced plasticising effect on the polymer. This is clearly manifested in LDPE as no change in the melting temperature occurred. LLDPE and HDPE were slightly affected by a high concentration of wax (30% and 40%. This is due to the non-uniform distribution of short chain branching along the LLDPE and HDPE main chains, which can interact with the wax structure.

  6. Rheological profiling of organogels prepared at critical gelling concentrations of natural waxes in a triacylglycerol solvent.

    Science.gov (United States)

    Patel, Ashok R; Babaahmadi, Mehrnoosh; Lesaffer, Ans; Dewettinck, Koen

    2015-05-20

    The aim of this study was to use a detailed rheological characterization to gain new insights into the gelation behavior of natural waxes. To make a comprehensive case, six natural waxes (differing in the relative proportion of chemical components: hydrocarbons, fatty alcohols, fatty acids, and wax esters) were selected as organogelators to gel high-oleic sunflower oil. Flow and dynamic rheological properties of organogels prepared at critical gelling concentrations (Cg) of waxes were studied and compared using drag (stress ramp and steady flow) and oscillatory shear (stress and frequency sweeps) tests. Although, none of the organogels satisfied the rheological definition of a "strong gel" (G″/G' (ω) ≤ 0.1), on comparing the samples, the strongest gel (highest critical stress and dynamic, apparent, and static yield stresses) was obtained not with wax containing the highest proportion of wax esters alone (sunflower wax, SFW) but with wax containing wax esters along with a higher proportion of fatty alcohols (carnauba wax, CRW) although at a comparatively higher Cg (4%wt for latter compared to 0.5%wt for former). As expected, gel formation by waxes containing a high proportion of lower melting fatty acids (berry, BW, and fruit wax, FW) required a comparatively higher Cg (6 and 7%wt, respectively), and in addition, these gels showed the lowest values for plateau elastic modulus (G'LVR) and a prominent crossover point at higher frequency. The gelation temperatures (TG'=G″) for all the studied gels were lower than room temperature, except for SFW and CRW. The yielding-type behavior of gels was evident, with most gels showing strong shear sensitivity and a weak thixotropic recovery. The rheological behavior was combined with the results of thermal analysis and microstructure studies (optical, polarized, and cryo-scanning electron microscopy) to explain the gelation properties of these waxes.

  7. Subchronic feeding study of carnauba wax in beagle dogs.

    Science.gov (United States)

    Parent, R A; Cox, G E; Babish, J G; Gallo, M A; Hess, F G; Becci, P J

    1983-02-01

    Carnauba wax fed at levels of 0.1, 0.3 and 1% in the diet to beagle dogs for 28 wk did not produce evidence of toxicity or pathological effects. Body weight gain, food consumption, clinical chemical, haematological, and urine analysis data, and organ weights of animals fed carnauba wax were comparable with those of control animals. Ophthalmic, gross and histopathological examinations revealed no significant treatment-related findings.

  8. Electrochemical behaviors of wax-coated Li powder/Li 4Ti 5O 12 cells

    Science.gov (United States)

    Park, Han Eol; Seong, Il Won; Yoon, Woo Young

    The wax-coated Li powder specimen was effectively synthesized using the drop emulsion technique (DET). The wax layer on the powder was verified by SEM, Focused Ion Beam (FIB), EDX and XPS. The porosity of a sintered wax-coated Li electrode was measured by linear sweep voltammetry (LSV) and compared with that of a bare, i.e., un-coated Li electrode. The electrochemical behavior of the wax-coated Li powder anode cell was examined by the impedance analysis and cyclic testing methods. The cyclic behavior of the wax-coated Li powder anode with the Li 4Ti 5O 12 (LTO) cathode cell was examined at a constant current density of 0.35 mA cm -2 with the cut-off voltages of 1.2-2.0 V at 25 °C. Over 90% of the initial capacity of the cell remained even after the 300th cycle. The wax-coated Li powder was confirmed to be a stable anode material.

  9. Antioxidant effect of 4-nerolidylcatechol and α-tocopherol in erythrocyte ghost membranes and phospholipid bilayers

    Science.gov (United States)

    Fernandes, K.S.; Silva, A.H.M.; Mendanha, S.A.; Rezende, K.R.; Alonso, A.

    2013-01-01

    4-Nerolidylcatechol (4-NC) is found in Pothomorphe umbellata root extracts and is reported to have a topical protective effect against UVB radiation-induced skin damage, toxicity in melanoma cell lines, and antimalarial activity. We report a comparative study of the antioxidant activity of 4-NC and α-tocopherol against lipid peroxidation initiated by two free radical-generating systems: 2,2′-azobis(2-aminopropane) hydrochloride (AAPH) and FeSO4/H2O2, in red blood cell ghost membranes and in egg phosphatidylcholine (PC) vesicles. Lipid peroxidation was monitored by membrane fluidity changes assessed by electron paramagnetic resonance spectroscopy of a spin-labeled lipid and by the formation of thiobarbituric acid-reactive substances. When lipoperoxidation was initiated by the hydroxyl radical in erythrocyte ghost membranes, both 4-NC and α-tocopherol acted in a very efficient manner. However, lower activities were observed when lipoperoxidation was initiated by the peroxyl radical; and, in this case, the protective effect of α-tocopherol was lower than that of 4-NC. In egg PC vesicles, malondialdehyde formation indicated that 4-NC was effective against lipoperoxidation initiated by both AAPH and FeSO4/H2O2, whereas α-tocopherol was less efficient in protecting against lipoperoxidation by AAPH, and behaved as a pro-oxidant for FeSO4/H2O2. The DPPH (2,2-diphenyl-1-picrylhydrazyl) free-radical assay indicated that two free radicals were scavenged per 4-NC molecule, and one free radical was scavenged per α-tocopherol molecule. These data provide new insights into the antioxidant capacity of 4-NC, which may have therapeutic applications for formulations designed to protect the skin from sunlight irradiation. PMID:24068194

  10. Antioxidant effect of 4-nerolidylcatechol and α-tocopherol in erythrocyte ghost membranes and phospholipid bilayers

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, K. S.; Silva, A. H.M.; Mendanha, S. A. [Instituto de Física, Universidade Federal de Goiás, Goiânia, GO (Brazil); Rezende, K. R. [Laboratório de Biofarmácia e Farmacocinética de Substâncias Bioativas, Faculdade de Farmácia, Universidade Federal de Goiás, Goiânia, GO (Brazil); Alonso, A. [Instituto de Física, Universidade Federal de Goiás, Goiânia, GO (Brazil)

    2013-09-06

    4-Nerolidylcatechol (4-NC) is found in Pothomorphe umbellata root extracts and is reported to have a topical protective effect against UVB radiation-induced skin damage, toxicity in melanoma cell lines, and antimalarial activity. We report a comparative study of the antioxidant activity of 4-NC and α-tocopherol against lipid peroxidation initiated by two free radical-generating systems: 2,2′-azobis(2-aminopropane) hydrochloride (AAPH) and FeSO{sub 4}/H{sub 2}O{sub 2}, in red blood cell ghost membranes and in egg phosphatidylcholine (PC) vesicles. Lipid peroxidation was monitored by membrane fluidity changes assessed by electron paramagnetic resonance spectroscopy of a spin-labeled lipid and by the formation of thiobarbituric acid-reactive substances. When lipoperoxidation was initiated by the hydroxyl radical in erythrocyte ghost membranes, both 4-NC and α-tocopherol acted in a very efficient manner. However, lower activities were observed when lipoperoxidation was initiated by the peroxyl radical; and, in this case, the protective effect of α-tocopherol was lower than that of 4-NC. In egg PC vesicles, malondialdehyde formation indicated that 4-NC was effective against lipoperoxidation initiated by both AAPH and FeSO{sub 4}/H{sub 2}O{sub 2}, whereas α-tocopherol was less efficient in protecting against lipoperoxidation by AAPH, and behaved as a pro-oxidant for FeSO{sub 4}/H{sub 2}O{sub 2}. The DPPH (2,2-diphenyl-1-picrylhydrazyl) free-radical assay indicated that two free radicals were scavenged per 4-NC molecule, and one free radical was scavenged per α-tocopherol molecule. These data provide new insights into the antioxidant capacity of 4-NC, which may have therapeutic applications for formulations designed to protect the skin from sunlight irradiation.

  11. Wax Precipitation Modeled with Many Mixed Solid Phases

    DEFF Research Database (Denmark)

    Heidemann, Robert A.; Madsen, Jesper; Stenby, Erling Halfdan

    2005-01-01

    The behavior of the Coutinho UNIQUAC model for solid wax phases has been examined. The model can produce as many mixed solid phases as the number of waxy components. In binary mixtures, the solid rich in the lighter component contains little of the heavier component but the second phase shows sub......-temperature and low-temperature forms, are pure. Model calculations compare well with the data of Pauly et al. for C18 to C30 waxes precipitating from n-decane solutions. (C) 2004 American Institute of Chemical Engineers....

  12. MAMP (microbe-associated molecular pattern)-induced changes in plasma membrane-associated proteins.

    Science.gov (United States)

    Uhlíková, Hana; Solanský, Martin; Hrdinová, Vendula; Šedo, Ondrej; Kašparovský, Tomáš; Hejátko, Jan; Lochman, Jan

    2017-03-01

    Plant plasma membrane associated proteins play significant roles in Microbe-Associated Molecular Pattern (MAMP) mediated defence responses including signal transduction, membrane transport or energetic metabolism. To elucidate the dynamics of proteins associated with plasma membrane in response to cryptogein, a well-known MAMP of defence reaction secreted by the oomycete Phytophthora cryptogea, 2D-Blue Native/SDS gel electrophoresis of plasma membrane fractions was employed. This approach revealed 21 up- or down-regulated protein spots of which 15 were successfully identified as proteins related to transport through plasma membrane, vesicle trafficking, and metabolic enzymes including cytosolic NADP-malic enzyme and glutamine synthetase. Observed changes in proteins were also confirmed on transcriptional level by qRT-PCR analysis. In addition, a significantly decreased accumulation of transcripts observed after employment of a mutant variant of cryptogein Leu41Phe, exhibiting a conspicuous defect in induction of resistance, sustains the contribution of identified proteins in cryptogein-triggered cellular responses. Our data provide further evidence for dynamic MAMP-induced changes in plasma membrane associated proteins. Copyright © 2016 Elsevier GmbH. All rights reserved.

  13. Modeling the hydration process of bean grains coated with carnauba wax

    Directory of Open Access Journals (Sweden)

    Aline Almeida da Paixão

    2017-08-01

    Full Text Available Edible waxes are widely used to maintain foodstuff until they are consumed. However, some products may be subjected to industrial procedures, such as hydration, prior to their consumption. Hydration of a material is a complex process, which aims to reconstitute the original characteristics of a product when in contact with a liquid phase. An important agricultural product that requires this procedure is beans. Thus, the purpose of this work is to study the hydration process of beans (cultivar BRSMG Majestoso in different temperatures and concentrations of carnauba wax, which is applied on the product surface. Beans with initial moisture content of 0.2015, 0.1972 and 0.1745 (d.b. corresponding to treatments 0 (witness, 1 (wax diluted in water in the ratio 1:1, and 2 (carnauba wax, without dilution were used. Later, these samples were imbibed in distilled water at temperatures of 20, 30 and 40 ºC, for 15 h. The temperature and the carnauba wax influenced the water absorption rate. The Peleg model described satisfactory experimental data and the Mitscherlich model presented biased residual distribution. The constants C1 and C2 of the Peleg model exhibited opposite behaviors with increasing temperatures in the hydration process.

  14. Caffeine and theobromine in epicuticular wax of Ilex paraguariensis A. St.-Hil.

    Science.gov (United States)

    Athayde, M L; Coelho, G C; Schenkel, E P

    2000-12-01

    Caffeine and theobromine were identified and quantified in leaf epicuticular waxes of Ilex paraguariensis A. St.-Hil. (Aquifoliaceae). The total epicuticular leaf wax content was ca. 0.5% on average of dry leaf weight. Epicuticular caffeine and theobromine contents varied from 0.16 to 127.6 microg/mg and from 0 to 9.5 microg/mg of wax, respectively. For some selected samples, the intracellular methylxanthine concentration was also determined. A positive correlation was found between inner and epicuticular caffeine contents.

  15. Changes in Cuticular Wax Composition of Two Blueberry Cultivars during Fruit Ripening and Postharvest Cold Storage.

    Science.gov (United States)

    Chu, Wenjing; Gao, Haiyan; Chen, Hangjun; Wu, Weijie; Fang, Xiangjun

    2018-03-21

    Cuticular wax plays an important role for the quality of blueberry fruits. In this study, the cuticular wax composition of two blueberry cultivars, 'Legacy' ( Vaccinium corymbosum) and 'Brightwell' ( Vaccinium ashei), was examined during fruit ripening and postharvest cold storage. The results showed that wax was gradually deposited on the epidermis of blueberry fruits and the content of major wax compounds, except that for diketones, increased significantly during fruit ripening. The total wax content was 2-fold greater in 'Brightwell' blueberries than that in 'Legacy' blueberries during fruit ripening. The total wax content of both cultivars decreased during 30 days of storage at 4 °C, and the variation of cuticular wax composition was cultivar-dependent. The content of diketones decreased significantly in 'Legacy' blueberries, while the content of triterpenoids and aliphatic compounds showed different fold changes in 'Brightwell' blueberries after 30 days of storage at 4 °C. Overall, our study provided a quantitative and qualitative overview of cuticular wax compounds of blueberry fruits during ripening and postharvest cold storage.

  16. Study of phase transition in hard microcrystalline waxes and wax blends by differential scanning calorimetry

    Czech Academy of Sciences Publication Activity Database

    Kumar, S.; Agrawal, K. M.; Khan, H. U.; Sikora, Antonín

    2004-01-01

    Roč. 22, 3 & 4 (2004), s. 337-345 ISSN 1091-6466 R&D Projects: GA AV ČR KSK4050111 Institutional research plan: CEZ:AV0Z4050913 Keywords : phase transition * hard microscrystalline waxes * differential scanning calorimetry Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.312, year: 2004

  17. Effects of sunflower wax coating on physicochemical changes of mangifera indica L. in storage life

    International Nuclear Information System (INIS)

    Soomro, R.K.; Sherazi, S.T.H.

    2013-01-01

    Mango (Mangifera indica L.) fruit has a relatively short storage life due to perishable nature. In order to increases the storage life of langra mangoes, fruits were coated with sunflower wax. Mangoes were stored at room and refrigerated temperature. Sunflower wax coating protects the mangoes in greater proportion to change their color, weight loss, moisture loss, pH and total soluble solids content. The sensorial panel also favors the grander role of sunflower wax coating. Application of sunflower wax coatings had no effect on vitamin C content of mangoes variety and could increases mango storage time around 30 days under regular storage conditions. Sunflower wax coating also inhibited the growth of micro-organisms. The data reveal that by applying a sunflower wax coating effectively prolongs the quality which attributes and extends the shelf life of mango. (author)

  18. GC-MS Metabolomics to Evaluate the Composition of Plant Cuticular Waxes for Four Triticum aestivum Cultivars

    Directory of Open Access Journals (Sweden)

    Florent D. Lavergne

    2018-01-01

    Full Text Available Wheat (Triticum aestivum L. is an important food crop, and biotic and abiotic stresses significantly impact grain yield. Wheat leaf and stem surface waxes are associated with traits of biological importance, including stress resistance. Past studies have characterized the composition of wheat cuticular waxes, however protocols can be relatively low-throughput and narrow in the range of metabolites detected. Here, gas chromatography-mass spectrometry (GC-MS metabolomics methods were utilized to provide a comprehensive characterization of the chemical composition of cuticular waxes in wheat leaves and stems. Further, waxes from four wheat cultivars were assayed to evaluate the potential for GC-MS metabolomics to describe wax composition attributed to differences in wheat genotype. A total of 263 putative compounds were detected and included 58 wax compounds that can be classified (e.g., alkanes and fatty acids. Many of the detected wax metabolites have known associations to important biological functions. Principal component analysis and ANOVA were used to evaluate metabolite distribution, which was attributed to both tissue type (leaf, stem and cultivar differences. Leaves contained more primary alcohols than stems such as 6-methylheptacosan-1-ol and octacosan-1-ol. The metabolite data were validated using scanning electron microscopy of epicuticular wax crystals which detected wax tubules and platelets. Conan was the only cultivar to display alcohol-associated platelet-shaped crystals on its abaxial leaf surface. Taken together, application of GC-MS metabolomics enabled the characterization of cuticular wax content in wheat tissues and provided relative quantitative comparisons among sample types, thus contributing to the understanding of wax composition associated with important phenotypic traits in a major crop.

  19. Characterization of thermophysical properties of phase change materials for non-membrane based indirect solar desalination application

    International Nuclear Information System (INIS)

    Sarwar, J.; Mansoor, B.

    2016-01-01

    Highlights: • Thermal cycling of paraffin waxes phase change materials. • Differential Scanning Calorimetry and thermogravimetric study of the materials. • Characterization of the phase change materials via Temperature History Method. • Investigation of suitability of materials for indirect solar desalination system. • Paraffin waxes are suitable for non-membrane indirect solar desalination system. - Abstract: Phase change material as a thermal energy storage medium has been widely incorporated in various technologies like solar air/water heating, buildings, and desalination for efficient use and management of fluctuating solar energy. Temperature and thermal energy requirements dictate the selection of an appropriate phase change material for its application in various engineering systems. In this work, two phase change materials belonging to organic paraffin wax class have been characterized to obtain their thermophysical properties. The melting/solidification temperatures, latent heat of fusion and heat capacities of the phase change materials have been investigated using Differential Scanning Calorimetry, Thermogravimetric analysis and Temperature History Method. Thermal cycles up to 300 are performed to investigate melting and solidification reversibility as well as degradation over time. It is shown that the selected paraffin waxes have reversible phase change with no degradation of thermophysical properties over time. It is also shown that melting/solidification temperature and thermal energy storage capabilities make them suitable for their application as a thermal energy storage medium, in high temperature vapour compression, multi-stage flash and multi-effect distillation processes of non-membrane based indirect desalination systems.

  20. Waxes and plastic film in relation to the shelf life of yellow passion fruit

    Directory of Open Access Journals (Sweden)

    Mota Wagner Ferreira da

    2003-01-01

    Full Text Available The high perishability of the yellow passion fruit (Passiflora edulis f. flavicarpa reduces its postharvest conservation and availability, mainly for in natura consumption. These losses of quality and commercial value occur due to the high respiration and loss of water. This work aimed to evaluate the influence of a modified atmosphere - wax emulsions and plastic film - on the shelf life of the yellow passion fruit. Plastic film (Cryovac D-955, 15 mum thickness reduced fresh weight loss and fruit wilting, kept higher fruit and rind weight and higher pulp osmotic potential over the storage period. However, it was not efficient in the control of rottenness. Sparcitrus wax (22-23% polyethylene/maleyc resin caused injury to the fruit, high fruit weight losses and wilting and resulted in lower pulp osmotic potential; this wax lead to a higher concentration of acid and a lower relation of soluble solids/acidity. Among the tested waxes, Fruit Wax (18-21% carnauba wax was the best, promoting reduced weight loss, wilting and rottenness.

  1. Anatomically realistic ultrasound phantoms using gel wax with 3D printed moulds

    Science.gov (United States)

    Maneas, Efthymios; Xia, Wenfeng; Nikitichev, Daniil I.; Daher, Batol; Manimaran, Maniragav; Wong, Rui Yen J.; Chang, Chia-Wei; Rahmani, Benyamin; Capelli, Claudio; Schievano, Silvia; Burriesci, Gaetano; Ourselin, Sebastien; David, Anna L.; Finlay, Malcolm C.; West, Simeon J.; Vercauteren, Tom; Desjardins, Adrien E.

    2018-01-01

    Here we describe methods for creating tissue-mimicking ultrasound phantoms based on patient anatomy using a soft material called gel wax. To recreate acoustically realistic tissue properties, two additives to gel wax were considered: paraffin wax to increase acoustic attenuation, and solid glass spheres to increase backscattering. The frequency dependence of ultrasound attenuation was well described with a power law over the measured range of 3-10 MHz. With the addition of paraffin wax in concentrations of 0 to 8 w/w%, attenuation varied from 0.72 to 2.91 dB cm-1 at 3 MHz and from 6.84 to 26.63 dB cm-1 at 10 MHz. With solid glass sphere concentrations in the range of 0.025-0.9 w/w%, acoustic backscattering consistent with a wide range of ultrasonic appearances was achieved. Native gel wax maintained its integrity during compressive deformations up to 60%; its Young’s modulus was 17.4  ±  1.4 kPa. The gel wax with additives was shaped by melting and pouring it into 3D printed moulds. Three different phantoms were constructed: a nerve and vessel phantom for peripheral nerve blocks, a heart atrium phantom, and a placental phantom for minimally-invasive fetal interventions. In the first, nerves and vessels were represented as hyperechoic and hypoechoic tubular structures, respectively, in a homogeneous background. The second phantom comprised atria derived from an MRI scan of a patient with an intervening septum and adjoining vena cavae. The third comprised the chorionic surface of a placenta with superficial fetal vessels derived from an image of a post-partum human placenta. Gel wax is a material with widely tuneable ultrasound properties and mechanical characteristics that are well suited for creating patient-specific ultrasound phantoms in several clinical disciplines.

  2. Wafer-Level Membrane-Transfer Process for Fabricating MEMS

    Science.gov (United States)

    Yang, Eui-Hyeok; Wiberg, Dean

    2003-01-01

    A process for transferring an entire wafer-level micromachined silicon structure for mating with and bonding to another such structure has been devised. This process is intended especially for use in wafer-level integration of microelectromechanical systems (MEMS) that have been fabricated on dissimilar substrates. Unlike in some older membrane-transfer processes, there is no use of wax or epoxy during transfer. In this process, the substrate of a wafer-level structure to be transferred serves as a carrier, and is etched away once the transfer has been completed. Another important feature of this process is that two electrodes constitutes an electrostatic actuator array. An SOI wafer and a silicon wafer (see Figure 1) are used as the carrier and electrode wafers, respectively. After oxidation, both wafers are patterned and etched to define a corrugation profile and electrode array, respectively. The polysilicon layer is deposited on the SOI wafer. The carrier wafer is bonded to the electrode wafer by using evaporated indium bumps. The piston pressure of 4 kPa is applied at 156 C in a vacuum chamber to provide hermetic sealing. The substrate of the SOI wafer is etched in a 25 weight percent TMAH bath at 80 C. The exposed buried oxide is then removed by using 49 percent HF droplets after an oxygen plasma ashing. The SOI top silicon layer is etched away by using an SF6 plasma to define the corrugation profile, followed by the HF droplet etching of the remaining oxide. The SF6 plasma with a shadow mask selectively etches the polysilicon membrane, if the transferred membrane structure needs to be patterned. Electrostatic actuators with various electrode gaps have been fabricated by this transfer technique. The gap between the transferred membrane and electrode substrate is very uniform ( 0.1 m across a wafer diameter of 100 mm, provided by optimizing the bonding control). Figure 2 depicts the finished product.

  3. Applications of micro-SAXS/WAXS to study polymer fibers

    International Nuclear Information System (INIS)

    Riekel, C.

    2003-01-01

    Instrumentation and selected applications for X-ray microdiffraction experiments on polymer and biopolymer fibers at the European Synchrotron Radiation Facility (ESRF) microfocus beamline are reviewed. Combined SAXS/WAXS experiments can be performed on single fibers with a beam size down to about 5 μm. WAXS experiments can be performed down to about 2 μm and in exceptional cases down to 0.1 μm beam size. The instrumental possibilities are demonstrated for the production line of spider silk

  4. Applications of micro-SAXS/WAXS to study polymer fibers

    Energy Technology Data Exchange (ETDEWEB)

    Riekel, C. E-mail: riekel@esrf.fr

    2003-01-01

    Instrumentation and selected applications for X-ray microdiffraction experiments on polymer and biopolymer fibers at the European Synchrotron Radiation Facility (ESRF) microfocus beamline are reviewed. Combined SAXS/WAXS experiments can be performed on single fibers with a beam size down to about 5 {mu}m. WAXS experiments can be performed down to about 2 {mu}m and in exceptional cases down to 0.1 {mu}m beam size. The instrumental possibilities are demonstrated for the production line of spider silk.

  5. Applications of micro-SAXS/WAXS to study polymer fibers

    Science.gov (United States)

    Riekel, C.

    2003-01-01

    Instrumentation and selected applications for X-ray microdiffraction experiments on polymer and biopolymer fibers at the European Synchrotron Radiation Facility (ESRF) microfocus beamline are reviewed. Combined SAXS/WAXS experiments can be performed on single fibers with a beam size down to about 5 μm. WAXS experiments can be performed down to about 2 μm and in exceptional cases down to 0.1 μm beam size. The instrumental possibilities are demonstrated for the production line of spider silk.

  6. Cuticular waxes in alpine meadow plants: climate effect inferred from latitude gradient in Qinghai-Tibetan Plateau.

    Science.gov (United States)

    Guo, Yanjun; Guo, Na; He, Yuji; Gao, Jianhua

    2015-09-01

    Alpine meadow ecosystems are susceptible to climate changes. Still, climate impact on cuticular wax in alpine meadow plants is poorly understood. Assessing the variations of cuticular wax in alpine meadow plants across different latitudes might be useful for predicting how they may respond to climate change. We studied nine alpine meadows in a climate gradient in the east side of Qinghai-Tibetan Plateau, with mean annual temperature ranging from -7.7 to 3.2°C. In total, 42 plant species were analyzed for cuticular wax, averaged 16 plant species in each meadow. Only four plant species could be observed in all sampling meadows, including Kobresia humilis,Potentilla nivea,Anaphalis lacteal, and Leontopodium nanum. The amounts of wax compositions and total cuticular wax in the four plant species varied among sampling meadows, but no significant correlation could be observed between them and temperature, precipitation, and aridity index based on plant species level. To analyze the variations of cuticular wax on community level, we averaged the amounts of n-alkanes, aliphatic acids, primary alcohols, and total cuticular wax across all investigated plant species in each sampling site. The mean annual temperature, mean temperature in July, and aridity index were significantly correlated with the averaged amounts of wax compositions and total cuticular wax. The average chain length of n-alkanes in both plant and soil linearly increased with increased temperature, whereas reduced with increased aridity index. No significant correlation could be observed between mean annual precipitation and mean precipitation from June to August and the cuticular wax amounts and average chain length. Our results suggest that the survival of some alpine plants in specific environments might be depended on their abilities in adjusting wax deposition on plant leaves, and the alpine meadow plants as a whole respond to climate change, benefiting the stability of alpine meadow ecosystem.

  7. Immobilization of Na,K-ATPase isolated from rat brain synaptic plasma membranes

    Directory of Open Access Journals (Sweden)

    ANICA HROVAT

    2002-12-01

    Full Text Available Rat brain Na,K-ATPase partially purified by SDS from synaptic plasma membranes (SPM was immobilized by adsorption on nitrocellulose (NC, polyvinylidene fluoride (PVDF and glass fiber (GF membranes. Partial SDS solubilization increased the enzyme activity by 40 %. With regard to the preservation of the enzyme activity, nitrocellulose was shown to be the optimal support for the immobilization. The enzyme showed the highest percentage activity (14 % after 30 min of SPM adsorption, at 20°C under the vaccum, with 25 mg of proteins per NC disc filter. In addition, adsorption on NC stabilizes the Na,K-ATPase, since the activity was substantial 72 h after adsorption at 20°C. After adsorption, the sensitivity of the enzyme to HgCl2and CdCll2 inhibition was higher. The results show that immobilized Na,K-ATPase SPM can be used as a practical model for the detection of metal ions in different samples.

  8. Composition of the epicuticular and intracuticular wax layers on Kalanchoe daigremontiana (Hamet et Perr. de la Bathie) leaves.

    Science.gov (United States)

    van Maarseveen, Clare; Jetter, Reinhard

    2009-05-01

    Epicuticular and intracuticular waxes from both adaxial and abaxial surfaces of the leaves of Kalanchoe daigremontiana were analyzed. All wax mixtures were found to contain approximately equal amounts of triterpenoids and very long chain fatty acid (VLCFA) derivatives. The triterpenoid fraction consisted of glutinol (8-19% of the total wax) and friedelin (4-9%), together with smaller amounts of glutanol, glutinol acetate, epifriedelanol, germanicol and beta-amyrin. The VLCFA derivatives comprised C27-C35 alkanes (19-37% of the total wax), C32-C34 aldehydes (3-7%), C32 and C34 fatty acids (0.2-3%), C26-C36 primary alcohols (4-8%), and C42-C52 alkyl esters (2-9%). The wax layers were found to differ in triterpenoid amounts, with the intracuticular wax containing higher percentages of most triterpenoids than the epicuticular wax. Friedelin, the only triterpenoid ketone present, showed the opposite distribution with higher proportions in the epicuticular wax. VLCFA derivatives also accumulated to higher percentages in the epicuticular than in the intracuticular wax layer. Epicuticular wax crystals were observed on both the adaxial and abaxial leaf surfaces.

  9. CARNAUBA WAX USED AS AN HYDROPHOBIC AGENT FOR EXPANDED VERMICULITE

    Directory of Open Access Journals (Sweden)

    M.A.F. Melo

    1998-03-01

    Full Text Available This work deals with the use of carnauba wax as an expansion and hydrophobicity agent for vermiculite, to be utilized in the sorption process of oil in water. Evaluation of the system (oil-water-hydrophobic vermiculite submersion percentage was considered in assessing the performance of vermiculite in comparison to a Mexican turf. Carnauba wax seems to be more efficient in both fresh and salt waters.

  10. Effects of Wax Coating on the Moisture Loss of Cucumbers at Different Storage Temperatures

    Directory of Open Access Journals (Sweden)

    Jian Li

    2018-01-01

    Full Text Available The effects of wax coating on moisture loss of cucumbers (Cucumis sativus L., cv. Jinglv were investigated at different temperatures. Cucumbers were treated with 10% (volume : volume wax and then stored at 15, 20, 25, or 30°C and 55% relative humidity. The changes in the mass of samples were recorded every 6 h. Results showed that wax coating along with low temperature was very effective in preventing moisture loss of cucumbers during simulated distribution. After 48 h storage, moisture loss in wax treated cucumbers at 15°C was 45% lower than the control at 30°C. Furthermore, a kinetic model was developed to study the influence of temperature on moisture loss based on the Arrhenius law. The model successfully described changes in cucumber moisture loss at different temperatures during storage. The shelf life of cucumber was also predicted using the kinetic model. A synergistic effect was found between wax coating and storage temperature on cucumber shelf life. Wax coating combined with low storage temperature was an effective method to extend the shelf life of cucumber fruit.

  11. Co-metabolism of DDT by the newly isolated bacterium, Pseudoxanthomonas sp. wax

    Directory of Open Access Journals (Sweden)

    Guangli Wang

    2010-06-01

    Full Text Available Microbial degradation of 1,1,1-trichloro-2,2-bis(p-chlorophenylethane (DDT is the most promising way to clean up DDT residues found in the environment. In this paper, a bacterium designated as wax, which was capable of co-metabolizing DDT with other carbon sources, was isolated from a long-term DDT-contaminated soil sample by an enrichment culture technique. The new isolate was identified as a member of the Pseudoxanthomonas sp., based on its morphological, physiological and biochemical properties, as well as by 16S rRNA gene analysis. In the presence of 100 mg l-1 glucose, the wax strain could degrade over 95% of the total DDT, at a concentration of 20 mg l-1, in 72 hours, and could degrade over 60% of the total DDT, at a concentration of 100 mg l-1, in 144 hours. The wax strain had the highest degradation efficiency among all of the documented DDT-degrading bacteria. The wax strain could efficiently degrade DDT at temperatures ranging from 20 to 37ºC, and with initial pH values ranging from 7 to 9. The bacterium could also simultaneously co-metabolize 1,1-dichloro-2,2-bis(p-chlorophenylethane (DDD, 2,2-bis(p-chlorophenyl-1,1-dichlorethylene (DDE, and other organochlorine compounds. The wax strain could also completely remove 20 mg kg-1 of DDT from both sterile and non-sterile soils in 20 days. This study demonstrates the significant potential use of Pseudoxanthomonas sp. wax for the bioremediation of DDT in the environment.

  12. Numerical performance study of paraffin wax dispersed with alumina in a concentric pipe latent heat storage system

    Directory of Open Access Journals (Sweden)

    Valan Arasu Amirtham

    2013-01-01

    Full Text Available Latent heat energy storage systems using paraffin wax could have lower heat transfer rates during melting/freezing processes due to its inherent low thermal conductivity. The thermal conductivity of paraffin wax can be enhanced by employing high conductivity materials such as alumina (Al2O3. A numerical analysis has been carried out to study the performance enhancement of paraffin wax with nanoalumina (Al2O3 particles in comparison with simple paraffin wax in a concentric double pipe heat exchanger. Numerical analysis indicates that the charge-discharge rates of thermal energy can be greatly enhanced using paraffin wax with alumina as compared with a simple paraffin wax as PCM.

  13. Epicuticular waxes from caatinga and cerrado species and their efficiency against water loss

    Directory of Open Access Journals (Sweden)

    Oliveira Antonio F. M.

    2003-01-01

    Full Text Available The effects of the contents and chemical composition of the foliar epicuticular waxes of species from the caatinga (Aspidosperma pyrifolium, Capparis yco, Maytenus rigida and Ziziphus joazeiro and cerrado (Aristolochia esperanzae, Didymopanax vinosum, Strychnos pseudoquina and Tocoyena formosa were evaluated as to the resistance to water loss by means of an experimental device constructed for this purpose. In general, the waxes of the caatinga species investigated were more efficient against water loss than cerrado species. Increase of the thickness of the waxy deposits from 40 to 90m g.cm-2 had no significant effect on the resistance to water loss. The chemistry of the wax constituents was shown to be an important factor to determine the degree of resistance to evaporation. n-Alkanes and alcoholic triterpenes were the most efficient barriers, while hentriacontan-16-one (a ketone and ursolic acid (an acid triterpene revealed lowefficiency. The higher efficiency of the waxes of the leaves from caatinga species (mainly those of C. yco and Z. joazeiro is probably accounted for the predominance of n-alkanes in their composition. The lower efficiency of the waxes of A. pyrifolium (caatinga, T. formosa and A. esperanzae (both species from the cerrado is probably a consequence of the predominance of triterpenoids in the waxes of the two former species and hentriacontan-16-one in the latter.

  14. Wax inhibitor based on ethylene vinyl acetate with methyl methacrylate and diethanolamine for crude oil pipeline

    Science.gov (United States)

    Anisuzzaman, S. M.; Abang, S.; Bono, A.; Krishnaiah, D.; Karali, R.; Safuan, M. K.

    2017-06-01

    Wax precipitation and deposition is one of the most significant flow assurance challenges in the production system of the crude oil. Wax inhibitors are developed as a preventive strategy to avoid an absolute wax deposition. Wax inhibitors are polymers which can be known as pour point depressants as they impede the wax crystals formation, growth, and deposition. In this study three formulations of wax inhibitors were prepared, ethylene vinyl acetate, ethylene vinyl acetate co-methyl methacrylate (EVA co-MMA) and ethylene vinyl acetate co-diethanolamine (EVA co-DEA) and the comparison of their efficiencies in terms of cloud point¸ pour point, performance inhibition efficiency (%PIE) and viscosity were evaluated. The cloud point and pour point for both EVA and EVA co-MMA were similar, 15°C and 10-5°C, respectively. Whereas, the cloud point and pour point for EVA co-DEA were better, 10°C and 10-5°C respectively. In conclusion, EVA co-DEA had shown the best % PIE (28.42%) which indicates highest percentage reduction of wax deposit as compared to the other two inhibitors.

  15. Role of needle surface waxes in dynamic exchange of mono- and sesquiterpenes

    Directory of Open Access Journals (Sweden)

    J. Joensuu

    2016-06-01

    Full Text Available Biogenic volatile organic compounds (BVOCs produced by plants have a major role in atmospheric chemistry. The different physicochemical properties of BVOCs affect their transport within and out of the plant as well as their reactions along the way. Some of these compounds may accumulate in or on the waxy surface layer of conifer needles and participate in chemical reactions on or near the foliage surface. The aim of this work was to determine whether terpenes, a key category of BVOCs produced by trees, can be found on the epicuticles of Scots pine (Pinus sylvestris L. and, if so, how they compare with the terpenes found in shoot emissions of the same tree. We measured shoot-level emissions of pine seedlings at a remote outdoor location in central Finland and subsequently analysed the needle surface waxes for the same compounds. Both emissions and wax extracts were clearly dominated by monoterpenes, but the proportion of sesquiterpenes was higher in the wax extracts. There were also differences in the terpene spectra of the emissions and the wax extracts. The results, therefore, support the existence of BVOC associated to the epicuticular waxes. We briefly discuss the different pathways for terpenes to reach the needle surfaces and the implications for air chemistry.

  16. Characterization and chemical composition of epicuticular wax from banana leaves grown in Northern Thailand

    OpenAIRE

    Suporn Charumanee; Songwut Yotsawimonwat; Panee Sirisa-ard; Kiatisak Pholsongkram

    2017-01-01

    This study aimed to investigate the physicochemical properties and chemical composition of epicuticular wax extracted from leaves of Kluai Namwa, a banana cultivar which is widely grown in Northern Thailand. Its genotype was identified by a botanist. The wax was extracted using solvent extraction. The fatty acid profiles and physicochemical properties of the wax namely melting point, congealing point, crystal structures and polymorphism, hardness, color, and solubility were examin...

  17. Procedures for extraction and purification of leaf wax biomarkers from peats

    Directory of Open Access Journals (Sweden)

    J.E. Nichols

    2011-12-01

    Full Text Available Palaeoecological and palaeoclimate reconstruction, using leaf wax biomarkers, is a relatively new sub-discipline of peatland science. The ability to process large numbers of samples rapidly for biomarkers makes this type of analysis particularly appealing. This review is a guide to the preparation of leaf waxes for analysis by gas chromatography. The main phases of preparation are extraction of soluble organic compounds from sediment, separation of the total extract into fractions of differing polarity, and the derivatisation of polar functional groups. The procedures described here are not meant be exhaustive of all organic geochemical possibilities in peatlands, but a distillation of methods for the preparation of leaf waxes that are commonly and increasingly being used in palaeoecological and palaeoclimatological studies.

  18. Plasma membrane factor XIIIA transglutaminase activity regulates osteoblast matrix secretion and deposition by affecting microtubule dynamics.

    Directory of Open Access Journals (Sweden)

    Hadil F Al-Jallad

    2011-01-01

    Full Text Available Transglutaminase activity, arising potentially from transglutaminase 2 (TG2 and Factor XIIIA (FXIIIA, has been linked to osteoblast differentiation where it is required for type I collagen and fibronectin matrix deposition. In this study we have used an irreversible TG-inhibitor to 'block -and-track' enzyme(s targeted during osteoblast differentiation. We show that the irreversible TG-inhibitor is highly potent in inhibiting osteoblast differentiation and mineralization and reduces secretion of both fibronectin and type I collagen and their release from the cell surface. Tracking of the dansyl probe by Western blotting and immunofluorescence microscopy demonstrated that the inhibitor targets plasma membrane-associated FXIIIA. TG2 appears not to contribute to crosslinking activity on the osteoblast surface. Inhibition of FXIIIA with NC9 resulted in defective secretory vesicle delivery to the plasma membrane which was attributable to a disorganized microtubule network and decreased microtubule association with the plasma membrane. NC9 inhibition of FXIIIA resulted in destabilization of microtubules as assessed by cellular Glu-tubulin levels. Furthermore, NC9 blocked modification of Glu-tubulin into 150 kDa high-molecular weight Glu-tubulin form which was specifically localized to the plasma membrane. FXIIIA enzyme and its crosslinking activity were colocalized with plasma membrane-associated tubulin, and thus, it appears that FXIIIA crosslinking activity is directed towards stabilizing the interaction of microtubules with the plasma membrane. Our work provides the first mechanistic cues as to how transglutaminase activity could affect protein secretion and matrix deposition in osteoblasts and suggests a novel function for plasma membrane FXIIIA in microtubule dynamics.

  19. Hybrid foundry patterns of bevel gears

    Directory of Open Access Journals (Sweden)

    Budzik G.

    2007-01-01

    Full Text Available Possibilities of making hybrid foundry patterns of bevel gears for investment casting process are presented. Rapid prototyping of gears with complex tooth forms is possible with the use of modern methods. One of such methods is the stereo-lithography, where a pattern is obtained as a result of resin curing with laser beam. Patterns of that type are applicable in precision casting. Removing of stereo-lithographic pattern from foundry mould requires use of high temperatures. Resin burning would generate significant amounts of harmful gases. In case of a solid stereo-lithographic pattern, the pressure created during gas burning may cause the mould to crack. A gas volume reduction may be achieved by using patterns of honeycomb structure. However, this technique causes a significant worsening of accuracy of stereo-lithographic patterns in respect of their dimensions and shape. In cooperation with WSK PZL Rzeszów, the Machine Design Department of Rzeszow University of Technology carried out research on the design of hybrid stereo-lithographic patterns. Hybrid pattern consists of a section made by stereo-lithographic process and a section made of casting wax. The latter material is used for stereo-lithographic pattern filling and for mould gating system. The hybrid pattern process consists of two stages: wax melting and then the burn-out of stereolithographic pattern. Use of hybrid patterns reduces the costs of production of stereolithographic patterns. High dimensional accuracy remains preserved in this process.

  20. Radiotherapic Valuation of Paraffin Wax for Patients with Oral Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Na, Kyung Su; Seo, Seuk Jin; Lee, Je Hee; Yoo, Sook Heun [Dept. of Radiation Oncology, Seoul National University Hosdital, Seoul (Korea, Republic of)

    2011-03-15

    This study is designed to investigate radiotherapic valuation of Paraffin Wax, which is newly formed for this study and generally utilized in dentistry, and Mouth Piece and Putty impression, which are commonly used in radiotherapy, for oral cavity as a compensator. Each compensator was formed by 10 x 10 x 1 cm and measured radiation dose attenuation ratio with reference of water phantom which is made of tissue-equivalent materials. Two patients with oral cancer underwent DRR (Digitally Reconstructed Radiogrph) of Offline Review Program of Aria System and Portal vision for 5 times for each material to evaluate reproducibility by each filling materials. Moreover, MU (monitor unit) changes by dose absorption were considered in the case of inevitable implication of an filling materials in the range for radiotherapy. Radiation dose attenuation ratios were shown -0.7{approx}+3.7% for Mouth Piece, +0.21{approx}+0.39% for Paraffin Wax and -2.71{approx}-1.76% for Putty impression. Error ranges of reproducibility of positions were measured {+-}3 mm for Mouth Piece, {+-}2 mm for Paraffin Wax and {+-}2 mm for Putty impression. Difference of prescription MU from dose absorption with an filling material increased +7.8% (250 MU) in Putty impression and -0.9% (230 MU) in Paraffin Wax as converted into a percentage from the standard phantom, Water 232 MU. Dose reduction of boundary between cavity and tissue was observed for Mouth Piece. Mouth Piece also had low reproducibility of positions as it had no reflection of anatomy of oral cavity even though it was a proper material to separate Maxilla and Mandible during therapy. On the other hand, Putty impression was a suitable material to correctly re-position oral cavity as before. However, it risked normal tissues getting unnecessary over irradiation and it caused radiation dose decrease by -2.5% for 1cm volume in comparison of it of water phantom. Dose reduction in Paraffin Wax, Fat Tissue-Equivalent Material, was smaller than other

  1. [Comparative adaptation of crowns of selective laser melting and wax-lost-casting method].

    Science.gov (United States)

    Li, Guo-qiang; Shen, Qing-yi; Gao, Jian-hua; Wu, Xue-ying; Chen, Li; Dai, Wen-an

    2012-07-01

    To investigate the marginal adaptation of crowns fabricated by selective laser melting (SLM) and wax-lost-casting method, so as to provide an experimental basis for clinic. Co-Cr alloy full crown were fabricated by SLM and wax-lost-casting for 24 samples in each group. All crowns were cemented with zinc phosphate cement and cut along longitudinal axis by line cutting machine. The gap between crown tissue surface and die was measured by 6-point measuring method with scanning electron microscope (SEM). The marginal adaptation of crowns fabricated by SLM and wax-lost-casting were compared statistically. The gap between SLM crowns were (36.51 ± 2.94), (49.36 ± 3.31), (56.48 ± 3.35), (42.20 ± 3.60) µm, and wax-lost-casting crowns were (68.86 ± 5.41), (58.86 ± 6.10), (70.62 ± 5.79), (69.90 ± 6.00) µm. There were significant difference between two groups (P casting method and SLM method provide acceptable marginal adaptation in clinic, and the marginal adaptation of SLM is better than that of wax-lost-casting method.

  2. Effect of soil moisture management on the quality of wax apple | Lin ...

    African Journals Online (AJOL)

    Wax apple (Syzygium samarngense Merr.et Perry) was one of the economically planted fruits in Taiwan. This research was conducted to evaluate the effects of different soil moisture management on increasing wax apple quality. It was preceded at two different soil properties (shallow soil and alluvial soil) in Pingtung, ...

  3. ETHNOECOLOGY AND ETHNOBOTANY OF THE PALM CARNAUBA WAX IN BRAZILIAN SEMI-ARID

    Directory of Open Access Journals (Sweden)

    Rodrigo Ferreira de Sousa

    2015-12-01

    Full Text Available The aim of this study was to investigate aspects of ethnoecological and ethnobotanical of carnauba wax (Copernicia prunifera (Miller H. E. Moore, Arecaceae in an extractive community of municipality of Ipanguaçu, Rio Grande do Norte state. We interviewed key informants, using the technique of inducing nonspecific, guided tour and direct observation to confirm the data. According to most residents of Pedro Ezequiel Araújo community, the area of carnauba wax in the region is natural. In the research ethnoecological, 73% of informants reported the occurrence of “a different kind of carnauba”, known as “white carnauba” phenotypically distinct from the “common carnauba wax” by presenting clear stipe, smaller fruits and absence of spines on the petiole, and is rare at the study site. Much of the informants observed phenological phases of carnauba wax, being consistent in stating that the species has fruits dispersed by bats. In ethnobotany, powder wax was cited by all as the most important product extracted from leaves of carnauba and the most used, followed by fruit, stem and root. Were still reported the division of work in the extraction of powder wax from the carnauba. The results of this research will contribute to knowledge of ethnobotanical and ethnoecological carnauba, supporting strategies for management and conservation of natural populations.

  4. Isolation and recrystallization of epicuticular waxes from Sorbus and Cotoneaster leaves

    OpenAIRE

    Ganeva Tsveta; Stefanova Miroslava; Koleva Dimitrina; Ruiz Segundo Ríos

    2015-01-01

    Wax morphology and chemical composition are widely accepted to be important for the protective properties of the leaf’s surface and also valuable characteristics in plant systematics. The leaves of Sorbus domestica L. and Cotoneaster granatensis Boiss., species of two large genera with intricate taxonomy referred to subtribe Pyrinae, Rosaceae (formerly subfamily Maloideae), were studied by scanning electron microscope (SEM) and performing different methods of wax isola...

  5. Investigation of wax precipitation in crude oil: Experimental and modeling

    Directory of Open Access Journals (Sweden)

    Taraneh Jafari Behbahani

    2015-09-01

    Full Text Available In this work, a series of experiments were carried to investigation of rheological behavior of crude oil using waxy crude oil sample in the absence/presence of flow improver such as ethylene-vinyl acetate copolymer. The rheological data covered the temperature range of 5–30 °C. The results indicated that the performance of flow improver was dependent on its molecular weight. Addition of small quantities of flow improver, can improve viscosity and pour point of crude oil. Also, an Artificial Neural Network (ANN model using Multi-Layer Perceptron (MLP topology has been developed to account wax appearance temperature and the amount of precipitated wax and the model was verified using experimental data given in this work and reported in the literature. In order to compare the performance of the proposed model based on Artificial Neural Network, the wax precipitation experimental data at different temperatures were predicted using solid solution model and multi-solid phase model. The results showed that the developed model based on Artificial Neural Network can predict more accurately the wax precipitation experimental data in comparison to the previous models such as solid solution and multi-solid phase model with AADs less than 0.5%. Furthermore, the number of parameters required for the Artificial Neural Network (ANN model is less than the studied thermodynamic models.

  6. Wax solidification of drying agents containing tritiated water

    International Nuclear Information System (INIS)

    Mishikawa, M.; Kido, H.

    1984-01-01

    It is necessary to immobilize the tritium not to give any impact on the environmental biosphere because tritium may give profound effects in the metabolic pathway. One of the most probable methods of immobilizing tritium would be incorporation of tritiated water in solid forms. Any drying or dehydration technique would be effective in a tritium cleanup system for off-gas streams containing tritium or tritiated water. Commonly used drying agents such as activated alumina, silica gel, molecular sieves and calcium sulfate are of value for removal of water vapour from air or other gases. For long term tritium storage, however, these adsorptive materials should be enveloped to prevent contact with water or water vapour because the rate of leaching, evaporation or diffusion of tritium from these porous materials is so large. The beeswax solidification method of the packed bed of drying agents adsorbing tritiated water is developed in this study, where the wax solidification procedure is performed by pouring the melt of wax into the void space of the packed bed of the drying agents and successive gradual cooling. The observed values of diffusivity or permeability of tritium in the wax solidified materials are about one-thousandth of those obtained for the cement block. Effect of coating on the rate of leaching is also discussed

  7. Radiological properties of a wax-gypsum compensator material

    International Nuclear Information System (INIS)

    Plessis, F.C.P. du; Willemse, C.A.

    2005-01-01

    In this paper the radiological properties of a compensator material consisting of wax and gypsum is presented. Effective attenuation coefficients (EACs) have been determined from transmission measurements with an ion chamber in a Perspex phantom. Measurements were made at 80 and 100 cm source-to-skin distance (SSD) for beam energies of 6, 8, and 15 MV, for field sizes ranging from narrow beam geometries up to 40x40 cm 2 , and at measurement depths of maximum dose build-up, 5 and 10 cm. A parametrization equation could be constructed to predict the EAC values within 4% uncertainty as a function of field size and depth of measurement. The EAC dependence on off-axis position was also quantified at each beam energy and SSD. It was found that the compensator material reduced the required thickness for compensation by 26% at 8 MV when compared to pure paraffin wax for a 10x10 cm 2 field. Relative surface ionization (RSI) measurements have been made to quantify the effect of scattered electrons from the wax-gypsum compensator. Results indicated that for 80 cm SSD the RSI would exceed 50% for fields larger than 15x15 cm 2 . At 100 cm SSD the RSI values were below 50% for all field sizes used

  8. The use of paraffin wax in a new solar cooker with inner and outer reflectors

    Directory of Open Access Journals (Sweden)

    Arabacigil Bihter

    2015-01-01

    Full Text Available In this paper, the potential use and effectiveness of paraffin wax in a new solar cooker was experimentally investigated during daylight and late evening hours. For these experiments, a cooker having an inner reflecting surface was designed, constructed by filling paraffin wax and metal shavings. The side- and sub-surface temperatures of the paraffin wax in the cooker are measured in the summer months of June and July. The thermal efficiency of the cooker was tested on different conditions. The results show that the optimum angle of the outer reflector is 30°. Here, the peak temperature of the paraffin wax in the solar cooker was 83.4 °C. The average solar radiation reflected makes a contribution of 9.26% to the temperature of paraffin wax with the outer reflector. The solar cooker with the outer reflector angle of 30° receives also reflected radiation from the inner reflectors. Besides, the heating time is decreased to approximately 1 hour. The designed solar cooker can be effectively used with 30.3% daily thermal efficiency and paraffin wax due to the amount of energy stored.

  9. Cuticular wax accumulation is associated with drought tolerance in wheat near-isogenic lines

    Directory of Open Access Journals (Sweden)

    Jianmin Song

    2016-11-01

    Full Text Available Previous studies have shown that wheat grain yield is seriously affected by drought stress, and leaf cuticular wax is reportedly associated with drought tolerance. However, most studies have focused on cuticular wax biosynthesis and model species. The effects of cuticular wax on wheat drought tolerance have rarely been studied. The aims of the current study were to study the effects of leaf cuticular wax on wheat grain yield under drought stress using the above-mentioned wheat NILs and to discuss the possible physiological mechanism of cuticular wax on high grain yield under drought stress. Compared to water-irrigated (WI conditions, the cuticular wax content (CWC in glaucous and non-glaucous NILs under drought-stress (DS conditions both increased; mean increase values were 151.1% and 114.4%, respectively, which was corroborated by scanning electronic microscopy images of large wax particles loaded on the surfaces of flag leaves. The average yield of glaucous NILs was higher than that of non-glaucous NILs under DS conditions in 2014 and 2015; mean values were 7368.37 kg·ha-1 and 7103.51 kg·ha-1. This suggested that glaucous NILs were more drought-tolerant than non-glaucous NILs (P = 0.05, which was supported by the findings of drought tolerance indices TOL and SSI in both years, the relatively high water potential and relative water content, and the low ELWL. Furthermore, the photosynthesis rate (Pn of glaucous and non-glaucous wheat NILs under DS conditions decreased by 7.5% and 9.8%, respectively; however, glaucous NILs still had higher mean values of Pn than those of non-glaucous NILs, which perhaps resulted in the higher yield of glaucous NILs. This could be explained by the fact that glaucous NILs had a smaller Fv/Fm reduction, a smaller PI reduction and a greater ABS/RC increase than non-glaucous NILs under DS conditions. This is the first report to show that wheat cuticular wax accumulation is associated with drought tolerance. Moreover

  10. EFFECT OF OIL TEMPERATURE ON THE WAX DEPOSITION OF CRUDE OIL WITH COMPOSITION ANALYSIS

    Directory of Open Access Journals (Sweden)

    Qing Quan

    Full Text Available Abstract Wax deposition behavior was investigated in a set of one-inch experiment flow loops, using a local crude oil with high wax content. The temperature of the oil phase is chosen as a variable parameter while the temperature of the coolant media is maintained constant. Detailed composition of the deposit is characterized using High Temperature Gas Chromatography. It was found that the magnitude of the diffusion of the heavier waxy components (C35-C50 decreases when the oil temperature decreases, but the magnitude of the diffusion of the lighter waxy components increases. This result means that the diffusion of wax molecules shifts towards lower carbon number, which further proves the concept of molecular diffusion. Meanwhile, a meaningful phenomenon is that the mass of the deposit increases with the oil temperature decrease, which definitely proves the influence of wax solubility on deposition, while the formation of an incipient gel layer reflects the fact that an increase in the mass of the deposit does not mean a larger wax percentage fraction at lower oil temperature.

  11. Digital Genome-Wide ncRNA Expression, Including SnoRNAs, across 11 Human Tissues Using PolyA-Neutral Amplification

    Science.gov (United States)

    Castle, John C.; Armour, Christopher D.; Löwer, Martin; Haynor, David; Biery, Matthew; Bouzek, Heather; Chen, Ronghua; Jackson, Stuart; Johnson, Jason M.; Rohl, Carol A.; Raymond, Christopher K.

    2010-01-01

    Non-coding RNAs (ncRNAs) are an essential class of molecular species that have been difficult to monitor on high throughput platforms due to frequent lack of polyadenylation. Using a polyadenylation-neutral amplification protocol and next-generation sequencing, we explore ncRNA expression in eleven human tissues. ncRNAs 7SL, U2, 7SK, and HBII-52 are expressed at levels far exceeding mRNAs. C/D and H/ACA box snoRNAs are associated with rRNA methylation and pseudouridylation, respectively: spleen expresses both, hypothalamus expresses mainly C/D box snoRNAs, and testes show enriched expression of both H/ACA box snoRNAs and RNA telomerase TERC. Within the snoRNA 14q cluster, 14q(I-6) is expressed at much higher levels than other cluster members. More reads align to mitochondrial than nuclear tRNAs. Many lincRNAs are actively transcribed, particularly those overlapping known ncRNAs. Within the Prader-Willi syndrome loci, the snoRNA HBII-85 (group I) cluster is highly expressed in hypothalamus, greater than in other tissues and greater than group II or III. Additionally, within the disease locus we find novel transcription across a 400,000 nt span in ovaries. This genome-wide polyA-neutral expression compendium demonstrates the richness of ncRNA expression, their high expression patterns, their function-specific expression patterns, and is publicly available. PMID:20668672

  12. Digital genome-wide ncRNA expression, including SnoRNAs, across 11 human tissues using polyA-neutral amplification.

    Directory of Open Access Journals (Sweden)

    John C Castle

    Full Text Available Non-coding RNAs (ncRNAs are an essential class of molecular species that have been difficult to monitor on high throughput platforms due to frequent lack of polyadenylation. Using a polyadenylation-neutral amplification protocol and next-generation sequencing, we explore ncRNA expression in eleven human tissues. ncRNAs 7SL, U2, 7SK, and HBII-52 are expressed at levels far exceeding mRNAs. C/D and H/ACA box snoRNAs are associated with rRNA methylation and pseudouridylation, respectively: spleen expresses both, hypothalamus expresses mainly C/D box snoRNAs, and testes show enriched expression of both H/ACA box snoRNAs and RNA telomerase TERC. Within the snoRNA 14q cluster, 14q(I-6 is expressed at much higher levels than other cluster members. More reads align to mitochondrial than nuclear tRNAs. Many lincRNAs are actively transcribed, particularly those overlapping known ncRNAs. Within the Prader-Willi syndrome loci, the snoRNA HBII-85 (group I cluster is highly expressed in hypothalamus, greater than in other tissues and greater than group II or III. Additionally, within the disease locus we find novel transcription across a 400,000 nt span in ovaries. This genome-wide polyA-neutral expression compendium demonstrates the richness of ncRNA expression, their high expression patterns, their function-specific expression patterns, and is publicly available.

  13. Review of the Factors that Influence the Condition of Wax Deposition in Subsea Pipelines

    Directory of Open Access Journals (Sweden)

    Koh Junyi

    2018-03-01

    Full Text Available When crude oil is transported via sub-sea pipeline, the temperature of the pipeline decreases at a deep depth which causes a difference in temperature with the crude oil inside. This causes the crude oil to dissipate its heat to the surrounding until thermal equilibrium is achieved. This is also known as the cloud point where wax begins to precipitate and solidifies at the walls of the pipeline which obstruct the flow of fluid. The main objective of this review is to quantify the factors that influence wax deposition such as temperature difference between the wall of the pipeline and the fluid flowing within, the flow rate of the fluid in the pipeline and residence time of the fluid in the pipeline. It is found the main factor that causes wax deposition in the pipeline is the difference in temperature between the petroleum pipeline and the fluid flowing within. Most Literature deduces that decreasing temperature difference results in lower wax content deposited on the wall of the pipeline. The wax content increases with rising flow rate. As for the residence time, the amount of deposited wax initially increases when residence time increases until it reaches a peak value and gradually decreases. Flow-loop system and cold finger apparatus were used in literature investigations to determine the trends above. Three new models are generated through a regression analysis based on the results from other authors. These new models form a relationship between temperature difference, flow rate, residence time and Reynolds number with wax deposition. These models have high values of R-square and adjusted R-square which demonstrate the reliability of these models.

  14. The effect of the environment on the structure, quantity and composition of spruce needle wax

    International Nuclear Information System (INIS)

    Guenthardt-Goerg, M.S.

    1994-01-01

    The tubular structure (10-nonacosanol), as formed in spring on the wax surface of new spruce needles (Picea abies (L.)Karst.), or as regenerated on previous-year needles, becomes gradually fused and flattened in relation to needle exposure, particularly wind and rain. Structural flattening does not necessarily imply changes in wax quantity, composition or lead to changes in needle transpiration or photosynthesis, and was approximately reproduced by bathing excised twigs in water (with pH having little effect). In 4-year-old plants of one clone planted out at a Swiss plateau and alpine sites, changes in wax structure were similar to those found in mature trees. No such changes were found in plants with O 3 , SO 2 , ambient air, charcoal-filtered air, or in plants grown outside the chambers but shielded from rain. Area-related needle wax quantity in mature trees differed between the two sites, but did not differ in young plants under different treatments (fumigation or planted out at the sites). Minor differences in wax composition, however, were found to be related to the ozone dose of the fumigation or the ambient ozone dose at the sites. In each needle wax sample, 68 compounds grouped into 12 constituent classes were quantified. The quantity of the individual substituent classes varied among wax samples from genetically different mature trees at the two sites in a tree-specific way. Variation of these quantities was not larger than among young cloned plants after different treatments. (orig.)

  15. 21 CFR 172.886 - Petroleum wax.

    Science.gov (United States)

    2010-04-01

    ... availability of this material at NARA, call 202-741-6030, or go to: http://www.archives.gov/federal_register... it is very hygroscopic and will react with some metal containers in the presence of air. Phosphoric... high enough to keep the wax melted. (Note: In preheating the sulfoxide-acid mixture, remove the stopper...

  16. Wax co-cracking synergism of high density polyethylene to alternative fuels

    Directory of Open Access Journals (Sweden)

    Magdy Motawie

    2015-09-01

    Full Text Available Attempts have been made to understand the thermal degradation of high density polyethylene (HDPE and their combined co-cracking using different ratios of HDPE and petroleum wax under nitrogen atmosphere. We have conducted the experiments using HDPE as the raw material and petroleum wax as co-feed by at 400 and 450 °C reaction temperatures. The product distribution was noted along with reaction time of 0.5–3 h for the degradation. Thermal gravimetric analysis (TGA technique was used to measure the weight change of the feedstock as a function of temperature and time. Differential scanning calorimetry (DSC was used to determine the degradation temperature. Products were characterized using gas chromatography (GC and infrared spectroscopy (FTIR, some other standard physical methods were used to determine the main properties of the liquid products. Results show that the mixed plastic-wax samples could be converted into gases, gasoline, and middle distillate depending upon the composition of feed polymer/wax ratio. It was found that the products mostly consisted of paraffin and olefin compounds, with carbon numbers of C1–C4, C5–C9 and C10–C19 in the case of gases, gasoline and middle distillate respectively.

  17. Real-time monitoring and measurement of wax deposition in pipelines via non-invasive electrical capacitance tomography

    Science.gov (United States)

    Lock Sow Mei, Irene; Ismail, Idris; Shafquet, Areeba; Abdullah, Bawadi

    2016-02-01

    Tomographic analysis of the behavior of waxy crude oil in pipelines is important to permit appropriate corrective actions to be taken to remediate the wax deposit layer before pipelines are entirely plugged. In this study, a non-invasive/non-intrusive electrical capacitance tomography (ECT) system has been applied to provide real-time visualization of the formation of paraffin waxes and to measure the amount of wax fraction from the Malay Basin waxy crude oil sample under the static condition. Analogous expressions to estimate the wax fraction of the waxy crude oil across the temperatures range of 30-50 °C was obtained by using Otsu’s and Kuo’s threshold algorithms. Otsu’s method suggested that the wax fraction can be estimated by the correlation coefficient β =0.0459{{T}3}-5.3535{{T}2}+200.36T-2353.7 while Kuo’s method provides a similar correlation with β =0.0741{{T}3}-8.4915{{T}2}+314.96T-3721.2 . These correlations show good agreements with the results which are obtained from the conventional weighting method. This study suggested that Kuo’s threshold algorithm is more promising when integrated into the ECT system compared to Otsu’s algorithm because the former provides higher accuracy wax fraction measurement results below the wax appearance temperature for waxy crude oil. This study is significant because it serves as a preliminary investigation for the application of ECT in the oil and gas industry for online measurement and detection of wax fraction without causing disturbance to the process flow.

  18. Modeling of asphaltene and wax precipitation

    Energy Technology Data Exchange (ETDEWEB)

    Chung, F.; Sarathi, P.; Jones, R.

    1991-01-01

    This research project was designed to focus on the development of a predictive technique for organic deposition during gas injection for petroleum EOR. A thermodynamic model has been developed to describe the effects of temperature, pressure, and composition on asphaltene precipitation. The proposed model combines regular solution theory with Flory-Huggins polymer solutions theory to predict maximum volume fractions of asphaltene dissolved in oil. The model requires evaluation of vapor-liquid equilibria, first using an equation of state followed by calculations of asphaltene solubility in the liquid-phase. A state-of-the-art technique for C{sub 7+} fraction characterization was employed in developing this model. The preliminary model developed in this work was able to predict qualitatively the trends of the effects of temperature, pressure, and composition. Since the mechanism of paraffinic wax deposition is different from that of asphaltene deposition, another thermodynamic model based on the solid-liquid solution theory was developed to predict the wax formation. This model is simple and can predict the wax appearance temperature with reasonable accuracy. Accompanying the modeling work, experimental studies were conducted to investigate the solubility of asphaltene in oil land solvents and to examine the effects of oil composition, CO{sub 2}, and solvent on asphaltene precipitation and its properties. This research focused on the solubility reversibility of asphaltene in oil and the precipitation caused by CO{sub 2} injection at simulated reservoir temperature and pressure conditions. These experiments have provided many observations about the properties of asphaltenes for further improvement of the model, but more detailed information about the properties of asphaltenes in solution is needed for the development of more reliable asphaltene characterization techniques. 50 refs., 8 figs., 7 tabs.

  19. Radiotherapic Valuation of Paraffin Wax for Patients with Oral Cancer

    International Nuclear Information System (INIS)

    Na, Kyung Su; Seo, Seuk Jin; Lee, Je Hee; Yoo, Sook Heun

    2011-01-01

    This study is designed to investigate radiotherapic valuation of Paraffin Wax, which is newly formed for this study and generally utilized in dentistry, and Mouth Piece and Putty impression, which are commonly used in radiotherapy, for oral cavity as a compensator. Each compensator was formed by 10 x 10 x 1 cm and measured radiation dose attenuation ratio with reference of water phantom which is made of tissue-equivalent materials. Two patients with oral cancer underwent DRR (Digitally Reconstructed Radiogrph) of Offline Review Program of Aria System and Portal vision for 5 times for each material to evaluate reproducibility by each filling materials. Moreover, MU (monitor unit) changes by dose absorption were considered in the case of inevitable implication of an filling materials in the range for radiotherapy. Radiation dose attenuation ratios were shown -0.7∼+3.7% for Mouth Piece, +0.21∼+0.39% for Paraffin Wax and -2.71∼-1.76% for Putty impression. Error ranges of reproducibility of positions were measured ±3 mm for Mouth Piece, ±2 mm for Paraffin Wax and ±2 mm for Putty impression. Difference of prescription MU from dose absorption with an filling material increased +7.8% (250 MU) in Putty impression and -0.9% (230 MU) in Paraffin Wax as converted into a percentage from the standard phantom, Water 232 MU. Dose reduction of boundary between cavity and tissue was observed for Mouth Piece. Mouth Piece also had low reproducibility of positions as it had no reflection of anatomy of oral cavity even though it was a proper material to separate Maxilla and Mandible during therapy. On the other hand, Putty impression was a suitable material to correctly re-position oral cavity as before. However, it risked normal tissues getting unnecessary over irradiation and it caused radiation dose decrease by -2.5% for 1cm volume in comparison of it of water phantom. Dose reduction in Paraffin Wax, Fat Tissue-Equivalent Material, was smaller than other impressions and

  20. Cannabis-induced psychosis associated with high potency "wax dabs".

    Science.gov (United States)

    Pierre, Joseph M; Gandal, Michael; Son, Maya

    2016-04-01

    With mounting evidence that the risk of cannabis-induced psychosis may be related to both dose and potency of tetrahydrocannbinol (THC), increasing reports of psychosis associated with cannabinoids containing greater amounts of THC are anticipated. We report two cases of emergent psychosis after using a concentrated THC extract known as cannabis "wax," "oil," or "dabs" raising serious concerns about its psychotic liability. Although "dabbing" with cannabis wax is becoming increasingly popular in the US for both recreational and "medicinal" intentions, our cases raise serious concerns about its psychotic liability and highlight the importance of understanding this risk by physicians recommending cannabinoids for purported medicinal purposes. Published by Elsevier B.V.

  1. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  2. 76 FR 773 - Petroleum Wax Candles From the People's Republic of China: Continuation of Antidumping Duty Order

    Science.gov (United States)

    2011-01-06

    ... DEPARTMENT OF COMMERCE International Trade Administration [A-570-504] Petroleum Wax Candles From... Trade Commission (``ITC'') that revocation of the antidumping duty order on petroleum wax candles from... order on petroleum wax candles from the PRC pursuant to section 751(c)(2) of the Tariff Act of 1930, as...

  3. Effect of feed flow pattern on the distribution of permeate fluxes in desalination by direct contact membrane distillation

    KAUST Repository

    Soukane, Sofiane; Naceur, Mohamed W.; Francis, Lijo; Alsaadi, Ahmad Salem; Ghaffour, NorEddine

    2017-01-01

    The current study aims to highlight the effect of flow pattern on the variations of permeate fluxes over the membrane surface during desalination in a direct contact membrane distillation (DCMD) flat module. To do so, a three dimensional (3D

  4. Development of lamellar structures in natural waxes - an electron diffraction investigation

    Science.gov (United States)

    Dorset, Douglas L.

    1999-06-01

    When they are recrystallized from the melt, natural plant or insect waxes tend to form solid phases with a nematic-like structure (i.e. a parallel array of polymethylene chains with little or no aggregation of the molecules into distinct layers). An electron diffraction study of carnauba wax and two types of beeswax has shown that the degree of molecular organization into lamellar structures can be enhanced by annealing in the presence of benzoic acid, which also acts as an epitaxial substrate. Nevertheless, the resultant layer structure in the annealed solid is not the same as that found for paraffin wax fractions refined from petroleum. Probably because of a small but significant fraction of a very long chain ingredient, the lamellar separation is incomplete, incorporating a number of `bridging molecules' that span the nascent lamellar interface.The same phenomenon has been described recently for a low molecular weight polyethylene.

  5. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  6. Compound-Specific Radiocarbon Dating Reveals the Age Distribution of Plant-Wax Biomarkers Exported to the Bengal Fan

    Science.gov (United States)

    Galy, V.; French, K. L.; Hein, C. J.; Haghipour, N.; Wacker, L.; Kudrass, H.; Eglinton, T. I.

    2017-12-01

    The stable isotope composition of leaf-wax compounds preserved in lacustrine and marine sediments has been widely used to reconstruct terrestrial paleo-environments. However, the timescales of plant-wax storage in continental reservoirs before riverine export are not well known, representing a key uncertainty in paleo-environment studies. We couple numerical models with bulk and leaf-wax fatty acid organic 13C and 14C signatures hosted in a high-deposition-rate sediment core from the Bengal shelf canyon in order to estimate storage timescales within the Ganges-Brahmaputra catchment area. The fatty acid 14C record reveals a muted nuclear weapons bomb spike, requiring that the Ganges-Brahmaputra river system exports a mixture of young and old (pre-aged) leaf-wax compounds. According to numerical simulations, 79-83% of the leaf-wax fatty acids in this core are sourced from continental reservoirs that store organic carbon on an average of 1000-1200 calendar years, while the remainder has an average age of 15 years. These results demonstrate that a majority of the leaf-wax compounds produced in the Ganges-Brahmaputra river basin was stored in soils, floodplains, and wetlands prior to its export to the Bengal Fan. We will discuss the implications of these findings for plant-wax based paleoenvironmental records.

  7. FIB patterning of dielectric, metallized and graphene membranes: A comparative study

    International Nuclear Information System (INIS)

    Hemamouche, A.; Morin, A.; Bourhis, E.; Madouri, A.; Lafosse, X.; Ulysse, C.; Guilet, S.; Patriarche, G.; Gierak, J.; Toury, B.; Tarnaud, E.; Mathe, J.; Guegan, P.; Auvray, L.; Montel, F.; Wilmart, Q.; Placais, B.; Yates, J.

    2014-01-01

    Fabrication of nano-pores and nano-masks has recently emerged as an area of considerable interest for research applications ranging from optics, to electronics and to biophysics. In this work we evaluate and compare the fabrication of nano-pores, using a finely focused gallium beam, in free-standing membranes/films made of Si, SiN, and SiO 2 (having thicknesses of a few tens of nanometers) and also in graphene and hexagonal boron nitride (h-BN) atomically thin suspended sheets. Mechanical resistance, charging effects and patterning performances are evaluated and compared. In spite of the very different properties of the membranes we report that reproducible nano-pore fabrication in the sub-10 nm range can be achieved in both amorphous and atomically thin sheets using Ga + focused ion beams (FIB). (authors)

  8. Clustering of comb and propolis waxes based on the distribution of aliphatic constituents

    Directory of Open Access Journals (Sweden)

    Custodio Angela R.

    2003-01-01

    Full Text Available Chemical composition data for 41 samples of propolis waxes and 9 samples of comb waxes of Apis mellifera collected mainly in Brazil were treated using Principal Component Analysis (PCA and Hierarchical Cluster Analysis (HCA. For chemometrical analysis, the distribution of hydrocarbons and residues of alcohols and carboxylic acids of monoesters were considered. The clustering obtained revealed chemical affinities and differences not previously grasped by simple eye-inspection of the data. No consistent differences were detected between comb and propolis waxes. These and previous results suggest that hydrocarbons, carboxylic acids, aliphatic alcohols and esters from both comb and propolis waxes are bee-produced compounds and, hence, the differences detected between one and another region are dependent on genetic factors related to the insects rather than the local flora. The samples analyzed were split into two main clusters, one of them comprising exclusively material collected in the State of São Paulo. The results are discussed with respect to the africanization of honeybees that first took place in that State and therefrom irradiated to other parts of Brazil.

  9. Production of wax esters via microbial oil synthesis from food industry waste and by-product streams.

    Science.gov (United States)

    Papadaki, Aikaterini; Mallouchos, Athanasios; Efthymiou, Maria-Nefeli; Gardeli, Chryssavgi; Kopsahelis, Nikolaos; Aguieiras, Erika C G; Freire, Denise M G; Papanikolaou, Seraphim; Koutinas, Apostolis A

    2017-12-01

    The production of wax esters using microbial oils was demonstrated in this study. Microbial oils produced from food waste and by-product streams by three oleaginous yeasts were converted into wax esters via enzymatic catalysis. Palm oil was initially used to evaluate the influence of temperature and enzyme activity on wax ester synthesis catalysed by Novozyme 435 and Lipozyme lipases using cetyl, oleyl and behenyl alcohols. The highest conversion yields (up to 79.6%) were achieved using 4U/g of Novozyme 435 at 70°C. Transesterification of microbial oils to behenyl and cetyl esters was achieved at conversion yields up to 87.3% and 69.1%, respectively. Novozyme 435 was efficiently reused for six and three cycles during palm esters and microbial esters synthesis, respectively. The physicochemical properties of microbial oil derived behenyl esters were comparable to natural waxes. Wax esters from microbial oils have potential applications in cosmetics, chemical and food industries. Copyright © 2017 Elsevier Ltd. All rights reserved.

  10. Biodegradation of paraffin wax by crude Aspergillus enzyme preparations for potential use in removing paraffin deposits.

    Science.gov (United States)

    Zhang, Junhui; Xue, Quanhong; Gao, Hui; Wang, Ping

    2015-11-01

    Paraffin deposition problems have plagued the oil industry. Whist mechanical and chemical methods are problematic, microbiological method of paraffin removal is considered an alternative. However, studies have mainly investigated the use of bacteria, with little attention to the potential of fungi. The performance of six Aspergillus isolates to degrade paraffin wax was evaluated under laboratory conditions using solid enzyme preparations. The results showed that all the six enzyme preparations efficiently improved the solubility of paraffin wax in n-hexane and degraded n-alkanes in paraffin wax. The degradation process was accompanied by dynamic production of gases (CO2 and H2 ) and organic acids (oxalate and propionate). The shape of wax crystals markedly changed after enzymatic degradation, with a rough surface and a loose structure. This study indicates that extracellular enzymes from Aspergillus spp. can efficiently degrade paraffin wax. These enzyme preparations have the potential for use in oil wells with paraffin deposition problems. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Retained bone wax on CT at one year after dacryocystorhinostomy: A case report

    International Nuclear Information System (INIS)

    Kim, Seung Hyun; Park, Dong Woo; Jeong, Jin Yeok; Lee, Jong Ah; Lee, Young Jun

    2015-01-01

    A 71-year-old man with chronic rhinosinusitis presented with a purulent, foul-smelling nasal discharge and obstruction. One year earlier he had been treated with a dacryocystorhinostomy for nasolacrimal duct obstruction. During the procedure, bone wax had been used to control bleeding in the anterior upper nasal cavity. On computed tomographic imaging, a fat-density lesion was seen in the anterior upper sinonasal cavity and was found to be hypointense or signal-void on all magnetic resonance imaging sequences. The lesion, which proved to consist of bone wax, was surgically removed. Here, we present the imaging features of retained bone wax in a patient with clinically diagnosed chronic rhinosinusitis after dacryocystorhinostomy

  12. Retained bone wax on CT at one year after dacryocystorhinostomy: A case report

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seung Hyun; Park, Dong Woo; Jeong, Jin Yeok [Guri Hospital, Hanyang University College of Medicine, Guri (Korea, Republic of); Lee, Jong Ah; Lee, Young Jun [Dept. of Radiology, Seoul Hospital, Hanyang University College of Medicine, Seoul (Korea, Republic of)

    2015-09-15

    A 71-year-old man with chronic rhinosinusitis presented with a purulent, foul-smelling nasal discharge and obstruction. One year earlier he had been treated with a dacryocystorhinostomy for nasolacrimal duct obstruction. During the procedure, bone wax had been used to control bleeding in the anterior upper nasal cavity. On computed tomographic imaging, a fat-density lesion was seen in the anterior upper sinonasal cavity and was found to be hypointense or signal-void on all magnetic resonance imaging sequences. The lesion, which proved to consist of bone wax, was surgically removed. Here, we present the imaging features of retained bone wax in a patient with clinically diagnosed chronic rhinosinusitis after dacryocystorhinostomy.

  13. A review of the performance and structural considerations of paraffin wax hybrid rocket fuels with additives

    Science.gov (United States)

    Veale, Kirsty; Adali, Sarp; Pitot, Jean; Brooks, Michael

    2017-12-01

    Paraffin wax as a hybrid rocket fuel has not been comprehensively characterised, especially regarding the structural feasibility of the material in launch applications. Preliminary structural testing has shown paraffin wax to be a brittle, low strength material, and at risk of failure under launch loading conditions. Structural enhancing additives have been identified, but their effect on motor performance has not always been considered, nor has any standard method of testing been identified between research institutes. A review of existing regression rate measurement techniques on paraffin wax based fuels and the results obtained with various additives are collated and discussed in this paper. The review includes 2D slab motors that enable visualisation of liquefying fuel droplet entrainment and the effect of an increased viscosity on the droplet entrainment mechanism, which can occur with the addition of structural enhancing polymers. An increased viscosity has been shown to reduce the regression rate of liquefying fuels. Viscosity increasing additives that have been tested include EVA and LDPE. Both these additives increase the structural properties of paraffin wax, where the elongation and UTS are improved. Other additives, such as metal hydrides, aluminium and boron generally offer improvements on the regression rate. However, very little consideration has been given to the structural effects these additives have on the wax grain. A 40% aluminised grain, for example, offers a slight increase in the UTS but reduces the elongation of paraffin wax. Geometrically accurate lab-scale motors have also been used to determine the regression rate properties of various additives in paraffin wax. A concise review of all available regression rate testing techniques and results on paraffin wax based hybrid propellants, as well as existing structural testing data, is presented in this paper.

  14. Understanding nucleic acid structural changes by comparing wide-angle x-ray scattering (WAXS) experiments to molecular dynamics simulations

    Energy Technology Data Exchange (ETDEWEB)

    Pabit, Suzette A.; Katz, Andrea M.; Pollack, Lois [School of Applied and Engineering Physics, Cornell University, Ithaca, New York 14853 (United States); Tolokh, Igor S. [Department of Computer Science, Virginia Tech, Blacksburg, Virginia 24061 (United States); Drozdetski, Aleksander [Department of Physics, Virginia Tech, Blacksburg, Virginia 24061 (United States); Baker, Nathan [Pacific Northwest National Laboratory, Richland, Washington 99352 (United States); Onufriev, Alexey V. [Department of Computer Science, Virginia Tech, Blacksburg, Virginia 24061 (United States); Department of Physics, Virginia Tech, Blacksburg, Virginia 24061 (United States)

    2016-05-28

    Wide-angle x-ray scattering (WAXS) is emerging as a powerful tool for increasing the resolution of solution structure measurements of biomolecules. Compared to its better known complement, small angle x-ray scattering (SAXS), WAXS targets higher scattering angles and can enhance structural studies of molecules by accessing finer details of solution structures. Although the extension from SAXS to WAXS is easy to implement experimentally, the computational tools required to fully harness the power of WAXS are still under development. Currently, WAXS is employed to study structural changes and ligand binding in proteins; however, the methods are not as fully developed for nucleic acids. Here, we show how WAXS can qualitatively characterize nucleic acid structures as well as the small but significant structural changes driven by the addition of multivalent ions. We show the potential of WAXS to test all-atom molecular dynamics (MD) simulations and to provide insight into understanding how the trivalent ion cobalt(III) hexammine (CoHex) affects the structure of RNA and DNA helices. We find that MD simulations capture the RNA structural change that occurs due to addition of CoHex.

  15. Modified paraffin wax for improvement of histological analysis efficiency.

    Science.gov (United States)

    Lim, Jin Ik; Lim, Kook-Jin; Choi, Jin-Young; Lee, Yong-Keun

    2010-08-01

    Paraffin wax is usually used as an embedding medium for histological analysis of natural tissue. However, it is not easy to obtain enough numbers of satisfactory sectioned slices because of the difference in mechanical properties between the paraffin and embedded tissue. We describe a modified paraffin wax that can improve the histological analysis efficiency of natural tissue, composed of paraffin and ethylene vinyl acetate (EVA) resin (0, 3, 5, and 10 wt %). Softening temperature of the paraffin/EVA media was similar to that of paraffin (50-60 degrees C). The paraffin/EVA media dissolved completely in xylene after 30 min at 50 degrees C. Physical properties such as the amount of load under the same compressive displacement, elastic recovery, and crystal intensity increased with increased EVA content. EVA medium (5 wt %) was regarded as an optimal composition, based on the sectioning efficiency measured by the numbers of unimpaired sectioned slices, amount of load under the same compressive displacement, and elastic recovery test. Based on the staining test of sectioned slices embedded in a 5 wt % EVA medium by hematoxylin and eosin (H&E), Masson trichrome (MT), and other staining tests, it was concluded that the modified paraffin wax can improve the histological analysis efficiency with various natural tissues. (c) 2010 Wiley-Liss, Inc.

  16. Development of lamellar structures in natural waxes - an electron diffraction investigation

    Energy Technology Data Exchange (ETDEWEB)

    Dorset, Douglas L. [Electron Diffraction Department, Hauptman-Woodward Medical Research Institute, Inc., Buffalo, NY (United States)

    1999-06-07

    When they are recrystallized from the melt, natural plant or insect waxes tend to form solid phases with a nematic-like structure (i.e. a parallel array of polymethylene chains with little or no aggregation of the molecules into distinct layers). An electron diffraction study of carnauba wax and two types of beeswax has shown that the degree of molecular organization into lamellar structures can be enhanced by annealing in the presence of benzoic acid, which also acts as an epitaxial substrate. Nevertheless, the resultant layer structure in the annealed solid is not the same as that found for paraffin wax fractions refined from petroleum. Probably because of a small but significant fraction of a very long chain ingredient, the lamellar separation is incomplete, incorporating a number of 'bridging molecules' that span the nascent lamellar interface.The same phenomenon has been described recently for a low molecular weight polyethylene. (author)

  17. A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

    Science.gov (United States)

    Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

    2015-01-30

    Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Increased accumulation of cuticular wax and expression of lipid transfer protein in response to periodic drying events in leaves of tree tobacco.

    Science.gov (United States)

    Cameron, Kimberly D; Teece, Mark A; Smart, Lawrence B

    2006-01-01

    Cuticular wax deposition and composition affects drought tolerance and yield in plants. We examined the relationship between wax and dehydration stress by characterizing the leaf cuticular wax of tree tobacco (Nicotiana glauca L. Graham) grown under periodic dehydration stress. Total leaf cuticular wax load increased after each of three periods of dehydration stress using a CH2Cl2 extraction process. Overall, total wax load increased 1.5- to 2.5-fold, but composition of the wax was not altered. Homologous series of wax components were classified into organic groups; n-hentriacontane was the largest component (>75%) with alcohols and fatty acids representing drying event. Leaves excised from plants subjected to multiple drying events were more resistant to water loss compared to leaves excised from well-watered plants, indicating that there is a negative relationship between total wax load and epidermal conductance. Lipid transfer proteins (LTPs) are thought to be involved in the transfer of lipids through the extracellular matrix for the formation of cuticular wax. Using northern analysis, a 6-fold increase of tree tobacco LTP gene transcripts was observed after three drying events, providing further evidence that LTP is involved in cuticle deposition. The simplicity of wax composition and the dramatic wax bloom displayed by tree tobacco make this an excellent species in which to study the relationship between leaf wax deposition and drought tolerance.

  19. Preparation and Characterization of Sugar Cane Wax Microspheres ...

    African Journals Online (AJOL)

    ... and characterize indomethacin (IM) microspheres prepared with sugar cane wax microsperes. Methods: Microspheres were prepared by melt-emulsified dispersion and cooling-induced solidification method. The microspheres were characterized by scanning electron microscopy (SEM) and differntial scanning calorimetry ...

  20. The Relationship between Respiration-Related Membrane Potential Slow Oscillations and Discharge Patterns in Mitral/Tufted Cells: What Are the Rules?

    Science.gov (United States)

    Briffaud, Virginie; Fourcaud-Trocmé, Nicolas; Messaoudi, Belkacem; Buonviso, Nathalie; Amat, Corine

    2012-01-01

    Background A slow respiration-related rhythm strongly shapes the activity of the olfactory bulb. This rhythm appears as a slow oscillation that is detectable in the membrane potential, the respiration-related spike discharge of the mitral/tufted cells and the bulbar local field potential. Here, we investigated the rules that govern the manifestation of membrane potential slow oscillations (MPSOs) and respiration-related discharge activities under various afferent input conditions and cellular excitability states. Methodology and Principal Findings We recorded the intracellular membrane potential signals in the mitral/tufted cells of freely breathing anesthetized rats. We first demonstrated the existence of multiple types of MPSOs, which were influenced by odor stimulation and discharge activity patterns. Complementary studies using changes in the intracellular excitability state and a computational model of the mitral cell demonstrated that slow oscillations in the mitral/tufted cell membrane potential were also modulated by the intracellular excitability state, whereas the respiration-related spike activity primarily reflected the afferent input. Based on our data regarding MPSOs and spike patterns, we found that cells exhibiting an unsynchronized discharge pattern never exhibited an MPSO. In contrast, cells with a respiration-synchronized discharge pattern always exhibited an MPSO. In addition, we demonstrated that the association between spike patterns and MPSO types appeared complex. Conclusion We propose that both the intracellular excitability state and input strength underlie specific MPSOs, which, in turn, constrain the types of spike patterns exhibited. PMID:22952828

  1. A review on wax printed microfluidic paper-based devices for international health.

    Science.gov (United States)

    Altundemir, S; Uguz, A K; Ulgen, K

    2017-07-01

    Paper-based microfluidics has attracted attention for the last ten years due to its advantages such as low sample volume requirement, ease of use, portability, high sensitivity, and no necessity to well-equipped laboratory equipment and well-trained manpower. These characteristics have made paper platforms a promising alternative for a variety of applications such as clinical diagnosis and quantitative analysis of chemical and biological substances. Among the wide range of fabrication methods for microfluidic paper-based analytical devices ( μ PADs), the wax printing method is suitable for high throughput production and requires only a commercial printer and a heating source to fabricate complex two or three-dimensional structures for multipurpose systems. μ PADs can be used by anyone for in situ diagnosis and analysis; therefore, wax printed μ PADs are promising especially in resource limited environments where people cannot get sensitive and fast diagnosis of their serious health problems and where food, water, and related products are not able to be screened for toxic elements. This review paper is focused on the applications of paper-based microfluidic devices fabricated by the wax printing technique and used for international health. Besides presenting the current limitations and advantages, the future directions of this technology including the commercial aspects are discussed. As a conclusion, the wax printing technology continues to overcome the current limitations and to be one of the promising fabrication techniques. In the near future, with the increase of the current interest of the industrial companies on the paper-based technology, the wax-printed paper-based platforms are expected to take place especially in the healthcare industry.

  2. Simulation of temperature-pressure profiles and wax deposition in gas-lift wells

    Directory of Open Access Journals (Sweden)

    Sevic Snezana

    2017-01-01

    Full Text Available Gas-lift is an artificial lift method in which gas is injected down the tubing- -casing annulus and enters the production tubing through the gas-lift valves to reduce the hydrostatic pressure of the formation fluid column. The gas changes pressure, temperature and fluid composition profiles throughout the production tubing string. Temperature and pressure drop along with the fluid composition changes throughout the tubing string can lead to wax, asphaltenes and inorganic salts deposition, increased emulsion stability and hydrate formation. This paper presents a new model that can sucesfully simulate temperature and pressure profiles and fluid composition changes in oil well that operates by means of gas-lift. This new model includes a pipe-in-pipe segment (production tubing inside production casing, countercurrent flow of gas-lift gas and producing fluid, heat exchange between gas-lift gas and the surrounding ambient – ground; and gas-lift gas with the fluid in the tubing. The model enables a better understanding of the multiphase fluid flow up the production tubing. Model was used to get insight into severity and locations of wax deposition. The obtained information on wax deposition can be used to plan the frequency and depth of wax removing operations. Model was developed using Aspen HYSYS software.

  3. Catalytic cracking of slack wax with molten mixtures containing aluminum chloride and bromide. [Wax obtained in the process of dewaxing lubricating oils

    Energy Technology Data Exchange (ETDEWEB)

    Ohtsuka, Y; Oizumi, K; Tamai, Y

    1983-09-01

    The catalytic cracking of slack wax with molten mixtures of AlCl/sub 3/ (aluminum chloride) and AlBr/sub 3/ (aluminum bromide) was investigated in an atmospheric semi-batch reactor at low temperatures of 100 to 160/sup 0/C. The cracking rate was proportional to the amount of unreacted wax. The conversion at 135/sup 0/C reached 25 wt % under typical reaction conditions. About 95 wt % of the cracking products consisted of isobutane, 2-methylbutane, and methylpentanes, ca. 50% of these isoparaffins being isobutane. The difference in cracking activity between this catalyst and a solid acid catalyst is discussed based on the product distribution. Hardly any reaction took place without HCl, which shows that the presence of HCl is essential for this cracking. The cracking rate increased sharply with an increase in the amount of the catalyst. The rate did not depend on the composition of the AlCl/sub 3//sup -/ AlBr/sub 3/ catalyst, but the product distribution did depend on it and the content of the gasoline fraction in the products increased with an increase in the concentration of AlBr/sub 3/. The cracking residue was characterized by IR and NMR spectroscopy. The results show that the cracking reaction probably occurs heterogeneously at the interface between the liquid wax and the molten catalyst. 3 figures, 4 tables.

  4. Proteolysis breaks tolerance toward intact α345(IV) collagen, eliciting novel anti-GBM autoantibodies specific for α345NC1 hexamers

    Science.gov (United States)

    Olaru, Florina; Wang, Xu-Ping; Luo, Wentian; Ge, Linna; Miner, Jeffrey H; Kleinau, Sandra; Geiger, Xochiquetzal J.; Wasiluk, Andrew; Heidet, Laurence; Kitching, A. Richard; Borza, Dorin-Bogdan

    2012-01-01

    Goodpasture disease is an autoimmune kidney disease mediated by autoAbs against NC1 monomers of α3(IV) collagen that bind to the glomerular basement membrane (GBM), usually causing rapidly progressive glomerulonephritis. We identified a novel type of human IgG4-restricted anti-GBM autoAbs associated with mild non-progressive glomerulonephritis, which specifically targeted α345NC1 hexamers but not α3NC1 monomers. The mechanisms eliciting these anti-GBM autoAbs were investigated in mouse models recapitulating this phenotype. Wild type and FcγRIIB−/− mice immunized with autologous murine GBM NC1 hexamers produced mouse IgG1-restricted autoAbs specific for α345NC1 hexamers, which bound to the GBM in vivo but did not cause glomerulonephritis. In these mice, intact collagen IV from murine GBM was not immunogenic. However, in Col4a3−/− Alport mice, both intact collagen IV and NC1 hexamers from murine GBM elicited IgG antibodies specific for α3α4α5NC1 hexamers, which were not subclass restricted. As heterologous antigen in COL4A3-humanized mice, murine GBM NC1 hexamers elicited mouse IgG1, IgG2a and IgG2b autoAbs specific for α345NC1 hexamers and induced anti-GBM Ab glomerulonephritis. These findings indicate that tolerance toward autologous intact α3α4α5(IV) collagen is established in hosts expressing this antigen, even though autoreactive B cells specific for α345NC1 hexamers are not purged from their repertoire. Proteolysis selectively breaches this tolerance by generating autoimmunogenic α3α4α5NC1 hexamers. This provides a mechanism eliciting autoAbs specific for α345NC1 hexamers, which are restricted to non-inflammatory IgG subclasses and non-nephritogenic. In Alport syndrome, lack of tolerance toward α3α4α5(IV) collagen promotes production of alloantibodies to α345NC1 hexamers, including pro-inflammatory IgG subclasses which mediate post-transplant anti-GBM nephritis. PMID:23303673

  5. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  6. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  7. Divorcing folding from function: how acylation affects the membrane-perturbing properties of an antimicrobial peptide

    DEFF Research Database (Denmark)

    Vad, Brian Stougaard; Thomsen, Line Aagot Hede; Bertelsen, Kresten

    2010-01-01

    Many small cationic peptides, which are unstructured in aqueous solution, have antimicrobial properties. These properties are assumed to be linked to their ability to permeabilize bacterial membranes, accompanied by the transition to an alpha-helical folding state. Here we show that there is no d......Many small cationic peptides, which are unstructured in aqueous solution, have antimicrobial properties. These properties are assumed to be linked to their ability to permeabilize bacterial membranes, accompanied by the transition to an alpha-helical folding state. Here we show...... that there is no direct link between folding of the antimicrobial peptide Novicidin (Nc) and its membrane permeabilization. N-terminal acylation with C8-C16 alkyl chains and the inclusion of anionic lipids both increase Nc's ability to form alpha-helical structure in the presence of vesicles. Nevertheless, both acylation......, this cannot rationalize our results since permeabilization and antimicrobial activities are observed well below concentrations where aggregation occurs. This suggests that significant induction of alpha-helical structure is not a prerequisite for membrane perturbation in this class of antimicrobial peptides...

  8. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    International Nuclear Information System (INIS)

    Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G

    2012-01-01

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 µm. The whole process is easy to perform without the requirement for any microfabrication facilities. (technical note)

  9. Investigation of the structure of human dental tissue at multiple length scales using high energy synchrotron X-ray SAXS/WAXS

    Science.gov (United States)

    Sui, Tan; Landini, Gabriel; Korsunsky, Alexander M.

    2011-10-01

    High energy (>50keV) synchrotron X-ray scattering experiments were carried out on beamline I12 JEEP at the Diamond Light Source (DLS, Oxford, UK). Although a complete human tooth could be studied, in the present study attention was focused on coupons from the region of the Dentin-Enamel Junction (DEJ). Simultaneous high energy SAXS/WAXS measurements were carried out. Quantitative analysis of the results allows multiple length scale characterization of the nano-crystalline structure of dental tissues. SAXS patterns analysis provide insight into the mean thickness and orientation of hydroxyapatite particles, while WAXS (XRD) patterns allow the determination of the crystallographic unit cell parameters of the hydroxyapatite phase. It was found that the average particle thickness determined from SAXS interpretation varies as a function of position in the vicinity of the DEJ. Most mineral particles are randomly orientated within dentin, although preferred orientation emerges and becomes stronger on approach to the enamel. Within the enamel, texture is stronger than anywhere in the dentin, and the determination of lattice parameters can be accomplished by Pawley refinement of the multiple peak diffraction pattern. The results demonstrate the feasibility of using high energy synchrotron X-ray beams for the characterization of human dental tissues. This opens up the opportunity of studying thick samples (e.g., complete teeth) in complex sample environments (e.g., under saline solution). This opens new avenues for the application of high energy synchrotron X-ray scattering to dental research.

  10. Particulate pollutants are capable to 'degrade' epicuticular waxes and to decrease the drought tolerance of Scots pine (Pinus sylvestris L.).

    Science.gov (United States)

    Burkhardt, Juergen; Pariyar, Shyam

    2014-01-01

    Air pollution causes the amorphous appearance of epicuticular waxes in conifers, usually called wax 'degradation' or 'erosion', which is often correlated with tree damage symptoms, e.g., winter desiccation. Previous investigations concentrated on wax chemistry, with little success. Here, we address the hypothesis that both 'wax degradation' and decreasing drought tolerance of trees may result from physical factors following the deposition of salt particles onto the needles. Pine seedlings were sprayed with dry aerosols or 50 mM solutions of different salts. The needles underwent humidity changes within an environmental scanning electron microscope, causing salt expansion on the surface and into the epistomatal chambers. The development of amorphous wax appearance by deliquescent salts covering tubular wax fibrils was demonstrated. The minimum epidermal conductance of the sprayed pine seedlings increased. Aerosol deposition potentially 'degrades' waxes and decreases tree drought tolerance. These effects have not been adequately considered thus far in air pollution research. Copyright © 2013 Elsevier Ltd. All rights reserved.

  11. Online estimation of wax deposition thickness in single-phase sub-sea pipelines based on acoustic chemometrics: A feasibility study

    OpenAIRE

    Halstensen, Maths; Arvoh, Benjamin Kaku; Amundsen, Lene; Hoffmann, Rainer

    2012-01-01

    Wax deposition in sub-sea oil producing pipelines is a concern to the oil producing companies. The deposition of wax in pipelines can cause serious economic implications if not monitored and controlled. Several researchers have developed models and investigated the deposition of wax in crude oil pipelines. As of today, there is no off the shelf instrument available for reliable online estimation of the wax depo- sition thickness in sub-sea pipelines. Acoustic chemometrics was applied to inves...

  12. Identification of the NC1 domain of {alpha}3 chain as critical for {alpha}3{alpha}4{alpha}5 type IV collagen network assembly.

    Science.gov (United States)

    LeBleu, Valerie; Sund, Malin; Sugimoto, Hikaru; Birrane, Gabriel; Kanasaki, Keizo; Finan, Elizabeth; Miller, Caroline A; Gattone, Vincent H; McLaughlin, Heather; Shield, Charles F; Kalluri, Raghu

    2010-12-31

    The network organization of type IV collagen consisting of α3, α4, and α5 chains in the glomerular basement membrane (GBM) is speculated to involve interactions of the triple helical and NC1 domain of individual α-chains, but in vivo evidence is lacking. To specifically address the contribution of the NC1 domain in the GBM collagen network organization, we generated a mouse with specific loss of α3NC1 domain while keeping the triple helical α3 chain intact by connecting it to the human α5NC1 domain. The absence of α3NC1 domain leads to the complete loss of the α4 chain. The α3 collagenous domain is incapable of incorporating the α5 chain, resulting in the impaired organization of the α3α4α5 chain-containing network. Although the α5 chain can assemble with the α1, α2, and α6 chains, such assembly is incapable of functionally replacing the α3α4α5 protomer. This novel approach to explore the assembly type IV collagen in vivo offers novel insights in the specific role of the NC1 domain in the assembly and function of GBM during health and disease.

  13. Flow and linear coefficient of thermal expansion of four types of Base Plate waxes compared with ADA standard

    Directory of Open Access Journals (Sweden)

    Monzavi A

    2002-07-01

    Full Text Available Waxes have a lot of applications in dentistry. Such materials are of thermoplastic type that undergoes deformation in different temperatures. Two important properties of base plate waxes are flow and their coefficient of linear thermal expansion. Recently, different institutions, inside the country, produce dentistry waxes, while they have not been standardized. Consequently, consumers' dissatisfaction are observed. In this research, the two above- mentioned factors were compared between three kinds of Iranian waxes with Cavex that is foreign production, based on test number 24 of ADA. To measure the flow rate in the temperatures of 23, 37 and 45°c, Wilcoxon statistical analysis was used. The results showed that in 23°c, the flow rate of Cavex and Azardent waxes met ADA standards; however, it was not true for two others types. In 37°c, the flow of none of the waxes was standardized and in 45°c their flow was acceptable, moreover, thermal expansion coefficient, for Cavex and Azardent types, was based on ADA standard.

  14. Evaluation of methods for wax determination in crude oil; Avaliacao de metodos de determinacao de parafinas em petroleo

    Energy Technology Data Exchange (ETDEWEB)

    Dias, Julio Cesar M.; Silva, Maria do Socorro A.J. da; Vasconcellos, Rosa C.U. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil). Centro de Pesquisas; Tamanqueira, Juliana B. [Fundacao Gorceix, Ouro Preto, MG (Brazil)

    2008-07-01

    Determining the wax content of crude oil is of great importance for petroleum industry, especially for production, storage and transportation of crude oils. Many different methodologies of wax determining are available in the technical literature. However, the selection of the most suitable method must be in accordance with the aim of the analysis and observing the specificities of each technique. The purpose of this work was to determine the performance of different techniques of wax determining applied to characterization of precipitation properties of waxy compounds in crude oils. Twelve samples of crude oils proceeding from the main Brazilian oil producing sedimentary basins were selected for this study. These samples were analyzed by three important analytical techniques of wax determining: precipitation by cooled solvent; liquid chromatography with precipitation by cooled solvent; and liquid chromatography followed by gas chromatography. Differential scanning calorimetry data related to the wax crystallization in these oils were used as parameters of validation. The results obtained in this study indicate that the liquid chromatography followed by gas chromatography method has the best performance for wax determining in crude oils. (author)

  15. Effect of asphaltenes on crude oil wax crystallization

    DEFF Research Database (Denmark)

    Kriz, Pavel; Andersen, Simon Ivar

    2005-01-01

    The paper summarizes the experimental work done on asphaltene influenced wax crystallization. Three different asphaltenes (from stable oil, instable oil, and deposit) were mixed at several concentrations or dispersions into the waxy crude oil. These blends were evaluated by viscometry and yield s...

  16. Comparative Evaluation of Marginal and Internal Gap of Co-Cr Copings Fabricated from Conventional Wax Pattern, 3D Printed Resin Pattern and DMLS Tech: An In Vitro Study.

    Science.gov (United States)

    Bhaskaran, Eswaran; Azhagarasan, N S; Miglani, Saket; Ilango, T; Krishna, G Phani; Gajapathi, B

    2013-09-01

    Accuracy of the fit of the restoration has always remained as one of the primary factors in determining success of the restoration. A well fitting restoration needs to be accurate both along its margins and internal surface. This study was conducted to comparatively evaluate the marginal gap and internal gap of cobalt-chromium (Co-Cr) copings fabricated by conventional casting procedures and with direct metal laser sintering (DMLS) technique. Among the total of 30 test samples 10 cast copings were made from inlay casting wax and 10 from 3D printed resin pattern. 10 copings were obtained from DMLS technique. All the 30 test samples were then cemented sequentially on stainless steel model using pressure indicating paste and evaluated for vertical marginal gap in 8 predetermined reference areas. All copings were then removed and partially sectioned and cemented sequentially on same master model for evaluation of internal gap at 4 predetermined reference areas. Both marginal gap and internal gap were measured in microns using video measuring system (VMS2010F). The results obtained for both marginal and internal gap were statistically analyzed and the values fall within the clinically acceptable range. The DMLS technique had an edge over the other two techniques used, as it exhibited minimal gap in the marginal region which is an area of chief concern.

  17. Metabolism of dietary fatty alcohol, fatty acid, and wax ester in carp

    International Nuclear Information System (INIS)

    Mankura, Mitsumasa; Kayama, Mitsu; Iijima, Noriaki.

    1987-01-01

    Lipids in various tissues of the carp, Cyprinus carpio were analyzed. The fates of force-fed [1- 14 C]palmitic acids, [1- 14 C]cetyl alcohol, and oleyl[1- 14 C]linoleate, were compared with those given in vitro experiments. Major lipid classes in all except adipose tissue were found to be polar lipids (phospholipids) and triacylglycerols. The major fatty acids in nearly all the tissues were 16 : 0, 18 : 1, 18 : 2, and 22 : 6. Although the radioactivity incorporation into wax esters from [1- 14 C]palmitic acid and [1- 14 C]cetyl alcohol for various tissue homogenates was quite high, in vivo incorporation of these labelled compounds into wax esters was very low and radioactivity was distributed mainly in the lipids of muscle, skin, hepatopancreas, intestine, and gill. Almost all the radioactivity in various tissues was present in phospatidylcholine and triacylglycerols. Most of the oleyl[1- 14 C]linoleate was easily hydrolyzed by various tissue homogenates. Force-fed oleyl[1- 14 C]linoleate was hydrolyzed in the intestine and then transported to other tissues, such as muscle, kin, gill, and hepatopancreas. Moreover, released radioactivity from oleyl[1- 14 C]linoleate was present in mainly phosphatidylcholine and triacylglycerols. Radioactivity was also detected in wax esters in plasma. Certain amounts for fatty acids released from [1- 14 C]triolein in the hepatopancreas homogenates were incorporated into wax esters; this was stimulated by the addition of oleyl alcohol. The present results indicate extensive hydrolysis of wax ester to possibly occur in the intestine and certain portions of the fatty alcohol moiety to be resterfied. The portions may be oxidized to fatty acids and which subsequently behave as dietary fatty acids. (author) 50 ref

  18. Influence of putrescine and carnauba wax on functional and sensory quality of pomegranate (Punica granatum L.) fruits during storage.

    Science.gov (United States)

    Barman, Kalyan; Asrey, Ram; Pal, R K; Kaur, Charanjit; Jha, S K

    2014-01-01

    Functional properties (anthocyanins, antioxidant, ascorbic acid and tannin) and sensory score were determined in pomegranate fruits at two storage temperatures (3 and 5 °C) after treatment with 2 mM putrescine and 1 : 10 carnauba wax (carnauba wax : water). The treatments (putrescine and carnauba wax) were given by immersion method followed by storage up to 60 days. Both treatments retained significantly higher anthocyanins, antioxidant, ascorbic acid, tannin and sensory qualities as compared with control fruits under both the storage conditions. Combined application of putrescine + carnauba wax showed better response in retaining functional properties than putrescine treated or nontreated fruits. The impacts of putrescine and carnauba wax treatments were found more pronounced after 30 days at 3-5 °C storage temperature in retaining functional and sensory qualities. After 60 days of storage, putrescine + carnauba wax retained about 25% higher antioxidant activity both at 3 and 5 °C storage temperatures.

  19. Field effect transistors and photodetectors based on nanocrystalline graphene derived from electron beam induced carbonaceous patterns

    International Nuclear Information System (INIS)

    Kurra, Narendra; Bhadram, Venkata Srinu; Narayana, Chandrabhas; Kulkarni, G U

    2012-01-01

    We describe a transfer-free method for the fabrication of nanocrystalline graphene (nc-graphene) on SiO 2 substrates directly from patterned carbonaceous deposits. The deposits were produced from the residual hydrocarbons present in the vacuum chamber without any external source by using an electron beam induced carbonaceous deposition (EBICD) process. Thermal treatment under vacuum conditions in the presence of Ni catalyst transformed the EBIC deposit into nc-graphene patterns, confirmed using Raman and TEM analysis. The nc-graphene patterns have been employed as an active p-type channel material in a field effect transistor (FET) which showed a hole mobility of ∼90 cm 2 V −1 s −1 . The nc-graphene also proved to be suitable material for IR detection. (paper)

  20. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang

    2012-01-13

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.

  1. Effects of irradiation in combination with waxing on the essential oils in orange peel

    International Nuclear Information System (INIS)

    Moussaid, M.; Lacroix, M.; Nketsia-Tabiri, J.; Boubekri, C.

    2000-01-01

    The study evaluated the effects of waxing and irradiation dose on the essential oils in orange peel. Mature oranges (Maroc late) waxed or unwaxed were treated with 0-2 kGy radiation. Volatiles in the peel were extracted and analyzed by G.C. D-limonene was significantly lower (P≤0.05) in waxed oranges; levels in samples treated with 2 kGy were higher than those treated with 0 or 1 kGy. Linalool, methyl anthranilate and 3.7-dimethyl-2.6-octadienal decreased as the dose increased. The analysis of variance indicates that only linalool was influenced by post-irradiation storage time. The level of this compound increased with storage time. (author)

  2. Influence of post-casting treatments on sulphonated polyetheretherketone composite membranes

    Energy Technology Data Exchange (ETDEWEB)

    Carbone, Alessandra; Gatto, Irene; Passalacqua, Enza [CNR-ITAE, Institute for Advanced Energy Technologies ' ' N. Giordano' ' Via Salita S. Lucia sopra Contesse, 5 - Messina (Italy); Ohira, Akihiro; Wu, Libin [FC-CUBIC (Polymer Electrolyte Fuel Cell Cutting-Edge Research Center) AIST Tokyo Waterfront, 2-41-6, Aomi, Koto-ku, Tokyo 135-0064 (Japan)

    2010-09-15

    Since the post-casting treatments influence the water entrapped in polymeric matrix and consequently its proton conductivity, an evaluation of annealing at 200 C and acid treatments was conducted on previously developed composite s-PEEK (1.55 mequiv. g{sup -1}) membranes, containing a commercial aminopropyl-functionalised silica. DSC, WAXS, SEM-EDX and laser microscope measurements carried out on membranes swollen at different temperatures highlighted different membrane properties depending on post-casting treatments. It was found that composite membranes have different structural and morphological characteristics than pristine polymer membranes. The silica distribution was modified when different treatments are used. The state of water changed when silica was inserted into the membranes. Actually, contrary to the pristine membranes the presence of freezable water was revealed at temperature lower than 80 C. The proton conductivity was also affected by the presence and the amount of water trapped into the membranes and was particularly influenced by the post-casting treatments. The silica introduction reduced the swelling effect and improved the robustness of the membranes even if a higher water content in the freezable state was observed. Acid treatment leads to significant improvement in membrane properties, but the present work shows that annealing before acid treatment can affect the membrane morphology more strongly than other treatments resulting in a much better fuel cell performance. (author)

  3. ETHNOECOLOGY AND ETHNOBOTANY OF THE PALM CARNAUBA WAX IN BRAZILIAN SEMI-ARID

    OpenAIRE

    Rodrigo Ferreira de Sousa; Richeliel Albert Rodrigues Silva; Talita Geovanna Fernandes Rocha; José Augusto da Silva Santana; Fábio de Almeida Vieira

    2015-01-01

    The aim of this study was to investigate aspects of ethnoecological and ethnobotanical of carnauba wax (Copernicia prunifera (Miller) H. E. Moore, Arecaceae) in an extractive community of municipality of Ipanguaçu, Rio Grande do Norte state. We interviewed key informants, using the technique of inducing nonspecific, guided tour and direct observation to confirm the data. According to most residents of Pedro Ezequiel Araújo community, the area of carnauba wax in the region is natural. In the r...

  4. Epicuticular wax on stomata of damaged silver fir trees (Abies alba Mili.)

    OpenAIRE

    Tomislav Bačić; Ljiljana Krstin; Jadranka Roša; Željko Popović

    2011-01-01

    Condition of epistomatal wax on the abaxial surface of the current and previous-year needles of damaged silver fir trees (Abies alba Mill.), both from the polluted Risnjak and "clean" Donja Dobra sites in Gorski Kotar region, both influenced by pollutants coming from Europe, during two years, three times a year, were examined with Scanning Electron Microscope. In the course of time the wax tubules on the epistomatal rims of stomata in polluted, but also in "clean" needles surface, become fuse...

  5. De novo assembly and characterization of the transcriptome, and development of SSR markers in wax gourd (Benicasa hispida.

    Directory of Open Access Journals (Sweden)

    Biao Jiang

    Full Text Available BACKGROUND: Wax gourd is a widely used vegetable of Cucuribtaceae, and also has important medicinal and health values. However, the genomic resources of wax gourd were scarcity, and only a few nucleotide sequences could be obtained in public databases. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we examined transcriptome in wax gourd. More than 44 million of high quality reads were generated from five different tissues of wax gourd using Illumina paired-end sequencing technology. Approximately 4 Gbp data were generated, and de novo assembled into 65,059 unigenes, with an N50 of 1,132 bp. Based on sequence similarity search with known protein database, 36,070 (55.4% showed significant similarity to known proteins in Nr database, and 24,969 (38.4% had BLAST hits in Swiss-Prot database. Among the annotated unigenes, 14,994 of wax gourd unigenes were assigned to GO term annotation, and 23,977 were found to have COG classifications. In addition, a total of 18,713 unigenes were assigned to 281 KEGG pathways. Furthermore, 6,242 microsatellites (simple sequence repeats were detected as potential molecular markers in wax gourd. Two hundred primer pairs for SSRs were designed for validation of the amplification and polymorphism. The result showed that 170 of the 200 primer pairs were successfully amplified and 49 (28.8% of them exhibited polymorphisms. CONCLUSION/SIGNIFICANCE: Our study enriches the genomic resources of wax gourd and provides powerful information for future studies. The availability of this ample amount of information about the transcriptome and SSRs in wax gourd could serve as valuable basis for studies on the physiology, biochemistry, molecular genetics and molecular breeding of this important vegetable crop.

  6. Gourds: Bitter, Bottle, Wax, Snake, Sponge and Ridge

    Science.gov (United States)

    Minor cucurbits include bitter gourd, bottle gourd, wax gourd, snake gourd, and sponge and ridge gourd, which are significant dietary sources of nutrients such as vitamin A and C, iron and calcium. These cucurbits are cultivated and marketed by smallholder farmers and remain important components of ...

  7. Effect of new type of synthetic waxes on reduced production and compaction temperature of asphalt mixture with reclaimed asphalt

    Science.gov (United States)

    Valentová, Tereza; Benešová, Lucie; Mastný, Jan; Valentin, Jan

    2017-09-01

    Lower mixing and paving temperatures of asphalt mixtures, which are an important issue in recent years, with respect to increased energy demand of civil engineering structures during their processing, allow reduction of this demand and result in minimized greenhouse gas production. In present time, there are many possibilities how to achieve reduction of production temperature during the mixing and paving of an asphalt mixture. The existing solutions distinguish in target operating temperature behaviour which has to be achieved in terms of good workability. This paper is focused on technical solutions based on use of new types of selected synthetic and bio-based waxes. In case of bio-based additive sugar cane wax was used, which is free of paraffins and is reclaimed as waste product during processing of sugar cane. The used waxes are added to bituminous binder in form of free-flowing granules or fine-grained powder. Synthetic waxes are represented by new series of Fischer-Tropsch wax in form of fine granules as well as by polyethylene waxes in form of fine-grained powder or granules. Those waxes were used to modify a standard paving grade bitumen dosed into asphalt mixture of ACsurf type containing up to 30 % of reclaimed asphalt (RA).

  8. High-pressure stainless steel active membrane microvalves

    International Nuclear Information System (INIS)

    Sharma, G; Svensson, S; Ogden, S; Klintberg, L; Hjort, K

    2011-01-01

    In this work, high-pressure membrane microvalves have been designed, manufactured and evaluated. The valves were able to withstand back-pressures of 200 bar with a response time of less than 0.6 s. These stainless steel valves, manufactured with back-end batch production, utilize the large volume expansion coupled to the solid–liquid phase transition in paraffin wax. When membrane materials were evaluated, parylene coated stainless steel was found to be the best choice as compared to polydimethylsiloxane and polyimide. Also, the influence of the orifice placement and diameter is included in this work. If the orifice is placed too close to the rim of the membrane, the valve can stay sealed even after turning the power off, and the valve will not open until the pressure in the system is released. The developed steel valves, evaluated for both water and air, provide excellent properties in terms of mechanical stability, ease of fabrication, and low cost. Possible applications include sampling at high pressures, chemical microreactors, high performance liquid chromatography, pneumatics, and hydraulics

  9. Effect of high dose SO2 and ethylene exposure on the structure of epicuticular wax of picea pungens

    International Nuclear Information System (INIS)

    Patrie, J.; Berg, V.

    1994-01-01

    Conifers in polluted air generally exhibit accelerated degradation of epicuticular wax, but it is not clear whether the change is due to direct exposure to the pollutant or some other mechanism. Needles from blue spruce (Picea pungens) were exposed to sulfur dioxide or ethylene gas at 0 to 10,000 microliters per liter for 2 to 196 h; samples were examined by scanning electron microscopy. Neither gas caused changes in the wax crystals, although late in the growing season a fungal infestation was associated with degradation of wax structures. This supports hypotheses explaining accelerated epicuticular wax degradation by indirect effects of exposure to air pollutants. (orig.)

  10. Surfactant-free carnauba wax dispersion and its use for layer-by-layer assembled protective surface coatings on wood

    International Nuclear Information System (INIS)

    Lozhechnikova, Alina; Bellanger, Hervé; Michen, Benjamin; Burgert, Ingo; Österberg, Monika

    2017-01-01

    Highlights: • A facile sonication route to produce aqueous wax dispersions is developed. • The wax dispersion is naturally stable and free of surfactants or stabilizers. • Wax and ZnO particles are coated onto wood using layer-by-layer assembly. • The coating brings superhydrophobicity while preserving moisture buffering. • ZnO improves the color stability of wood to UV light. - Abstract: Protection from liquid water and UV radiation are equally important, and a sophisticated approach is needed when developing surface coatings that preserve the natural and well-appreciated aesthetic appearance of wood. In order to prevent degradation and prolong the service life of timber, a protective coating was assembled using carnauba wax particles and zinc oxide nanoparticles via layer-by-layer deposition in water. For this purpose, a facile sonication route was developed to produce aqueous wax dispersion without any surfactants or stabilizers. The suspension was stable above pH 4 due to the electrostatic repulsion between the negatively charged wax particles. The particle size could be controlled by the initial wax concentration with average particle sizes ranging from 260 to 360 nm for 1 and 10 g/L, respectively. The deposition of wax particles onto the surface of spruce wood introduced additional roughness to the wood surface at micron level, while zinc oxide provided nano roughness and UV-absorbing properties. In addition to making wood superhydrophobic, this novel multilayer coating enhanced the natural moisture buffering capability of spruce. Moreover, wood surfaces prepared in this fashion showed a significant reduction in color change after exposure to UV light. A degradation of the wax through photocatalytic activity of the ZnO particles was measured by FTIR, indicating that further studies are required to achieve long-term stability. Nevertheless, the developed coating showed a unique combination of superhydrophobicity and excellent moisture buffering

  11. Surfactant-free carnauba wax dispersion and its use for layer-by-layer assembled protective surface coatings on wood

    Energy Technology Data Exchange (ETDEWEB)

    Lozhechnikova, Alina [Department of Forest Products Technology, School of Chemical Technology, Aalto University, P.O. Box 16300, FI-00076, Aalto (Finland); Bellanger, Hervé; Michen, Benjamin; Burgert, Ingo [Institute for Building Materials (IfB), Wood Materials Science, ETH Zürich, Stefano-Franscini-Platz 3, 8093 Zürich (Switzerland); Applied Wood Materials Laboratory, Empa − Swiss Federal Laboratories for Material Testing and Research, 8600 Dübendorf (Switzerland); Österberg, Monika, E-mail: monika.osterberg@aalto.fi [Department of Forest Products Technology, School of Chemical Technology, Aalto University, P.O. Box 16300, FI-00076, Aalto (Finland)

    2017-02-28

    Highlights: • A facile sonication route to produce aqueous wax dispersions is developed. • The wax dispersion is naturally stable and free of surfactants or stabilizers. • Wax and ZnO particles are coated onto wood using layer-by-layer assembly. • The coating brings superhydrophobicity while preserving moisture buffering. • ZnO improves the color stability of wood to UV light. - Abstract: Protection from liquid water and UV radiation are equally important, and a sophisticated approach is needed when developing surface coatings that preserve the natural and well-appreciated aesthetic appearance of wood. In order to prevent degradation and prolong the service life of timber, a protective coating was assembled using carnauba wax particles and zinc oxide nanoparticles via layer-by-layer deposition in water. For this purpose, a facile sonication route was developed to produce aqueous wax dispersion without any surfactants or stabilizers. The suspension was stable above pH 4 due to the electrostatic repulsion between the negatively charged wax particles. The particle size could be controlled by the initial wax concentration with average particle sizes ranging from 260 to 360 nm for 1 and 10 g/L, respectively. The deposition of wax particles onto the surface of spruce wood introduced additional roughness to the wood surface at micron level, while zinc oxide provided nano roughness and UV-absorbing properties. In addition to making wood superhydrophobic, this novel multilayer coating enhanced the natural moisture buffering capability of spruce. Moreover, wood surfaces prepared in this fashion showed a significant reduction in color change after exposure to UV light. A degradation of the wax through photocatalytic activity of the ZnO particles was measured by FTIR, indicating that further studies are required to achieve long-term stability. Nevertheless, the developed coating showed a unique combination of superhydrophobicity and excellent moisture buffering

  12. The analysis of the wax foundry models fabrication process for the CPX3000 device

    Directory of Open Access Journals (Sweden)

    G. Budzik

    2011-04-01

    Full Text Available The paper presents possibilities of creating wax founding models by means of CPX3000 device. The device is used for Rapid Prototypingof models made of foundry wax in an incremental process. The paper also presents problems connected with choosing technologicalparameters for incremental shaping which influence the accuracy of created models. Issues connected with post-processing are alsodescribed. This process is of great importance for obtaining geometrically correct models. The analysis of parameters of cleaning models from supporting material is also presented. At present CPX3000 printer is the first used in Poland device by 3D Systems firm for creating wax models. The printer is at The Faculty of Mechanical Engineering at Rzeszów University of Technology.

  13. Morphology and accumulation of epicuticular wax on needles of Douglas-fir (Pseudotsuga menziesii var. menziesii)

    Science.gov (United States)

    Constance A. Harrington; William C. Carlson

    2015-01-01

    Past studies have documented differences in epicuticular wax among several tree species but little attention has been paid to changes in accumulation of foliar wax that can occur during the year. We sampled current-year needles from the terminal shoots of Douglas-fir (Pseudotsuga menziesii var. menziesii) in late June/early...

  14. Identification of In-Chain-Functionalized Compounds and Methyl-Branched Alkanes in Cuticular Waxes of Triticum aestivum cv. Bethlehem.

    Directory of Open Access Journals (Sweden)

    Radu C Racovita

    Full Text Available In this work, cuticular waxes from flag leaf blades and peduncles of Triticum aestivum cv. Bethlehem were investigated in search for novel wax compounds. Seven wax compound classes were detected that had previously not been reported, and their structures were elucidated using gas chromatography-mass spectrometry of various derivatives. Six of the classes were identified as series of homologs differing by two methylene units, while the seventh was a homologous series with homologs with single methylene unit differences. In the waxes of flag leaf blades, secondary alcohols (predominantly C27 and C33, primary/secondary diols (predominantly C28 and esters of primary/secondary diols (predominantly C50, combining C28 diol with C22 acid were found, all sharing similar secondary hydroxyl group positions at and around C-12 or ω-12. 7- and 8-hydroxy-2-alkanol esters (predominantly C35, 7- and 8-oxo-2-alkanol esters (predominantly C35, and 4-alkylbutan-4-olides (predominantly C28 were found both in flag leaf and peduncle wax mixtures. Finally, a series of even- and odd-numbered alkane homologs was identified in both leaf and peduncle waxes, with an internal methyl branch preferentially on C-11 and C-13 of homologs with even total carbon number and on C-12 of odd-numbered homologs. Biosynthetic pathways are suggested for all compounds, based on common structural features and matching chain length profiles with other wheat wax compound classes.

  15. Elasticity-based patterning of red blood cells on undulated lipid membranes supported on porous topographic substrates.

    Science.gov (United States)

    Lee, Sang-Wook; Jeong, Cherlhyun; Lee, Sin-Doo

    2009-03-26

    We describe elasticity-based patterning of human red blood cells (RBCs) into a microarray form on supported lipid membranes (SLMs) prepared on a solid substrate having two types of topographic patterns, porous and flat regions. The underlying concept is to precisely control the interplay between adhesion and the bending rigidity of the RBCs that interact with the SLMs. Attachment of the RBCs on highly undulated SLMs formed on the porous region is not energetically favorable, since membrane bending of the RBCs costs a high curvature elastic energy which exceeds adhesion. The RBCs are thus selectively confined within relatively flat regions of the SLMs without causing considerable elastic distortions. It was found that the population of the RBCs in a single corral is linearly proportional to the area of one element in our microarray.

  16. EPICUTICULAR WAX COMPOSITION OF SOME EUROPEAN SEDUM SPECIES

    NARCIS (Netherlands)

    STEVENS, JF; THART, H; BOLCK, A; ZWAVING, JH; MALINGRE, TM

    Epicuticular waxes from 30 species of Sedum and 2 species of Sempervivoideae, i.e. Aeonium spathulatum and Sempervivum nevadense, have been analysed by GC and GC-MS. The Sedum taxa examined were S. acre, S. album, S. series Alpestria (13 species), S. anglicum, S. brevifolium, S. litoreum, S. lydium,

  17. Screening of environmental contaminants in honey bee wax comb using gas chromatography-high-resolution time-of-flight mass spectrometry.

    Science.gov (United States)

    Gómez-Ramos, M M; García-Valcárcel, A I; Tadeo, J L; Fernández-Alba, A R; Hernando, M D

    2016-03-01

    This study reports an analytical approach intended to be used for investigation of non-targeted environmental contaminants and to characterize the organic pollution pattern of bee wax comb samples. The method comprises a generic extraction followed by detection with gas chromatography coupled to high-resolution time-of-flight mass spectrometry (GC-TOF-MS), operated in electron impact ionization (EI) mode. The screening approach for the investigation of non-targeted contaminants consisted of initial peak detection by deconvolution and matching the first-stage mass spectra EI-MS(1) with a nominal mass spectral library. To gain further confidence in the structural characterization of the contaminants under investigation, the molecular formula of representative ions (molecular ion when present in the EI spectrum) and, for at least other two fragment ions, was provided for those with an accurate mass scoring (mass error contaminants in 50 samples of bee wax comb. This approach has allowed the tentative identification of some GC-amenable contaminants belonging to different chemical groups, among them, phthalates and polycyclic aromatic hydrocarbons (PAHs), along with residues of veterinary treatments used in apiculture.

  18. Bee waxes: a model of characterization for using as base simulator tissue in teletherapy with photons

    International Nuclear Information System (INIS)

    Silva, Rogerio Matias Vidal da; Souza, Divanizia do Nascimento

    2011-01-01

    This paper presents a model of characterization and selection of bee waxes which makes possible to certify the usage viability of that base simulator tissue in the manufacture of appropriated objects for external radiotherapy with mega volt photon beams. The work was divide into three stages, where was evaluated physical and chemical properties besides the aspects related to the capacity of beam attenuation. All the process was carefully accompanied related to the wax origin such as the bee specimen and the flora surrounding the beehives. The chemical composition of the waxes is similar to others simulators usually used in radiotherapy. The behavior of mass attenuation coefficient in the radiotherapeutic energy range is comparable to other simulators, and consequently to the soft tissue. The proposed model is efficient and allows the affirmative that the usage of determined bee wax as base simulator tissue is convenient

  19. Particulate pollutants are capable to ‘degrade’ epicuticular waxes and to decrease the drought tolerance of Scots pine (Pinus sylvestris L.)

    International Nuclear Information System (INIS)

    Burkhardt, Juergen; Pariyar, Shyam

    2014-01-01

    Air pollution causes the amorphous appearance of epicuticular waxes in conifers, usually called wax ‘degradation’ or ‘erosion’, which is often correlated with tree damage symptoms, e.g., winter desiccation. Previous investigations concentrated on wax chemistry, with little success. Here, we address the hypothesis that both ‘wax degradation’ and decreasing drought tolerance of trees may result from physical factors following the deposition of salt particles onto the needles. Pine seedlings were sprayed with dry aerosols or 50 mM solutions of different salts. The needles underwent humidity changes within an environmental scanning electron microscope, causing salt expansion on the surface and into the epistomatal chambers. The development of amorphous wax appearance by deliquescent salts covering tubular wax fibrils was demonstrated. The minimum epidermal conductance of the sprayed pine seedlings increased. Aerosol deposition potentially ‘degrades’ waxes and decreases tree drought tolerance. These effects have not been adequately considered thus far in air pollution research. Highlights: • Demonstrated capability of particles to produce ‘wax degradation’. • Dynamics of particles on pine needles, shown by videos. • Salt particles sprayed on pine needles increased minimum epidermal conductance g min . • Results strongly suggest direct link between air pollution and drought tolerance. • Linkage between different types of forest decline is suggested. -- ‘Wax degradation’ on pine needles and increased minimum epidermal conductance (i.e. uncontrollable water loss) were created by particles, suggesting a link between air pollution and tree drought tolerance

  20. Biochemical characterization and substrate specificity of jojoba fatty acyl-CoA reductase and jojoba wax synthase.

    Science.gov (United States)

    Miklaszewska, Magdalena; Banaś, Antoni

    2016-08-01

    Wax esters are used in industry for production of lubricants, pharmaceuticals and cosmetics. The only natural source of wax esters is jojoba oil. A much wider variety of industrial wax esters-containing oils can be generated through genetic engineering. Biotechnological production of tailor-made wax esters requires, however, a detailed substrate specificity of fatty acyl-CoA reductases (FAR) and wax synthases (WS), the two enzymes involved in wax esters synthesis. In this study we have successfully characterized the substrate specificity of jojoba FAR and jojoba WS. The genes encoding both enzymes were expressed heterologously in Saccharomyces cerevisiae and the activity of tested enzymes was confirmed by in vivo studies and in vitro assays using microsomal preparations from transgenic yeast. Jojoba FAR exhibited the highest in vitro activity toward 18:0-CoA followed by 20:1-CoA and 22:1-CoA. The activity toward other 11 tested acyl-CoAs was low or undetectable as with 18:2-CoA and 18:3-CoA. In assays characterizing jojoba WS combinations of 17 fatty alcohols with 14 acyl-CoAs were tested. The enzyme displayed the highest activity toward 14:0-CoA and 16:0-CoA in combination with C16-C20 alcohols as well as toward C18 acyl-CoAs in combination with C12-C16 alcohols. 20:1-CoA was efficiently utilized in combination with most of the tested alcohols. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  1. Review of data on the dermal penetration of mineral oils and waxes used in cosmetic applications.

    Science.gov (United States)

    Petry, T; Bury, D; Fautz, R; Hauser, M; Huber, B; Markowetz, A; Mishra, S; Rettinger, K; Schuh, W; Teichert, T

    2017-10-05

    Mineral oils and waxes used in cosmetic products, also referred to as "personal care products" outside the European Union, are mixtures of predominantly saturated hydrocarbons consisting of straight-chain, branched and ring structures with carbon chain lengths greater than C16. They are used in skin and lip care cosmetic products due to their excellent skin tolerance as well as their high protecting and cleansing performance and broad viscosity options. Recently, concerns have been raised regarding potential adverse health effects of mineral oils and waxes from dermal application of cosmetics. In order to be able to assess the risk for the consumer the dermal penetration potential of these ingredients has to be evaluated. The scope and objective of this review are to identify and summarize publicly available literature on the dermal penetration of mineral oils and waxes as used in cosmetic products. For this purpose, a comprehensive literature search was conducted. A total of 13 in vivo (human, animal) and in vitro studies investigating the dermal penetration of mineral oils and waxes has been identified and analysed. The majority of the substances were dermally adsorbed to the stratum corneum and only a minor fraction reached deeper skin layers. Overall, there is no evidence from the various studies that mineral oils and waxes are percutaneously absorbed and become systemically available. Thus, given the absence of dermal uptake, mineral oils and waxes as used in cosmetic products do not present a risk to the health of the consumer. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  2. Variations of Leaf Cuticular Waxes Among C3 and C4 Gramineae Herbs.

    Science.gov (United States)

    He, Yuji; Gao, Jianhua; Guo, Na; Guo, Yanjun

    2016-11-01

    Modern C4 plants are commonly distributed in hot and dry environments whereas C3 plants predominate in cool and shade areas. At the outmost of plant surface, the deposition and chemical composition of cuticular waxes vary under different environmental conditions. However, whether such variation of cuticular wax is related to the distribution of C3 and C4 under different environmental conditions is still not clear. In this study, leaves of six C3 Gramineae herbs distributed in spring, Roegneria kamoji, Polypogon fugax, Poa annua, Avena fatua, Alopecurus aequalis, and Oplismenus undulatifolius, and four C4 and one C3 Gramineae herbs distributed in summer, Digitaria sanguinalis, Eleusine indica, Setaria viridis, S. plicata, and O. undulatifolius, were sampled and analyzed for cuticular wax. Plates were the main epicuticular wax morphology in both C3 and C4 plants except S. plicata. The plates melted in C4 plants but not in C3 plants. The total cuticular wax amounts in C4 plants were significantly lower than those in C3 plants, except for O. undulatifolius. Primary alcohols were the most abundant compounds in C3 plants, whereas n-alkanes were relatively the most abundant compounds in C4 plants. C 29 was the most abundant n-alkane in C3 plants except for O. undulatifolius, whereas the most abundant n-alkane was C 31 or C 33 in C4 plants. The average chain length (ACL) of n-alkanes was higher in C4 than in C3 plants, whereas the ACL of n-alkanoic acids was higher in C3 than C4 plants. The cluster analysis based on the distribution of n-alkanes clearly distinguished C3 and C4 plants into two groups, except for O. undulatifolius which was grouped with C4 plants. These results suggest that the variations of cuticular waxes among C3 and C4 Gramineae herbs are related to the distribution of C3 and C4 plants under different environmental conditions. © 2016 Wiley-VHCA AG, Zurich, Switzerland.

  3. Effects of ozone exposures on epicuticular wax of ponderosa pine needles

    International Nuclear Information System (INIS)

    Bytnerowicz, A.; Turunen, M.

    1994-01-01

    Two-year-old ponderosa pine (Pinus ponderosa L.) seedlings were exposed during the 1989 and 1990 growing seasons to ozone in open-top chambers placed in a forested location at Shirley Meadow, Greenhorn Mountain Range, Sierra Nevada. The ozone treatments were as follows: charcoal-filtered air (CF); charcoal-filtered air with addition of ambient concentrations of ozone (CF + O 3 ); and charcoal-filtered air with addition of doubled concentrations of ozone (CF + 2 x O 3 ). Ozone effects on ponderosa pine seedlings progressed and accumulated over two seasons of exposure. Throughout the first season, increased visible injury and accelerated senescence of the foliage were noted. Subsequently, during the second season of ozone exposure, various physiological and biochemical changes in the foliage took place. All these changes led to reduced growth and biomass of the seedlings. Epistomatal waxes of needles from the CA + 2 x O 3 treatment had an occluded appearance. This phenomenon may be caused by earlier phenological development of needles from the high-ozone treatments and disturbed development and synthesis of waxes. It may also be caused by chemical degradation of waxes by exposures to high ozone concentrations. (orig.)

  4. Cuticular membrane of Fuyu persimmon fruit is strengthened by triterpenoid nano-fillers.

    Directory of Open Access Journals (Sweden)

    Shuntaro Tsubaki

    Full Text Available The mechanical defensive performance of fruit cuticular membranes (CMs is largely dependent on the molecular arrangement of their constituents. Here, we elucidated nano-sized interactions between cutin and triterpenoids in the cuticular matrix of Fuyu persimmon fruits (Diospyroskaki Thunb. cv. Fuyu, focusing on the mechanical properties using a combination of polymer analyses. The fruit CMs of Fuyu were primarily composed of wax (34.7%, which was predominantly triterpenoids followed by higher aliphatic compounds, and cutin (48.4%, primarily consisting of 9,10-epoxy-18-hydroxyoctadecanoic acid and 9,10,18-trihydroxyoctadecanoic acid. Based on the tensile tests of the CM, the removal of wax lead to a considerable decrease in the maximum stress and elastic modulus accompanied by an increase in the maximum strain, indicating that wax is of significant importance for maintaining the mechanical strength of the CM. Wide-angle X-ray diffraction and relaxation time measurements using solid-state (13C nuclear magnetic resonance indicated that the triterpenoids in the cuticular matrix construct a nanocomposite at a mixing scale below 20-24 nm; however, the higher aliphatic compounds did not exhibit clear interactions with cutin. The results indicated that the triterpenoids in the cuticular matrix endow toughness to the CM by functioning as a nanofiller.

  5. Molecular and Biochemical Characterization of Cotton Epicuticular Wax in Defense Against Cotton Leaf Curl Disease.

    Science.gov (United States)

    Khan, Muhammad Azmat Ullah; Shahid, Ahmad Ali; Rao, Abdul Qayyum; Bajwa, Kamran Shehzad; Samiullah, Tahir Rehman; Muzaffar, Adnan; Nasir, Idrees Ahmad; Husnain, Tayyab

    2015-12-01

    Gossypium arboreumis resistant to Cotton leaf curl Burewala virus and its cognate Cotton leaf curl Multan beta satellite ( CLCuBuV and CLCuMB ). However, the G. arboreum wax deficient mutant (GaWM3) is susceptible to CLCuV . Therefore, epicuticular wax was characterized both quantitatively and qualitatively for its role as physical barrier against whitefly mediated viral transmission and co-related with the titer of each viral component (DNA-A, alphasatellite and betasatellite) in plants. The hypothesis was the CLCuV titer in cotton is dependent on the amount of wax laid down on plant surface and the wax composition. Analysis of the presence of viral genes, namely alphasatellite, betasatellite and DNA-A, via real-time PCR in cotton species indicated that these genes are detectable in G. hirsutum , G. harknessii and GaWM3, whereas no particle was detected in G. arboreum . Quantitative wax analysis revealed that G. arboreum contained 183 μg.cm -2 as compared to GaWM3 with only 95 μg.cm -2 . G. hirsutum and G. harknessii had 130 μg.cm -2 and 146 μg.cm -2 , respectively. The GCMS results depicted that Lanceol, cis was 45% in G. harknessii . Heptadecanoic acid was dominant in G. arboreum with 25.6%. GaWM3 had 18% 1,2,-Benenedicarboxylic acid. G. hirsutum contained 25% diisooctyl ester. The whitefly feeding assay with Nile Blue dye showed no color in whiteflies gut fed on G. arboreum . In contrast, color was observed in the rest of whiteflies. From results, it was concluded that reduced quantity as well as absence of (1) 3-trifluoroacetoxytetradecane, (2) 2-piperidinone,n-|4-bromo-n-butyl|, (3) 4-heptafluorobutyroxypentadecane, (4) Silane, trichlorodocosyl-, (5) 6- Octadecenoic acid, methyl ester, and (6) Heptadecanoicacid,16-methyl-,methyl ester in wax could make plants susceptible to CLCuV , infested by whiteflies.

  6. The effects of surgicel and bone wax hemostatic agents on bone healing: An experimental study

    Directory of Open Access Journals (Sweden)

    Nasser Nooh

    2014-01-01

    Full Text Available Background: The biological effects of hemostatic agends on the physiological healing process need to be tested. The aim of this study was to assess the effects of oxidized cellulose (surgicel and bone wax on bone healing in goats′ feet. Materials and Methods: Three congruent circular bone defects were created on the lateral aspects of the right and left metacarpal bones of ten goats. One defect was left unfilled and acted as a control; the remaining two defects were filled with bone wax and surgicel respectively. The 10 animals were divided into two groups of 5 animals each, to be sacrificed at the 3rd and 5th week postoperatively. Histological analysis assessing quality of bone formed and micro-computed tomography (MCT measuring the quantities of bone volume (BV and bone density (BD were performed. The results of MCT analysis pertaining to BV and BD were statistically analyzed using two-way analysis of variance (ANOVA and posthoc least significant difference tests. Results: Histological analysis at 3 weeks showed granulation tissue with new bone formation in the control defects, active bone formation only at the borders for surgicel filled defects and fibrous encapsulation with foreign body reaction in the bone wax filled defects. At 5 weeks, the control and surgicel filled defects showed greater bone formation; however the control defects had the greatest amount of new bone. Bone wax filled defects showed very little bone formation. The two-way ANOVA for MCT results showed significant differences for BV and BD between the different hemostatic agents during the two examination periods. Conclusion: Surgicel has superiority over bone wax in terms of osseous healing. Bone wax significantly hinders osteogenesis and induces inflammation.

  7. Rapid atmospheric transport and large-scale deposition of recently synthesized plant waxes

    Science.gov (United States)

    Nelson, Daniel B.; Ladd, S. Nemiah; Schubert, Carsten J.; Kahmen, Ansgar

    2018-02-01

    Sedimentary plant wax 2H/1H ratios are important tools for understanding hydroclimate and environmental changes, but large spatial and temporal uncertainties exist about transport mechanisms from ecosystem to sediments. To assess atmospheric pathways, we collected aerosol samples for two years at four locations within a ∼60 km radius in northern Switzerland. We measured n-alkane distributions and 2H/1H ratios in these samples, and from local plants, leaf litter, and soil, as well as surface sediment from six nearby lakes. Increased concentrations and 2H depletion of long odd chain n-alkanes in early summer aerosols indicate that most wax aerosol production occurred shortly after leaf unfolding, when plants synthesize waxes in large quantities. During autumn and winter, aerosols were characterized by degraded n-alkanes lacking chain length preferences diagnostic of recent biosynthesis, and 2H/1H values that were in some cases more than 100‰ higher than growing season values. Despite these seasonal shifts, modeled deposition-weighted average 2H/1H values of long odd chain n-alkanes primarily reflected summer values. This was corroborated by n-alkane 2H/1H values in lake sediments, which were similar to deposition-weighted aerosol values at five of six sites. Atmospheric deposition rates for plant n-alkanes on land were ∼20% of accumulation rates in lakes, suggesting a role for direct deposition to lakes or coastal oceans near similar production sources, and likely a larger role for deposition on land and transport in river systems. This mechanism allows mobilization and transport of large quantities of recently produced waxes as fine-grained material to low energy sedimentation sites over short timescales, even in areas with limited topography. Widespread atmospheric transfer well before leaf senescence also highlights the importance of the isotopic composition of early season source water used to synthesize waxes for the geologic record.

  8. Thermal characterizations of the paraffin wax/low density polyethylene blends as a solid fuel

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Soojong; Moon, Heejang; Kim, Jinkon, E-mail: jkkim@kau.ac.kr

    2015-08-10

    Highlights: • Regression rate of blends fuel is higher than polymer fuel. • LDPE is an effective mixing ingredient for the combustion efficiency. • Blends fuel is a uniform mixture with two degradation steps. • LDPE plays a positive role for the low sensitivity to the thermal deformation • Blends with low LDPE content can be an effective fuel for hybrid rocket application. - Abstract: Thermal characterizations of a novel solid fuel for hybrid rocket application, based on the paraffin wax blends with low density polyethylene (LDPE) concentration of 5% (SF-5) and 10% (SF-10) were conducted. Both the increased regression rate in comparison with the polymeric fuel, and the improved combustion efficiency in comparison with the pure paraffin fuel reveal that the blend fuels achieve higher combustion performance. The morphology of the shape stabilized paraffin wax/LDPE blends was characterized by the scanning electron microscopy (SEM). Although the SEM observation indicated the blends have uniform mixtures, they showed two degradation steps confirming the immiscibility of components in the crystalline phase from thermogravimetric analysis (TGA). The differential scanning calorimeter (DSC) results showed that the melting temperature of LDPE in the blends decreased with an increase of paraffin wax content. The decreasing total specific melting enthalpy of blended fuels with decreasing paraffin wax content is in fairly good agreement with the additive rule. In thermomechanical analysis (TMA), the linear coefficient of thermal expansion (LCTE) seems to decrease with an increase of LDPE loading, however, the loaded LDPE do merely affect the LCTE in case of the blends with low LDPE concentration. It was found that a blend of low concentration of LDPE with a relatively high concentration of paraffin wax can lead to a potential novel fuel for rocket application, a contrary case with respect to the field of phase change materials (PCM) where a blend of high concentration

  9. Thermal characterizations of the paraffin wax/low density polyethylene blends as a solid fuel

    International Nuclear Information System (INIS)

    Kim, Soojong; Moon, Heejang; Kim, Jinkon

    2015-01-01

    Highlights: • Regression rate of blends fuel is higher than polymer fuel. • LDPE is an effective mixing ingredient for the combustion efficiency. • Blends fuel is a uniform mixture with two degradation steps. • LDPE plays a positive role for the low sensitivity to the thermal deformation • Blends with low LDPE content can be an effective fuel for hybrid rocket application. - Abstract: Thermal characterizations of a novel solid fuel for hybrid rocket application, based on the paraffin wax blends with low density polyethylene (LDPE) concentration of 5% (SF-5) and 10% (SF-10) were conducted. Both the increased regression rate in comparison with the polymeric fuel, and the improved combustion efficiency in comparison with the pure paraffin fuel reveal that the blend fuels achieve higher combustion performance. The morphology of the shape stabilized paraffin wax/LDPE blends was characterized by the scanning electron microscopy (SEM). Although the SEM observation indicated the blends have uniform mixtures, they showed two degradation steps confirming the immiscibility of components in the crystalline phase from thermogravimetric analysis (TGA). The differential scanning calorimeter (DSC) results showed that the melting temperature of LDPE in the blends decreased with an increase of paraffin wax content. The decreasing total specific melting enthalpy of blended fuels with decreasing paraffin wax content is in fairly good agreement with the additive rule. In thermomechanical analysis (TMA), the linear coefficient of thermal expansion (LCTE) seems to decrease with an increase of LDPE loading, however, the loaded LDPE do merely affect the LCTE in case of the blends with low LDPE concentration. It was found that a blend of low concentration of LDPE with a relatively high concentration of paraffin wax can lead to a potential novel fuel for rocket application, a contrary case with respect to the field of phase change materials (PCM) where a blend of high concentration

  10. The Preparation and Performances of Self-Dispersed Nanomicron Emulsified Wax Solid Lubricant Ewax for Drilling Fluids

    Directory of Open Access Journals (Sweden)

    Feng-shan Zhou

    2014-01-01

    Full Text Available An oil-in-water nanomicron wax emulsion with oil phase content 45 wt% was prepared by using the emulsifying method of surfactant-in-oil. The optimum prepared condition is 85°C, 20 min, and 5 wt% complex emulsifiers. Then the abovementioned nanomicron emulsifying wax was immersed into a special water-soluble polymer in a certain percentage by the semidry technology. At last, a solidified self-dispersed nanomicron emulsified wax named as Ewax, a kind of solid lubricant for water based drilling fluid, was obtained after dried in the special soluble polymer containing emulsifying wax in low temperature. It is shown that the adhesion coefficient reduced rate (ΔKf is 73.5% and the extreme pressure (E-P friction coefficient reduced rate (Δf is 77.6% when the produced Ewax sample was added to fresh water based drilling fluid at dosage 1.0 wt%. In comparison with other normal similar liquid products, Ewax not only has better performances of lubrication, filtration loss control property, heat resistance, and tolerance to salt and is environmentally friendly, but also can solve the problems of freezing in the winter and poor storage stability of liquid wax emulsion in oilfield applications.

  11. Neutral Lipid Biosynthesis in Engineered Escherichia coli: Jojoba Oil-Like Wax Esters and Fatty Acid Butyl Esters

    OpenAIRE

    Kalscheuer, Rainer; Stöveken, Tim; Luftmann, Heinrich; Malkus, Ursula; Reichelt, Rudolf; Steinbüchel, Alexander

    2006-01-01

    Wax esters are esters of long-chain fatty acids and long-chain fatty alcohols which are of considerable commercial importance and are produced on a scale of 3 million tons per year. The oil from the jojoba plant (Simmondsia chinensis) is the main biological source of wax esters. Although it has a multitude of potential applications, the use of jojoba oil is restricted, due to its high price. In this study, we describe the establishment of heterologous wax ester biosynthesis in a recombinant E...

  12. Design and evaluation of a heat exchanger that uses paraffin wax and recycled materials as solar energy accumulator

    International Nuclear Information System (INIS)

    Reyes, Alejandro; Negrete, Daniela; Mahn, Andrea; Sepúlveda, Francisco

    2014-01-01

    Highlights: • Thermal conductivity of paraffin wax was improved with aluminum wool. • Aluminum wool surrounding the cans favored the energy recuperation from the wax. • The heat exchanger accumulated 3000 kJ energy. • The accumulated energy can be easily increased with larger units. • COMSOL simulated adequately the energy removal process from the cans. - Abstract: Soft drink cans filled with paraffin wax mixed with 5% w/w aluminum wool, obtained from disposable cans, doubled the thermal conductivity of cans filled only with paraffin wax. Thermal conductivity of the systems was determined by two ways: directly using a thermal conductivimeter, and indirectly based on temperature profiles and on the analytical solution of a cylinder. We designed, built and evaluated a heat exchanger for solar energy accumulation, composed by 48 disposable soft drink cans filled with a total of 9.5 kg of paraffin wax mixed with 5% w/w aluminum wool. In sunny days, the wax melted completely in 3 h. The accumulated energy of 3000 kJ, allowed increasing the temperature of 3.5 m 3 /h air flow rate from 20 to 40 °C during a period of 2 h. This application will allow extending the use of solar energy in drying processes or could be used as household calefaction system. The progress of the phase change front in time during the energy discharge period was simulated with COMSOL, whereas the effect of the number of cans and thermal conductivity of the paraffin wax on the air temperature increase was simulated with MATLAB

  13. Characterization and expression patterns of a membrane-bound trehalase from Spodoptera exigua

    Directory of Open Access Journals (Sweden)

    Xu Weihua

    2008-05-01

    Full Text Available Abstract Background The chitin biosynthesis pathway starts with trehalose in insects and the main functions of trehalases are hydrolysis of trehalose to glucose. Although insects possess two types, soluble trehalase (Tre-1 and membrane-bound trehalase (Tre-2, very little is known about Tre-2 and the difference in function between Tre-1 and Tre-2. Results To gain an insight into trehalase functions in insects, we investigated a putative membrane-bound trehalase from Spodoptera exigua (SeTre-2 cloned from the fat body. The deduced amino acid sequence of SeTre-2 contains 645 residues and has a predicted molecular weight of ~74 kDa and pI of 6.01. Alignment of SeTre-2 with other insect trehalases showed that it contains two trehalase signature motifs and a putative transmembrane domain, which is an important characteristic of Tre-2. Comparison of the genomic DNA and cDNA sequences demonstrated that SeTre-2 comprises 13 exons and 12 introns. Southern blot analysis revealed that S. exigua has two trehalase genes and that SeTre-2 is a single-copy gene. Northern blot analyses showed that the SeTre-2 transcript is expressed not only in the midgut, as previously reported for Bombyx mori, but also in the fat body and Malpighian tubules, although expression patterns differed between the midgut and fat body. SeTre-2 transcripts were detected in the midgut of feeding stage larvae, but not in pupae, whereas SeTre-2 mRNA was detected in the fat body of fifth instar larvae and pupae. Conclusion These findings provide new data on the tissue distribution, expression patterns and potential function of membrane-bound trehalase. The results suggest that the SeTre-2 gene may have different functions in the midgut and fat body.

  14. Antinuclear antibodies giving the 'multiple nuclear dots' or the 'rim-like/membranous' patterns: diagnostic accuracy for primary biliary cirrhosis.

    Science.gov (United States)

    Granito, A; Muratori, P; Muratori, L; Pappas, G; Cassani, F; Worthington, J; Guidi, M; Ferri, S; DE Molo, C; Lenzi, M; Chapman, R W; Bianchi, F B

    2006-12-01

    Serum antinuclear antibodies giving the 'multiple nuclear dots' or the 'rim-like/membranous' patterns are frequently detected by indirect immunofluorescence on HEp-2 cells in patients with primary biliary cirrhosis. To assess the accuracy of multiple nuclear dot and rim-like/membranous antinuclear antibodies for the diagnosis of primary biliary cirrhosis. Sera from 4371 consecutive patients referred to our laboratory were analysed under code for antinuclear antibodies testing by indirect immunofluorescence on HEp-2 cells. Review of the clinical records of the 4371 patients allowed identification of 101 patients with antimitochondrial antibody-positive primary biliary cirrhosis and 22 with antimitochondrial antibody-negative variant. Multiple nuclear dot and/or rim-like/membranous patterns were found in 59 (1.3%) of the 4371 patients: 31 antimitochondrial antibody-positive primary biliary cirrhosis, 17 antimitochondrial antibody-negative primary biliary cirrhosis and 11 non-primary biliary cirrhosis. The specificity for primary biliary cirrhosis of both the antinuclear antibodies pattern was 99%. Positive predictive value and likelihood ratio for a positive test were 86% (95% CI: 72.7-94) and 221 (95% CI: 91.7-544) for multiple nuclear dot, 79% (95% CI: 62.2-90.1) and 132 (95% CI: 56.8-312.7) for rim-like/membranous, respectively. Multiple nuclear dot and rim-like/membranous antinuclear antibodies are rare findings. Their positivity strongly suggests the diagnosis of primary biliary cirrhosis, irrespective of antimitochondrial antibody status. The high specificity for primary biliary cirrhosis makes them a useful diagnostic tool especially in antimitochondrial antibody-negative patients.

  15. New hybrid nanofluid containing encapsulated paraffin wax and sand nanoparticles in propylene glycol-water mixture: Potential heat transfer fluid for energy management

    International Nuclear Information System (INIS)

    Manikandan, S.; Rajan, K.S.

    2017-01-01

    Highlights: • Hybrid nanofluid containing sand nanoparticles & encapsulated paraffin wax prepared. • Specific heat of hybrid nanofluid 9% greater than that of PG-water mixture. • Specific heat & thermal conductivity enhanced at optimum paraffin wax concentration. • Hybrid nanofluid with 1 wt.% paraffin wax & 1 vol% sand nanoparticles best suited. - Abstract: The reduction in specific heat commonly encountered due to the addition of nanoparticles to a heat transfer fluid such as propylene glycol-water mixture, can be overcome by co-dispersing surfactant-encapsulated paraffin wax, leading to formation of a hybrid nanofluid. Experimental investigations have been carried out on the preparation and evaluation of thermophysical properties of a hybrid nanofluid containing pluronic P-123 encapsulated paraffin wax (70–120 nm diameter, 1–5 wt.%) and sand nanoparticles (1 vol%) in propylene glycol-water mixture. The comparison of results of differential scanning calorimetry of pure paraffin wax and encapsulated paraffin wax revealed encapsulation efficiency of 84.4%. The specific heat of hybrid nanofluids monotonously increased with paraffin wax concentration, with 9.1% enhancement in specific heat for hybrid nanofluid containing 5 wt.% paraffin wax, in comparison to propylene glycol-water mixture. There exists an optimum paraffin wax concentration (1 wt.%) for the hybrid nanofluid at which the combination of various thermophysical properties such as specific heat, thermal conductivity and viscosity are favorable for use as heat transfer fluid. Such a hybrid nanofluid can be used as a substitute for propylene glycol-water mixture in solar thermal systems.

  16. Thermodynamics Prediction of Wax Precipitation in Black Oil Using Regular Solution Model and Plus Fraction Characterization

    Directory of Open Access Journals (Sweden)

    Wei Wang

    2013-01-01

    Full Text Available The precipitation of wax/solid paraffin during production, transportation, and processing of crude oil is a serious problem. It is essential to have a reliable model to predict the wax appearance temperature and the amount of solid precipitated at different conditions. This paper presents a work to predict the solid precipitation based on solid-liquid equilibrium with regular solution-molecular thermodynamic theory and characterization of the crude oil plus fraction. Due to the differences of solubility characteristics between solid and liquid phase, the solubility parameters of liquid and solid phase are calculated by a modified model. The heat capacity change between solid and liquid phase is considered and estimated in the thermodynamic model. An activity coefficient based thermodynamic method combined with two characteristic methods to calculate wax precipitation in crude oil, especially heavy oil, has been tested with experimental data. The results show that the wax appearance temperature and the amount of weight precipitated can be predicted well with the experimental data.

  17. The moss Funaria hygrometrica has cuticular wax similar to vascular plants, with distinct composition on leafy gametophyte, calyptra and sporophyte capsule surfaces.

    Science.gov (United States)

    Busta, Lucas; Budke, Jessica M; Jetter, Reinhard

    2016-09-01

    Aerial surfaces of land plants are covered with a waxy cuticle to protect against water loss. The amount and composition of cuticular waxes on moss surfaces had rarely been investigated. Accordingly, the degree of similarity between moss and vascular plant waxes, and between maternal and offspring moss structure waxes is unknown. To resolve these issues, this study aimed at providing a comprehensive analysis of the waxes on the leafy gametophyte, gametophyte calyptra and sporophyte capsule of the moss Funaria hygrometrica Waxes were extracted from the surfaces of leafy gametophytes, gametophyte calyptrae and sporophyte capsules, separated by gas chromatography, identified qualitatively with mass spectrometry, and quantified with flame ionization detection. Diagnostic mass spectral peaks were used to determine the isomer composition of wax esters. The surfaces of the leafy gametophyte, calyptra and sporophyte capsule of F. hygrometrica were covered with 0·94, 2·0 and 0·44 μg cm(-2) wax, respectively. While each wax mixture was composed of mainly fatty acid alkyl esters, the waxes from maternal and offspring structures had unique compositional markers. β-Hydroxy fatty acid alkyl esters were limited to the leafy gametophyte and calyptra, while alkanes, aldehydes and diol esters were restricted to the sporophyte capsule. Ubiquitous fatty acids, alcohols, fatty acid alkyl esters, aldehydes and alkanes were all found on at least one surface. This is the first study to determine wax coverage (μg cm(-2)) on a moss surface, enabling direct comparisons with vascular plants, which were shown to have an equal amount or more wax than F. hygrometrica Wax ester biosynthesis is of particular importance in this species, and the ester-forming enzyme(s) in different parts of the moss may have different substrate preferences. Furthermore, the alkane-forming wax biosynthesis pathway, found widely in vascular plants, is active in the sporophyte capsule, but not in the leafy

  18. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  19. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  20. Antimicrobial susceptibility pattern of genital Mycoplasmas among a ...

    African Journals Online (AJOL)

    Safaa M. Abdel Rahman

    2016-02-17

    Feb 17, 2016 ... Peer review under responsibility of Alexandria University Faculty of Medicine. Alexandria Journal of ... This is an open access article under the CC BY-NC-ND license ... to pregnant women with preterm rupture of the membranes. (PROM) ... mitted pathogens M. hominis and U. urealyticum among a group of ...

  1. Molecular analysis of intact preen waxes of Calidris canutus (Aves : Scolopacidae) by gas chromatography/mass spectrometry

    NARCIS (Netherlands)

    Dekker, MHA; Piersma, T; Damste, JSS; Dekker, Marlèn H.A.; Sinninghe Damsté, Jaap S.

    The intact preen wax esters of the red knot Calidris canutus were studied with gas chromatography/mass spectrometry (GC/MS) and GC/MS/MS. In this latter technique, transitions from the molecular ion to fragment ions representing the fatty acid moiety of the wax esters were measured, providing

  2. A new experimental method to prevent paraffin - wax formation on the crude oil wells: A field case study in Libya

    Directory of Open Access Journals (Sweden)

    Elhaddad Elnori E.

    2015-01-01

    Full Text Available Wax formation and deposition is one of the most common problems in oil producing wells. This problem occurs as a result of the reduction of the produced fluid temperature below the wax appearance temperature (range between 46°C and 50°C and the pour point temperature (range between 42°C and 44°C. In this study, two new methods for preventing wax formation were implemented on three oil wells in Libya, where the surface temperature is, normally, 29°C. In the first method, the gas was injected at a pressure of 83.3 bar and a temperature of 65°C (greater than the pour point temperature during the gas-lift operation. In the second method, wax inhibitors (Trichloroethylene-xylene (TEX, Ethylene copolymers, and Comb polymers were injected down the casings together with the gas. Field observations confirmed that by applying these techniques, the production string was kept clean and no wax was formed. The obtained results show that the wax formation could be prevented by both methods.

  3. Effect of gamma radiation and entomopathogenic nematodes on greater wax moth, Galleria mellonella (Linnaeus) [Lep., Pyralidae

    International Nuclear Information System (INIS)

    Ali, R.M.S.

    2008-01-01

    The greater wax moth, Galleria mellonella (L.), is a lepidoptera insect; its larval stage, feeds on wax and pollen stored in combs of active honey bee colonies (Milam, 1970). It does not attack adult bees but destructs combs of a weak colony by chewing the comb; spinning silk-lined tunnels through the cell wall and over the face of the comb, which prevent the bees to emerge by their abdomen from their cell, so they die by starvation as they unable to escape from their cell. They also eat out a place to spin their cocoons in the soft wood of the bee hive. Galleria mellonella can also destroy stored honey combs. Therefore, it is considered a major pest of the honeybee. Damage will vary with the level of infestation and the time that has elapsed since the infestation first began. In time, stored combs may be completely destroyed and the frames and combs become filled with a mass of tough, silky web. In ideal conditions for wax moth development, a box (super) of combs may be rendered useless in about a week. Damage occurs mainly in the warm and hot months of the year when wax moths are most active. However, considerable damage can still occur during the cool part of late autumn and early spring as greater wax moth can produce a large amount of metabolic heat which can raise the immediate temperature around them by up to 25 degree C above the normal environment temperature. At the time of storage, combs that are apparently free of wax moth may contain eggs that will hatch later. They should be monitored

  4. Preparing paraffin wax, etc

    Energy Technology Data Exchange (ETDEWEB)

    1935-12-27

    A process is described for preparing paraffin wax by separation from substances containing bitumen, consisting of treating the raw material at an elevated temperature under such moderate conditions and by means of such organic solvents that the bitumen present in the raw material or formed in the process dissolves as well as the asphaltic and phenolic substances and the humic acids which may be said to be neither extracts nor decomposed materials, and then submitting the products and extracts to a treatment with hydrogen gas, which is effected below 300/sup 0/C, and passing the material over fixed hydrogenation catalysts above 300/sup 0/C by means of hydrogenation catalysts finely dispersed in carbonaceous materials all avoiding decomposition with the formation of volatile products.

  5. The effects of magnetic fields on carnauba wax electret formation

    Science.gov (United States)

    Clator, Irvin G.

    1987-08-01

    The results of thermally stimulated depolarization current and effective surface charge-density measurements indicate that magnetic fields do not produce carnauba wax electrets and that previously reported data can be attributed to nonmagnetic effects.

  6. Expression of bovine non-classical major histocompatibility complex class I proteins in mouse P815 and human K562 cells.

    Science.gov (United States)

    Parasar, Parveen; Wilhelm, Amanda; Rutigliano, Heloisa M; Thomas, Aaron J; Teng, Lihong; Shi, Bi; Davis, William C; Suarez, Carlos E; New, Daniel D; White, Kenneth L; Davies, Christopher J

    2016-08-01

    Major histocompatibility complex class I (MHC-I) proteins can be expressed as cell surface or secreted proteins. To investigate whether bovine non-classical MHC-I proteins are expressed as cell surface or secreted proteins, and to assess the reactivity pattern of monoclonal antibodies with non-classical MHC-I isoforms, we expressed the MHC proteins in murine P815 and human K562 (MHC-I deficient) cells. Following antibiotic selection, stably transfected cell lines were stained with H1A or W6/32 antibodies to detect expression of the MHC-I proteins by flow cytometry. Two non-classical proteins (BoLA-NC1*00501 and BoLA-NC3*00101) were expressed on the cell surface in both cell lines. Surprisingly, the BoLA-NC4*00201 protein was expressed on the cell membrane of human K562 but not mouse P815 cells. Two non-classical proteins (BoLA-NC1*00401, which lacks a transmembrane domain, and BoLA-NC2*00102) did not exhibit cell surface expression. Nevertheless, Western blot analyses demonstrated expression of the MHC-I heavy chain in all transfected cell lines. Ammonium-sulfate precipitation of proteins from culture supernatants showed that BoLA-NC1*00401 was secreted and that all surface expressed proteins where shed from the cell membrane by the transfected cells. Interestingly, the surface expressed MHC-I proteins were present in culture supernatants at a much higher concentration than BoLA-NC1*00401. This comprehensive study shows that bovine non-classical MHC-I proteins BoLA-NC1*00501, BoLA-NC3*00101, and BoLA-NC4*00201 are expressed as surface isoforms with the latter reaching the cell membrane only in K562 cells. Furthermore, it demonstrated that BoLA-NC1*00401 is a secreted isoform and that significant quantities of membrane associated MHC-I proteins can be shed from the cell membrane. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Synchrotron WAXS and XANES studies of silica (SiO2) powders synthesized from Indonesian natural sands

    International Nuclear Information System (INIS)

    Muchlis, Khairanissa; Fauziyah, Nur Aini; Pratapa, Suminar; Soontaranon, Siriwat; Limpirat, Wanwisa

    2017-01-01

    In this study, we have investigated polymorphic silica (SiO 2 ) powders using, Wide Angle X-ray Scattering (WAXS) and X-Ray Absorption Near Edge Spectroscopy (XANES), laboratory X-Ray Diffraction (XRD) instruments. The WAXS and XANES spectra were collected using synchrotron radiation at Synchrotron Light Research Institute (SLRI), Nakhon Ratchasima, Thailand. The silica powders were obtained by processing silica sand from Tanah Laut, South Kalimantan, Indonesia. Purification process of silica sand was done by magnetic separation and immersion with HCl. The purification step was needed to reduce impurity or undesirable non Si elements. Three polymorphs of silica were produced, i.e. amorphous phase (A), quartz (B), and cristobalite (C). WAXS profile for each phase was presented in terms of intensity vs. 2θ prior to analyses. Both XRD (λ CuKα =1.54056 Å) and WAXS (λ=1.09 Å) patttern show that (1) A sample contains no crystallites, (2) B sample is monophasic, contains only quartz, and (3) C sample contains cristobalite and trydimite. XRD quantitative analysis using Rietica gave 98,8 wt% cristobalite, while the associated WAXS data provided 98.7 wt% cristobalite. Si K-edge XANES spectra were measured at energy range 1840 to 1920 eV. Qualitatively, the pre-edge and edge features for all phases are similar, but their main peaks in the post-edge region are different. (paper)

  8. Heat transfer enhancement in energy storage in spherical capsules filled with paraffin wax and metal beads

    International Nuclear Information System (INIS)

    Ettouney, Hisham; Alatiqi, Imad; Al-Sahali, Mohammad; Al-Hajirie, Khalida

    2006-01-01

    Energy storage is an attractive option to conserve limited energy resources, where more than 50% of the generated industrial energy is discarded in cooling water and stack gases. This study focuses on the evaluation of heat transfer enhancement in phase change energy storage units. The experiments are performed using spherical capsules filled with paraffin wax and metal beads. The experiments are conducted by inserting a single spherical capsule filled with wax and metal beads in a stream of hot/cold air. Experimental measurements include the temperature field within the spherical capsule and in the air stream. To determine the enhancement effects of the metal beads, the measured data is correlated against those for a spherical capsule filled with pure wax. Data analysis shows a reduction of 15% in the melting and solidification times upon increasing the number and diameter of the metal beads. This reduction is caused by a similar decrease in the thermal load of the sphere due to replacement of the wax by metal beads. The small size of the spherical capsule limits the enhancement effects; this is evident upon comparison of the heat transfer in a larger size, double pipe energy storage unit, where 2% of the wax volume is replaced with metal inserts, result in a three fold reduction in the melting/solidification time and a similar enhancement in the heat transfer rate

  9. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  10. Neutral lipid biosynthesis in engineered Escherichia coli: jojoba oil-like wax esters and fatty acid butyl esters.

    Science.gov (United States)

    Kalscheuer, Rainer; Stöveken, Tim; Luftmann, Heinrich; Malkus, Ursula; Reichelt, Rudolf; Steinbüchel, Alexander

    2006-02-01

    Wax esters are esters of long-chain fatty acids and long-chain fatty alcohols which are of considerable commercial importance and are produced on a scale of 3 million tons per year. The oil from the jojoba plant (Simmondsia chinensis) is the main biological source of wax esters. Although it has a multitude of potential applications, the use of jojoba oil is restricted, due to its high price. In this study, we describe the establishment of heterologous wax ester biosynthesis in a recombinant Escherichia coli strain by coexpression of a fatty alcohol-producing bifunctional acyl-coenzyme A reductase from the jojoba plant and a bacterial wax ester synthase from Acinetobacter baylyi strain ADP1, catalyzing the esterification of fatty alcohols and coenzyme A thioesters of fatty acids. In the presence of oleate, jojoba oil-like wax esters such as palmityl oleate, palmityl palmitoleate, and oleyl oleate were produced, amounting to up to ca. 1% of the cellular dry weight. In addition to wax esters, fatty acid butyl esters were unexpectedly observed in the presence of oleate. The latter could be attributed to solvent residues of 1-butanol present in the medium component, Bacto tryptone. Neutral lipids produced in recombinant E. coli were accumulated as intracytoplasmic inclusions, demonstrating that the formation and structural integrity of bacterial lipid bodies do not require specific structural proteins. This is the first report on substantial biosynthesis and accumulation of neutral lipids in E. coli, which might open new perspectives for the biotechnological production of cheap jojoba oil equivalents from inexpensive resources employing recombinant microorganisms.

  11. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  12. Effect of emulsifier type and concentration, aqueous phase volume and wax ratio on physical, material and mechanical properties of water in oil lipsticks.

    Science.gov (United States)

    Beri, A; Norton, J E; Norton, I T

    2013-12-01

    Water-in-oil emulsions in lipsticks could have the potential to improve moisturizing properties and deliver hydrophilic molecules to the lips. The aims of this work were (i) to investigate the effect of emulsifier type (polymer vs. monomer, and saturated vs. unsaturated chain) and concentration on droplet size and (ii) to investigate the effect of wax ratio (carnauba wax, microcrystalline wax, paraffin wax and performalene) and aqueous phase volume on material properties (Young's modulus, point of fracture, elastic modulus and viscous modulus). Emulsion formation was achieved using a high shear mixer. Results showed that the saturated nature of the emulsifier had very little effect on droplet size, neither did the use of an emulsifier with a larger head group (droplet size ~18-25 μm). Polyglycerol polyricinoleate (PGPR) resulted in emulsions with the smallest droplets (~3-5 μm), as expected from previous studies that show that it produces a thick elastic interface. The results also showed that both Young's modulus and point of fracture increase with increasing percentage of carnauba wax (following a power law dependency of 3), but decrease with increasing percentage of microcrystalline wax, suggesting that the carnauba wax is included in the overall wax network formed by the saturated components, whereas the microcrystalline wax forms irregular crystals that disrupt the overall wax crystal network. Young's modulus, elastic modulus and viscous modulus all decrease with increasing aqueous phase volume in the emulsions, although the slope of the decrease in elastic and viscous moduli is dependent on the addition of solid wax, as a result of strengthening the network. This work suggests the potential use for emulsions in lipstick applications, particularly when PGPR is used as an emulsifier, and with the addition of solid wax, as it increases network strength. © 2013 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

  13. Enhanced ethanol production by removal of cutin and epicuticular waxes of wheat straw by plasma assisted pretreatment

    DEFF Research Database (Denmark)

    Kádár, Zsófia; Schultz-Jensen, Nadja; Jensen, J. S.

    2015-01-01

    as with Scanning Electron Microscopy (SEM) imaging. Compounds resulting from wax degradation were analyzed in the washing water of PAP wheat straw. The wax removal enhanced enzymatic hydrolysis yield and, consequently, the efficiency of wheat straw conversion into ethanol. In total, PAP increased the conversion...

  14. Thermal Cracking to Improve the Qualification of the Waxes

    Science.gov (United States)

    He, B.; Agblevor, F. A.; Chen, C. G.; Feng, J.

    2018-05-01

    Thermal cracking of waxes at mild conditions (430-500°C) has been reconsidered as a possible refining technology for the production of fuels and chemicals. In this study, the more moderate thermal cracking was investigated to process Uinta Basin soft waxes to achieve the required pour point so that they can be pumped to the refineries. The best thermal cracking conditions were set 420°C and 20 minutes. The viscosity and density of the final liquid product were respectively achieved as 2.63 mP•s and 0.784 g/cm3 at 40°C. The result of FT-IR analysis of the liquid product indicated that the unsaturated hydrocarbons were produced after thermal cracking, which was corroborated by the 13C NMR spectrum. The GC analysis of the final gas product indicated that the hydrogen was produced; the dehydrogenation reaction was also proved by the elemental analysis and HHV results. The pour point of the final liquid product met the requirement.

  15. A news magnetic tools designed by ECOPETROL to inhibit wax in the petroleum production systems

    Energy Technology Data Exchange (ETDEWEB)

    Pelaez U, C.; Medina Z, C. [ECOPETROL, Instituto Colombiano del Petroleo (Colombia); Pena C, A. [INSERPET, Bucaramanga (Colombia)

    1996-12-31

    The deposition of wax and asphaltenes in production systems cause plugging in the flow lines reducing the oil production and increasing significantly the produced barrels prices. A wax magnetic inhibition technique has been tested with great success. The method has been improved with the use of magnetic tools. This work describes the experience and the results obtained with these tools. 6 figs., 1 tab.

  16. A news magnetic tools designed by ECOPETROL to inhibit wax in the petroleum production systems

    Energy Technology Data Exchange (ETDEWEB)

    Pelaez U, C; Medina Z, C [ECOPETROL, Instituto Colombiano del Petroleo (Colombia); Pena C, A [INSERPET, Bucaramanga (Colombia)

    1997-12-31

    The deposition of wax and asphaltenes in production systems cause plugging in the flow lines reducing the oil production and increasing significantly the produced barrels prices. A wax magnetic inhibition technique has been tested with great success. The method has been improved with the use of magnetic tools. This work describes the experience and the results obtained with these tools. 6 figs., 1 tab.

  17. Low-pressure injection molding of alumina ceramics using a carnauba wax binder: preliminary results

    Energy Technology Data Exchange (ETDEWEB)

    Quevedo Nogueira, R.E.F.; Bezerra, A.C.; Santos, F.C. dos [Dept. de Engenharia Mecanica, Centro de Tecnologia-UFC, Fortaleza, CE (Brazil); Sousa, M.R. de; Acchar, W. [Dept. de Engenharia Mecanica, Univ. Federal do Rio Grande do Norte, UFRN-Campus Univ., Natal, RN (Brazil)

    2001-07-01

    Carnauba wax, a natural product from Northeastern Brazil, has found application in the processing of ceramics. However, the use of pure carnauba wax is not recommended due to its narrow melting range and poor mechanical properties. In the present work carnauba wax based organic vehicles with the addition of low-density polyethylene and stearic acid were developed for use in the low-pressure injection molding of alumina ceramics. Viscosimetric testing was employed for the determination of optimal composition of the organic vehicle. The optimal content of ceramic powder in the mixture was also determined. All the materials used are easily available in the Brazilian market. A simple ceramic part was injected at low pressures (0.6 MPa) using a semi-automatic injection molding machine. For this purpose a double cavity mold was designed and built. Preliminary results demonstrate the technical viability of the process using the organic vehicle developed. (orig.)

  18. Anchoring plant metallothioneins to the inner face of the plasma membrane of Saccharomyces cerevisiae cells leads to heavy metal accumulation.

    Directory of Open Access Journals (Sweden)

    Lavinia Liliana Ruta

    Full Text Available In this study we engineered yeast cells armed for heavy metal accumulation by targeting plant metallothioneins to the inner face of the yeast plasma membrane. Metallothioneins (MTs are cysteine-rich proteins involved in the buffering of excess metal ions, especially Cu(I, Zn(II or Cd(II. The cDNAs of seven Arabidopsis thaliana MTs (AtMT1a, AtMT1c, AtMT2a, AtMT2b, AtMT3, AtMT4a and AtMT4b and four Noccaea caerulescens MTs (NcMT1, NcMT2a, NcMT2b and NcMT3 were each translationally fused to the C-terminus of a myristoylation green fluorescent protein variant (myrGFP and expressed in Saccharomyces cerevisiae cells. The myrGFP cassette introduced a yeast myristoylation sequence which allowed directional targeting to the cytosolic face of the plasma membrane along with direct monitoring of the intracellular localization of the recombinant protein by fluorescence microscopy. The yeast strains expressing plant MTs were investigated against an array of heavy metals in order to identify strains which exhibit the (hyperaccumulation phenotype without developing toxicity symptoms. Among the transgenic strains which could accumulate Cu(II, Zn(II or Cd(II, but also non-canonical metal ions, such as Co(II, Mn(II or Ni(II, myrGFP-NcMT3 qualified as the best candidate for bioremediation applications, thanks to the robust growth accompanied by significant accumulative capacity.

  19. Anchoring plant metallothioneins to the inner face of the plasma membrane of Saccharomyces cerevisiae cells leads to heavy metal accumulation.

    Science.gov (United States)

    Ruta, Lavinia Liliana; Lin, Ya-Fen; Kissen, Ralph; Nicolau, Ioana; Neagoe, Aurora Daniela; Ghenea, Simona; Bones, Atle M; Farcasanu, Ileana Cornelia

    2017-01-01

    In this study we engineered yeast cells armed for heavy metal accumulation by targeting plant metallothioneins to the inner face of the yeast plasma membrane. Metallothioneins (MTs) are cysteine-rich proteins involved in the buffering of excess metal ions, especially Cu(I), Zn(II) or Cd(II). The cDNAs of seven Arabidopsis thaliana MTs (AtMT1a, AtMT1c, AtMT2a, AtMT2b, AtMT3, AtMT4a and AtMT4b) and four Noccaea caerulescens MTs (NcMT1, NcMT2a, NcMT2b and NcMT3) were each translationally fused to the C-terminus of a myristoylation green fluorescent protein variant (myrGFP) and expressed in Saccharomyces cerevisiae cells. The myrGFP cassette introduced a yeast myristoylation sequence which allowed directional targeting to the cytosolic face of the plasma membrane along with direct monitoring of the intracellular localization of the recombinant protein by fluorescence microscopy. The yeast strains expressing plant MTs were investigated against an array of heavy metals in order to identify strains which exhibit the (hyper)accumulation phenotype without developing toxicity symptoms. Among the transgenic strains which could accumulate Cu(II), Zn(II) or Cd(II), but also non-canonical metal ions, such as Co(II), Mn(II) or Ni(II), myrGFP-NcMT3 qualified as the best candidate for bioremediation applications, thanks to the robust growth accompanied by significant accumulative capacity.

  20. Long-term evaluation of the needle surface wax condition of Pinus sylvestris around different industries in Lithuania

    International Nuclear Information System (INIS)

    Kupcinskiene, Eugenija; Huttunen, Satu

    2005-01-01

    The aim of our study was to evaluate the annual dynamics of needle surface wax erosion and wettability in Scots pines exposed to a gradient of industrial pollutants emitted from the main factories of Lithuania: a nitrogen fertilizer factory, an oil refinery and a cement factory. Decreased emissions (in the case of the oil refinery and the cement factory) were reflected in the increased structural surface area (SSA, i.e. area covered by tubular waxes) on the needles. The nearly constant amount of emissions from the nitrogen fertilizer factory within the 1994-2000 period corresponded to negligible annual differences in SSA. Annual changes in the hydrophobicity of needles on the investigated transects were small. Despite the decreased pollution within the 7-year period, industrial emissions are still causing significantly accelerated wax erosion and increased wettability in needles sampled from the stands most heavily affected by pollutants. - Tubular wax on the pine needle surface reflects changes/differences in industrial emissions

  1. Enhanced Thermo-Optical Switching of Paraffin-Wax Composite Spots under Laser Heating.

    Science.gov (United States)

    Said, Asmaa; Salah, Abeer; Fattah, Gamal Abdel

    2017-05-12

    Thermo-optical switches are of particular significance in communications networks where increasingly high switching speeds are required. Phase change materials (PCMs), in particular those based on paraffin wax, provide wealth of exciting applications with unusual thermally-induced switching properties, only limited by paraffin's rather low thermal conductivity. In this paper, the use of different carbon fillers as thermal conductivity enhancers for paraffin has been investigated, and a novel structure based on spot of paraffin wax as a thermo-optic switch is presented. Thermo-optical switching parameters are enhanced with the addition of graphite and graphene, due to the extreme thermal conductivity of the carbon fillers. Differential Scanning Calorimetry (DSC) and Scanning electron microscope (SEM) are performed on paraffin wax composites, and specific heat capacities are calculated based on DSC measurements. Thermo-optical switching based on transmission is measured as a function of the host concentration under conventional electric heating and laser heating of paraffin-carbon fillers composites. Further enhancements in thermo-optical switching parameters are studied under Nd:YAG laser heating. This novel structure can be used in future networks with huge bandwidth requirements and electric noise free remote aerial laser switching applications.

  2. Influence of putrescine and carnauba wax on functional and sensory quality of pomegranate (Punica granatum L.) fruits during storage

    OpenAIRE

    Barman, Kalyan; Asrey, Ram; Pal, R. K.; Kaur, Charanjit; Jha, S. K.

    2011-01-01

    Functional properties (anthocyanins, antioxidant, ascorbic acid and tannin) and sensory score were determined in pomegranate fruits at two storage temperatures (3 and 5 °C) after treatment with 2 mM putrescine and 1 : 10 carnauba wax (carnauba wax : water). The treatments (putrescine and carnauba wax) were given by immersion method followed by storage up to 60 days. Both treatments retained significantly higher anthocyanins, antioxidant, ascorbic acid, tannin and sensory qualities as compared...

  3. Cross-linking of LDPE/wax blends by using dicumyl peroxide

    African Journals Online (AJOL)

    Igor Krupa

    They are not soluble in many solvents due to their high crystallinity, but they ... macroradical formation via thermal decomposition of organic peroxides.6,7,8 A ... as potential applications of LDPE/wax blends are concerned, lower viscosity of ...

  4. Leaf waxes in litter and topsoils along a European transect

    Czech Academy of Sciences Publication Activity Database

    Schäfer, I. K.; Lanny, V.; Franke, J.; Eglinton, T. I.; Zech, M.; Vysloužilová, Barbora; Zech, R.

    2016-01-01

    Roč. 2, č. 4 (2016), s. 551-564 ISSN 2199-3971 Institutional support: RVO:67985912 Keywords : leaf waxes * soil s Subject RIV: AC - Archeology, Anthropology, Ethnology http://www. soil -journal.net/2/551/2016/ soil -2-551-2016.pdf

  5. Composition of epicuticular wax on Prosopis glandulosa leaves

    International Nuclear Information System (INIS)

    Mayeux, H.S. Jr.; Wilkinson, R.E.

    1990-01-01

    Epicuticular wax on leaves of field-grown honey mesquite (Prosopis glandulosa Torr.) trees consisted of 35% esters, 32% alkanes, 25% free fatty alcohols, and 7% free fatty acids. Aldehydes were present in very low concentrations. The number of carbon atoms (C n ) of alkanes ranged from 25 to 31, with a maximum (57%) at 29. Esters consisted of fatty acids with C n of 16, 18, and 20, with most (70%) at 18 and fatty alcohols with C n of 24-32. The C n of free fatty alcohols and free fatty acids also ranged from 24 to 32. Only primary alcohols were present. Immediately after exposure of glasshouse-grown seedlings to 14 CO 2 for 4 h, 60% of the recovered 14 C was incorporated into free fatty acids; the percentage decreased progressively to 18% 8 h after exposure and remained stable thereafter. The proportion of 14 C in free fatty alcohols increased from ca. 12% immediately after exposure to 14 CO 2 to 55% at 8 h. Little 14 C was associated with other wax components over the 24-h period; 3% or less was incorporated into alkanes

  6. Application of carnauba-based wax maintains postharvest quality of 'Ortanique' tangor

    Directory of Open Access Journals (Sweden)

    Francisca Ligia de Castro Machado

    2012-06-01

    Full Text Available This study aimed at evaluating compositional changes in the quality of 'Ortanique' tangor after coating with the carnauba-based waxes Aruá Tropical® or Star Light®. The storage conditions studied simulated those of local marketing (22 ± 2 °C, 60 ± 5% RH. Non-destructive analysis, mass loss, peel color, and sensory evaluation, were performed upon coating and every three days up to the fifteenth day of storage. Destructive analysis, peel moisture content, chlorophyll of the peel, pulp color, juice content, soluble solids (SS, titratable acidity (TA, pH, and soluble solids to titratable acidity ratio, were performed upon coating and every four days up to the sixteenth day of storage. The assay was conducted using an entirely randomized design, with three replications (destructive analyses or ten replications (non-destructive analyses, in a split plot scheme. Wax-coating, especially Aruá Tropical®, maintained fruit freshness by reducing mass loss and peel dehydration and retaining green color. Peel moisture content, chlorophyll content, and juice content had lower rates in the wax coated fruits. Puncture force, soluble solids, titratable acidity, pH, and soluble solids to titratable acidity ratio varied vary little over the course of storage. Sensory evaluation showed that the application of Aruá Tropical keeps 'Ortanique' tangor fresher for 6 days longer for commercialization.

  7. Evolution and development of model membranes for physicochemical and functional studies of the membrane lateral heterogeneity.

    Science.gov (United States)

    Morigaki, Kenichi; Tanimoto, Yasushi

    2018-03-14

    One of the main questions in the membrane biology is the functional roles of membrane heterogeneity and molecular localization. Although segregation and local enrichment of protein/lipid components (rafts) have been extensively studied, the presence and functions of such membrane domains still remain elusive. Along with biochemical, cell observation, and simulation studies, model membranes are emerging as an important tool for understanding the biological membrane, providing quantitative information on the physicochemical properties of membrane proteins and lipids. Segregation of fluid lipid bilayer into liquid-ordered (Lo) and liquid-disordered (Ld) phases has been studied as a simplified model of raft in model membranes, including giant unilamellar vesicles (GUVs), giant plasma membrane vesicles (GPMVs), and supported lipid bilayers (SLB). Partition coefficients of membrane proteins between Lo and Ld phases were measured to gauze their affinities to lipid rafts (raftophilicity). One important development in model membrane is patterned SLB based on the microfabrication technology. Patterned Lo/Ld phases have been applied to study the partition and function of membrane-bound molecules. Quantitative information of individual molecular species attained by model membranes is critical for elucidating the molecular functions in the complex web of molecular interactions. The present review gives a short account of the model membranes developed for studying the lateral heterogeneity, especially focusing on patterned model membranes on solid substrates. Copyright © 2018 Elsevier B.V. All rights reserved.

  8. Heritability of the Structures and 13C Fractionation in Tomato Leaf Wax Alkanes: A Genetic Model System to Inform Paleoenvironmental Reconstructions

    Directory of Open Access Journals (Sweden)

    Amanda L. D. Bender

    2017-06-01

    Full Text Available Leaf wax n-alkanes are broadly used to reconstruct paleoenvironmental information. However, the utility of n-alkanes as a paleoenvironmental proxy may be modulated by the extent to which biological as well as environmental factors influence the structural and isotopic variability of leaf waxes. In paleoclimate applications, there is usually an implicit assumption that most variation of leaf wax traits through a time series can be attributed to environmental change and that biological sources of variability within plant communities are small. For example, changes in hydrology affect the δ2H of waxes via rainwater and the δ13C of leaf waxes by changing plant communities. We measured the degree of genetic control over δ13C variation in leaf waxes within closely related species with an experimental greenhouse growth study. We measured the proportion of variability in structural and isotopic leaf wax traits that is attributable to genetic variation using a set of 76 introgression lines (ILs between two interfertile Solanum (tomato species: S. lycopersicum cv M82 (hereafter cv M82 and S. pennellii. Leaves of S. pennellii, a wild desert tomato relative, produced significantly more iso-alkanes than cv M82, a domesticated tomato cultivar adapted to water-replete conditions. We report a methylation index to summarize the ratio of branched (iso- and anteiso- to total alkanes. Between Solanum pennellii and cv M82, the iso-alkanes were found to be enriched in 13C by 1.2–1.4‰ over n-alkanes. The broad-sense heritability values (H2 of leaf wax traits describe the degree to which genetic variation contributes to variation of these traits. Variation of individual carbon isotopic compositions of alkanes were of low heritability (H2 = 0.13–0.19, suggesting that most variation in δ13C of leaf waxes in this study can be attributed to environmental variance. This supports the interpretation that variation in the δ13C of wax compounds recorded in sediments

  9. Heritability of the structures and 13C fractionation in tomato leaf wax alkanes: a genetic model system to inform paleoenvironmental reconstructions

    Science.gov (United States)

    Bender, Amanda L. D.; Chitwood, Daniel H.; Bradley, Alexander S.

    2017-06-01

    Leaf wax n-alkanes are broadly used to reconstruct paleoenvironmental information. However, the utility of n-alkanes as a paleoenvironmental proxy may be modulated by the extent to which biological as well as environmental factors influence the structural and isotopic variability of leaf waxes. In paleoclimate applications, there is usually an implicit assumption that most variation of leaf wax traits through a time series can be attributed to environmental change and that biological sources of variability within plant communities are small. For example, changes in hydrology affect the δ2H of waxes via rainwater and the δ13C of leaf waxes by changing plant communities. We measured the degree of genetic control over δ13C variation in leaf waxes within closely related species with an experimental greenhouse growth study. We measured the proportion of variability in structural and isotopic leaf wax traits that is attributable to genetic variation using a set of 76 introgression lines (ILs) between two interfertile Solanum (tomato) species: S. lycopersicum cv M82 (hereafter cv M82) and S. pennellii. Leaves of S. pennellii, a wild desert tomato relative, produced significantly more iso-alkanes than cv M82, a domesticated tomato cultivar adapted to water-replete conditions. We report a methylation index to summarize the ratio of branched (iso- and anteiso-) to total alkanes. Between S. pennellii and cv M82, the iso-alkanes were found to be enriched in 13C by 1.2-1.4‰ over n-alkanes. The broad-sense heritability values (H2) of leaf wax traits describe the degree to which genetic variation contributes to variation of these traits. Variation of individual carbon isotopic compositions of alkanes were of low heritability (H2 = 0.13-0.19), suggesting that most variation in δ13C of leaf waxes in this study can be attributed to environmental variance. This supports the interpretation that variation in the δ13C of wax compounds recorded in sediments reflects

  10. Coupling of separation and reaction in zeolite membrane reactor for hydroisomerization of hydrocarbons

    Energy Technology Data Exchange (ETDEWEB)

    Gora, L.; Maloncy, M.L.; Jansen, J.C. [Ceramic Membrane Centre, The Pore, DelftChemTech, Delft Univ. of Technology (Netherlands)

    2004-07-01

    A zeolite membrane reactor has been developed for the hydroisomerization of hydrocarbons, in which the linear molecules are separated from branch ones on the silicalite-1 membrane prior to conversion of the permeated linear hydrocarbons to equilibrium levels on the catalyst bed. A model studies using C6 components are conduct. Separated n-C6 from 2MP (selectivity 24) is converted for 72% with 36% selectivity towards di-branched isomers (at 393 K). The results indicate that platinum containing chlorinated alumina/silicalite-1 membrane reactor has a potential in upgrading octane values and offers advantages such as higher efficiency, better process control and lower consumption of energy. (orig.)

  11. Surfactants from petroleum paraffin wax

    Energy Technology Data Exchange (ETDEWEB)

    Kassem, T.M.; Hussein, M.H.; El Sayed, A.S.

    Paraffin wax from Egyptian petroleum was purified and then oxidized to fatty acids which were esterified to form their methyl esters, fractionated and then hydrolysed. The obtained fatty acids were converted into the corresponding primary amines which were converted with ethylene oxide to form nonionic surfactants. The prepared primary amines were also converted into tertiary amines and then converted into cationic surfactants through condensation with benzyl chloride or 1-chloromethylnaphthalene. Also, amine oxide surfactants were prepared by oxidation of the tertiary amines with hydrogen peroxide. The surface active properties of all the prepared surfactants were determined, and the effect of their chemical structure on the surfactant properties are discussed in this paper.

  12. Placental histologic patterns and neonatal seizure, in preterm premature rupture of membrane.

    Science.gov (United States)

    Ko, Hyun Sun; Cheon, Ju Young; Choi, Sae Kyung; Lee, Hye Won; Lee, Ahwon; Park, In Yang; Shin, Jong Chul

    2017-04-01

    To investigate the relationship between placenta and perinatal outcomes, in preterm infants born to mothers with preterm premature rupture of fetal membrane (PPROM). We report detailed histology of placentas and perinatal outcomes of infants from 79 PPROM pregnancies. Placental histologic pattern and adverse perinatal outcomes were assessed by logistic regression, adjusting for gestational age at birth, birth weight and interval from rupture of membrane to delivery. Mean gestational age at membrane rupture was 29.5 ± 3.4 weeks. The incidence of histologic chorioamnionitis (HCA), fetal inflammatory response (FIR) and vascular thrombotic abnormalities in placental histologic examination were 63.3, 25.3 and 78.5%, respectively. Neonates with FIR showed significantly higher incidence of periventricular leukomalacia (PVL) (85% versus 59.3%, p = 0.0364) at brain ultrasonography, than neonates without FIR, in univariate analysis, but not in logistic regression analysis. In logistic regression analysis, the odds ratio of low Apgar score at 1 min in the neonates with clinical chorioamnionitis was 5.009 (95% CI, 1.242-20.195). The odds ratio of neonatal seizure in the neonates with FIR and vascular thrombotic problem was 7.486 (95% CI, 1.617-34.653). Our findings support the association between FIR with vascular thrombotic problem in placenta and neonatal seizure, in pregnancies with PPROM.

  13. A prediction method for the wax deposition rate based on a radial basis function neural network

    Directory of Open Access Journals (Sweden)

    Ying Xie

    2017-06-01

    Full Text Available The radial basis function neural network is a popular supervised learning tool based on machinery learning technology. Its high precision having been proven, the radial basis function neural network has been applied in many areas. The accumulation of deposited materials in the pipeline may lead to the need for increased pumping power, a decreased flow rate or even to the total blockage of the line, with losses of production and capital investment, so research on predicting the wax deposition rate is significant for the safe and economical operation of an oil pipeline. This paper adopts the radial basis function neural network to predict the wax deposition rate by considering four main influencing factors, the pipe wall temperature gradient, pipe wall wax crystal solubility coefficient, pipe wall shear stress and crude oil viscosity, by the gray correlational analysis method. MATLAB software is employed to establish the RBF neural network. Compared with the previous literature, favorable consistency exists between the predicted outcomes and the experimental results, with a relative error of 1.5%. It can be concluded that the prediction method of wax deposition rate based on the RBF neural network is feasible.

  14. Photoaffinity Labeling of Developing Jojoba Seed Microsomal Membranes with a Photoreactive Analog of Acyl-Coenzyme A (Acyl-CoA) (Identification of a Putative Acyl-CoA:Fatty Alcohol Acyltransferase.

    Science.gov (United States)

    Shockey, J. M.; Rajasekharan, R.; Kemp, J. D.

    1995-01-01

    Jojoba (Simmondsia chinensis, Link) is the only plant known that synthesizes liquid wax. The final step in liquid wax biosynthesis is catalyzed by an integral membrane enzyme, fatty acyl-coenzyme A (CoA):fatty alcohol acyltransferase, which transfers an acyl chain from acyl-CoA to a fatty alcohol to form the wax ester. To purify the acyltransferase, we have labeled the enzyme with a radioiodinated, photoreactive analog of acyl-CoA, 12-[N-(4-azidosalicyl)amino] dodecanoyl-CoA (ASD-CoA). This molecule acts as an inhibitor of acyltransferase activity in the dark and as an irreversible inhibitor upon exposure to ultraviolet light. Oleoyl-CoA protects enzymatic activity in a concentration-dependent manner. Photolysis of microsomal membranes with labeled ASD-CoA resulted in strong labeling of two polypeptides of 57 and 52 kD. Increasing concentrations of oleoyl-CoA reduced the labeling of the 57-kD polypeptide dramatically, whereas the labeling of the 52-kD polypeptide was much less responsive to oleoyl-CoA. Also, unlike the other polypeptide, the labeling of the 57-kD polypeptide was enhanced considerably when photolyzed in the presence of dodecanol. These results suggest that a 57-kD polypeptide from jojoba microsomes may be the acyl-CoA:fatty alcohol acyltransferase.

  15. Characterization of rice bran wax policosanol and its nanoemulsion formulation

    Directory of Open Access Journals (Sweden)

    Ishaka A

    2014-05-01

    Full Text Available Aminu Ishaka,1,2 Mustapha Umar Imam,1 Rozi Mahamud,3 Abu Bakar Zakaria Zuki,4 Ismail Maznah1 1Laboratory of Molecular Biomedicine, Institute of Bioscience, University Putra Malaysia, Serdang, Selangor, Malaysia; 2Department of Medical Biochemistry, College of Health Sciences, Usmanu Danfodiyo University, Sokoto, Nigeria; 3Faculty of Medicine and Health Sciences, 4Faculty of Veterinary Medicine, University Putra Malaysia, Serdang, Selangor, Malaysia Abstract: Policosanol, a mixture of long-chain alcohols found in animal and plant waxes, has several biological effects; however, it has a bioavailability of less than 10%. Therefore, there is a need to improve its bioavailability, and one of the ways of doing this is by nanoemulsion formulation. Different droplet size distributions are usually achieved when emulsions are formed, which solely depends on the preparation method used. Mostly, emulsions are intended for better delivery with maintenance of the characteristics and properties of the leading components. In this study, policosanol was extracted from rice bran wax, its composition was determined by gas chromatography mass spectrophotometry, nanoemulsion was made, and the physical stability characteristics were determined. The results showed that policosanol nanoemulsion has a nanosize particle distribution below 100 nm (92.56–94.52 nm, with optimum charge distribution (-55.8 to -45.12 mV, pH (6.79–6.92 and refractive index (1.50; these were monitored and found to be stable for 8 weeks. The stability of policosanol nanoemulsion confers the potential to withstand long storage times. Keywords: rice bran wax, policosanol, nanoemulsion, characterization

  16. Forearm interosseous membrane trauma: MRI diagnostic criteria and injury patterns

    Energy Technology Data Exchange (ETDEWEB)

    McGinley, Joseph C. [Stanford University Medical Center, Department of Radiology, Stanford, CA (United States); Roach, Neil [Hospital of the University of Pennsylvania, Department of Radiology, Philadelphia, PA (United States); Hopgood, Brendon C. [Albert Einstein Medical Center, Department of Surgery, Philadelphia, PA (United States); Limmer, Karl [Temple University School of Medicine, Philadelphia, PA (United States); Kozin, Scott H. [Shriners Hospital for Children, Temple University and Pediatric Hand and Upper Extremity Surgeon, Philadelphia, PA (United States)

    2006-05-15

    Define criteria for interosseous membrane (IOM) injury diagnosis using MRI, and characterize patterns of IOM disruption following forearm trauma. Our hypothesis is that most IOM injuries occur along the ulnar insertion, and MRI should be obtained following forearm trauma to assess IOM competency. Sixteen cadaver forearms were subjected to longitudinal impact trauma. Prior to and following injury, MR images were examined by a board-certified musculoskeletal radiologist using pre-defined criteria for determining IOM integrity. Each specimen was dissected and the viability/pattern of injury examined. The MRI and dissection results were compared using a double-blinded methodology. Eight of the 16 specimens demonstrated IOM trauma. Seven specimens demonstrated complete IOM disruption from the ulnar insertion, and one revealed a mid-substance tear with intact origin and insertion. The dorsal oblique bundle was disrupted in four specimens. MRI analysis identified IOM injury in seven of the eight forearms. The injury location was correctly identified in six specimens when compared to dissection observations. MRI determination of IOM injury demonstrated a positive predictive value of 100%, a negative predictive value of 89%, a sensitivity of 87.5% and a specificity of 100%. (orig.)

  17. Forearm interosseous membrane trauma: MRI diagnostic criteria and injury patterns

    International Nuclear Information System (INIS)

    McGinley, Joseph C.; Roach, Neil; Hopgood, Brendon C.; Limmer, Karl; Kozin, Scott H.

    2006-01-01

    Define criteria for interosseous membrane (IOM) injury diagnosis using MRI, and characterize patterns of IOM disruption following forearm trauma. Our hypothesis is that most IOM injuries occur along the ulnar insertion, and MRI should be obtained following forearm trauma to assess IOM competency. Sixteen cadaver forearms were subjected to longitudinal impact trauma. Prior to and following injury, MR images were examined by a board-certified musculoskeletal radiologist using pre-defined criteria for determining IOM integrity. Each specimen was dissected and the viability/pattern of injury examined. The MRI and dissection results were compared using a double-blinded methodology. Eight of the 16 specimens demonstrated IOM trauma. Seven specimens demonstrated complete IOM disruption from the ulnar insertion, and one revealed a mid-substance tear with intact origin and insertion. The dorsal oblique bundle was disrupted in four specimens. MRI analysis identified IOM injury in seven of the eight forearms. The injury location was correctly identified in six specimens when compared to dissection observations. MRI determination of IOM injury demonstrated a positive predictive value of 100%, a negative predictive value of 89%, a sensitivity of 87.5% and a specificity of 100%. (orig.)

  18. The effect of waxes, as a complement to hydrothermal immersion, on the quality of papaya fruit (Carica papaya L. Pococí hybrid

    Directory of Open Access Journals (Sweden)

    V. Gustavo Corra

    2015-06-01

    Full Text Available Different waxes were evaluated as a complement to hydrothermal treatment on the overall papaya fruit quality parameters. The fruits were harvested, washed in water, disinfected with sodium hypochlorite and exposed to hydrothermal immersion treatment at 49°C/20 min (HT; then treatments were applied: 1 bees wax +palm oil 5% solution; 2 fatty acids wax mixture 4.7%; 3 chitosan 0.1%; 4 only HT; 5 control (no hydrothermal immersion nor wax. The fruit was stored for 15 days at 12°C, then at 20°C. Significant differences (p≤0.05 were found between fruits receiving HT complemented with 5% bees + palm oil wax, which exhibited lower respiration rate (12.27 ml CO2/kg*h a 8 days after leaving cold storage, as compared with those receiving only HT (16.72 ml CO2/ kg*h or control fruits (17.01 ml CO2/kg*h. The lesser percent of acumulated weight loss was registered whit TH plus bees wax cund palm oil. The color parameters were not affected, except for treatment 2, fatty acids wax mixture, which induced a delay in color development (p≤0.05. No changes were observed in internal or external firmness, nor in degrees brix. HT reduced the incidence of peduncular rot and anthracnose severity (p≤0.05, and extended useful life time. The use of waxes as a complement to HT can contribute to preserving some of the parameters which influence the final papaya fruit quality.

  19. Effect of matrix granulation and wax coating on the dissolution rates ...

    African Journals Online (AJOL)

    disintegrating) granules consisting of paracetamol (drug) and acrylatemethacrylate copolymer, a matrix forming material. The effect of coating the matrix granules with wax on the drug release profiles was also investigated. The objective was to ...

  20. Insecticidal Properties of a Highly Potent Wax Isolated from Dolichandra cynanchoides Cham

    Directory of Open Access Journals (Sweden)

    Georgina Díaz Napal

    2016-08-01

    Full Text Available Bioassay-guided fractionation of an ethanolic extract of the aerial parts of Dolichandra cynanchoides Cham. (Bignoniaceae led to the isolation of a natural wax with anti-insect activity against Spodoptera frugiperda (Noctuidae and Epilachna paenulata (Coleptera. The compound was identified spectroscopically as an ester of a C27 fatty acid and a C25 alcohol, pentacosyl heptacosanoate (1. The effective doses of 1 for 50% feeding inhibition (ED50 of S. frugiperda and E. paenulata were 0.82 and 8.53 µg/cm2, respectively, in a choice test, while azadirachtin showed ED50 of 0.10 and 0.59 µg/cm2, respectively. In a no-choice test, both insects refused to feed on leaves treated with 1 at doses of 0.1 µg/cm2 or greater inhibiting larval growth and dramatically reducing survival. The lethal doses 50 (LD50 of 1 were 0.39 and 0.68 µg/cm2 for S. frugiperda and E. paenulata, respectively. These results indicate that 1 has potential for development as botanical insecticides. Similar esters might be obtainable in large quantities as many edible crops produce wax esters that are discarded during food processing. Research on these materials could lead to the detection of similar waxes with insecticidal activity.

  1. High-level accumulation of oleyl oleate in plant seed oil by abundant supply of oleic acid substrates to efficient wax ester synthesis enzymes.

    Science.gov (United States)

    Yu, Dan; Hornung, Ellen; Iven, Tim; Feussner, Ivo

    2018-01-01

    Biotechnology enables the production of high-valued industrial feedstocks from plant seed oil. The plant-derived wax esters with long-chain monounsaturated acyl moieties, like oleyl oleate, have favorite properties for lubrication. For biosynthesis of wax esters using acyl-CoA substrates, expressions of a fatty acyl reductase (FAR) and a wax synthase (WS) in seeds are sufficient. For optimization of the enzymatic activity and subcellular localization of wax ester synthesis enzymes, two fusion proteins were created, which showed wax ester-forming activities in Saccharomyces cerevisiae . To promote the formation of oleyl oleate in seed oil, WSs from Acinetobactor baylyi ( Ab WSD1) and Marinobacter aquaeolei ( Ma WS2), as well as the two created fusion proteins were tested in Arabidopsis to evaluate their abilities and substrate preference for wax ester production. The tested seven enzyme combinations resulted in different yields and compositions of wax esters. Expression of a FAR of Marinobacter aquaeolei ( Ma FAR) with Ab WSD1 or Ma WS2 led to a high incorporation of C 18 substrates in wax esters. The Ma FAR/TM Mm AWAT2- Ab WSD1 combination resulted in the incorporation of more C 18:1 alcohol and C 18:0 acyl moieties into wax esters compared with Ma FAR/ Ab WSD1. The fusion protein of a WS from Simmondsia chinensis ( Sc WS) with MaFAR exhibited higher specificity toward C 20:1 substrates in preference to C 18:1 substrates. Expression of Ma FAR/ Ab WSD1 in the Arabidopsis fad2 fae1 double mutant resulted in the accumulation of oleyl oleate (18:1/18:1) in up to 62 mol% of total wax esters in seed oil, which was much higher than the 15 mol% reached by Ma FAR/ Ab WSD1 in Arabidopsis Col-0 background. In order to increase the level of oleyl oleate in seed oil of Camelina , lines expressing Ma FAR/ Sc WS were crossed with a transgenic high oleate line. The resulting plants accumulated up to >40 mg g seed -1 of wax esters, containing 27-34 mol% oleyl oleate. The

  2. Characterization of complementary patterned metallic membranes produced simultaneously by a dual fabrication process

    Science.gov (United States)

    Hao, Qingzhen; Zeng, Yong; Wang, Xiande; Zhao, Yanhui; Wang, Bei; Chiang, I.-Kao; Werner, Douglas H.; Crespi, Vincent; Huang, Tony Jun

    2010-11-01

    An efficient technique is developed to fabricate optically thin metallic films with subwavelength patterns and their complements simultaneously. By comparing the spectra of the complementary films, we show that Babinet's principle nearly holds for these structures in the optical domain. Rigorous full-wave simulations are employed to verify the experimental observations. It is further demonstrated that a discrete-dipole approximation can qualitatively describe the spectral dependence of the metallic membranes on the geometry of the constituent particles as well as the illuminating polarization.

  3. In vitro erythemal UV-A protection factors of inorganic sunscreens distributed in aqueous media using carnauba wax-decyl oleate nanoparticles.

    Science.gov (United States)

    Villalobos-Hernández, J R; Müller-Goymann, C C

    2007-01-01

    This paper describes the in vitro photoprotection in the UV-A range, i.e. 320-400 nm obtained by the use of carnauba wax-decyl oleate nanoparticles either as encapsulation systems or as accompanying vehicles for inorganic sunscreens such as barium sulfate, strontium carbonate and titanium dioxide. Lipid-free inorganic sunscreen nanosuspensions, inorganic sunscreen-free wax-oil nanoparticle suspensions and wax-oil nanoparticle suspensions containing inorganic sunscreens dispersed either in their oil phase or their aqueous phase were prepared by high pressure homogenization. The in vitro erythemal UV-A protection factors (EUV-A PFs) of the nanosuspensions were calculated by means of a sun protection analyzer. EUV-A PFs being no higher than 4 were obtained by the encapsulation of barium sulfate and strontium carbonate, meanwhile by the distribution of titanium dioxide in presence of wax-oil nanoparticles, the EUV-A PFs varied between 2 and 19. The increase in the EUV-A PFs of the titanium dioxide obtained by the use of wax-oil nanoparticles demonstrated a better performance of the sun protection properties of this pigment in the UV-A region.

  4. Experimental analysis, modeling and simulation of a solar energy accumulator with paraffin wax as PCM

    International Nuclear Information System (INIS)

    Reyes, A.; Henríquez-Vargas, L.; Aravena, R.; Sepúlveda, F.

    2015-01-01

    Highlights: • Enhancement of paraffin wax thermal conductivity using soft drink can stripes. • Thermal analysis and simulations results agree well with experimental data. • Increase in accumulator thermal efficiencies through addition of external aluminum stripes. • Proposed accumulator allows up to 13,000 kJ of energy storage. - Abstract: Soft drink cans filled with paraffin wax mixed with 7.5% aluminum stripes, obtained from disposable cans, doubled the thermal conductivity of cans filled only with paraffin wax. Promising results obtained in a prototype heat exchanger encouraged the construction of this unit 6 times bigger. We experimentally evaluated and model a heat exchanger for solar energy accumulation, composed by 300 disposable soft drink cans filled with a total of 59.25 kg of paraffin wax mixed with 7.5% aluminum stripes. The effect of adding 2.75 kg of aluminum fins for enhancing heat transfer from the outer surface of the cans to the circulant air was experimentally analyzed. In sunny days, the wax melted completely in about 4 h. The accumulated energy in form of latent heat (about 13,000 kJ) allowed to increase the temperature of 0.040 kg/s of circulant air in at least 20 °C during a period of 2.5 h. For an air mass rate of 0.018 kg/s the period was extended practically to 5 h. The accumulator thermal analysis was presented and a subsequent numerical simulation with Matlab was performed to compare with the experimental results obtaining good agreement specially for higher air mass flow rates. The low cost accumulator presented is of simple construction and will allow extended use of solar energy for applications such as drying processes or household calefaction system.

  5. Inhomogeneity Based Characterization of Distribution Patterns on the Plasma Membrane.

    Directory of Open Access Journals (Sweden)

    Laura Paparelli

    2016-09-01

    Full Text Available Cell surface protein and lipid molecules are organized in various patterns: randomly, along gradients, or clustered when segregated into discrete micro- and nano-domains. Their distribution is tightly coupled to events such as polarization, endocytosis, and intracellular signaling, but challenging to quantify using traditional techniques. Here we present a novel approach to quantify the distribution of plasma membrane proteins and lipids. This approach describes spatial patterns in degrees of inhomogeneity and incorporates an intensity-based correction to analyze images with a wide range of resolutions; we have termed it Quantitative Analysis of the Spatial distributions in Images using Mosaic segmentation and Dual parameter Optimization in Histograms (QuASIMoDOH. We tested its applicability using simulated microscopy images and images acquired by widefield microscopy, total internal reflection microscopy, structured illumination microscopy, and photoactivated localization microscopy. We validated QuASIMoDOH, successfully quantifying the distribution of protein and lipid molecules detected with several labeling techniques, in different cell model systems. We also used this method to characterize the reorganization of cell surface lipids in response to disrupted endosomal trafficking and to detect dynamic changes in the global and local organization of epidermal growth factor receptors across the cell surface. Our findings demonstrate that QuASIMoDOH can be used to assess protein and lipid patterns, quantifying distribution changes and spatial reorganization at the cell surface. An ImageJ/Fiji plugin of this analysis tool is provided.

  6. Molecular analysis of intact preen waxes of Calidris Canutus (Aves: Scolopacidae) by GC/MS and GC/MS/MS

    NARCIS (Netherlands)

    Sinninghe Damsté, J.S.; Dekker, M.H.A.; Piersma, T.

    2000-01-01

    The intact preen wax esters of the red knot Calidris canutus were studied with gas chromatography/mass spectrometry (GC/MS) and GC/MS/MS. In this latter technique, transitions from the molecular ion to fragment ions representing the fatty acid moiety of the wax esters were measured, providing

  7. Development of Wax-Incorporated Emulsion Gel Beads for the Encapsulation and Intragastric Floating Delivery of the Active Antioxidant from Tamarindus indica L.

    Science.gov (United States)

    Soradech, Sitthiphong; Petchtubtim, Intira; Thongdon-A, Jeerayu; Muangman, Thanchanok

    2016-03-22

    In this study, tamarind (Tamarindus indica L.) seed extracts with potential antioxidant activity and toxicity to cancer cells were developed as functional foods and nutraceutical ingredients in the form of emulsion gel beads. Three extracts were obtained from ethanol and water: TSCH50, TSCH95 and TSCH. All extracts exhibited high potential for superoxide anion scavenging activity over the IC50 range emulsion gel beads, which were prepared using a modified ionotropic gelation technique. Tamarind seed extract at 1% (w/w) was used as the active ingredient in all formulations. The effect of the types and amounts of wax on the encapsulation efficiency and percentage of the active release of alginate gel beads was also investigated. The results demonstrated that the incorporation of both waxes into the gel beads had an effect on the percentage of encapsulation efficiency (%) and the percentage of the active ingredient release. Furthermore, the addition of water insoluble waxes (carnauba and bee wax) significantly retarded the release of the active ingredient. The addition of both waxes had a slight effect on drug release behavior. Nevertheless, the increase in incorporated waxes in all formulations could sustain the percentage of active ingredient release. In conclusion, wax-incorporated emulsion gel beads using a modified ionotropic gelation technique could be applied for the intragastric floating delivery and controlled release of functional food and nutraceutical products for their antioxidant and anticancer capacity.

  8. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  9. Surfactant-free carnauba wax dispersion and its use for layer-by-layer assembled protective surface coatings on wood

    Science.gov (United States)

    Lozhechnikova, Alina; Bellanger, Hervé; Michen, Benjamin; Burgert, Ingo; Österberg, Monika

    2017-02-01

    Protection from liquid water and UV radiation are equally important, and a sophisticated approach is needed when developing surface coatings that preserve the natural and well-appreciated aesthetic appearance of wood. In order to prevent degradation and prolong the service life of timber, a protective coating was assembled using carnauba wax particles and zinc oxide nanoparticles via layer-by-layer deposition in water. For this purpose, a facile sonication route was developed to produce aqueous wax dispersion without any surfactants or stabilizers. The suspension was stable above pH 4 due to the electrostatic repulsion between the negatively charged wax particles. The particle size could be controlled by the initial wax concentration with average particle sizes ranging from 260 to 360 nm for 1 and 10 g/L, respectively. The deposition of wax particles onto the surface of spruce wood introduced additional roughness to the wood surface at micron level, while zinc oxide provided nano roughness and UV-absorbing properties. In addition to making wood superhydrophobic, this novel multilayer coating enhanced the natural moisture buffering capability of spruce. Moreover, wood surfaces prepared in this fashion showed a significant reduction in color change after exposure to UV light. A degradation of the wax through photocatalytic activity of the ZnO particles was measured by FTIR, indicating that further studies are required to achieve long-term stability. Nevertheless, the developed coating showed a unique combination of superhydrophobicity and excellent moisture buffering ability and some UV protection, all achieved using an environmentally friendly coating process, which is beneficial to retain the natural appearance of wood and improve indoor air quality and comfort.

  10. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  11. Plasma lipid pattern and red cell membrane structure in β-thalassemia patients in Jakarta

    Directory of Open Access Journals (Sweden)

    Seruni K.U. Freisleben

    2011-08-01

    Full Text Available Background: Over the last 10 years, we have investigated thalassemia patients in Jakarta to obtain a comprehensive picture of iron overload, oxidative stress, and cell damage.Methods: In blood samples from 15 transfusion-dependent patients (group T, 5 non-transfused patients (group N and 10 controls (group C, plasma lipids and lipoproteins, lipid-soluble vitamin E, malondialdehyde (MDA and thiol status were measured. Isolated eryhtrocyte membranes were investigated with electron paramagnetic resonance (EPR spectroscopy using doxyl-stearic acid and maleimido-proxyl spin lables. Data were analyzed statistically with ANOVA.Results: Plasma triglycerides were higher and cholesterol levels were lower in thalassemic patients compared to controls. Vitamin E, group C: 21.8 vs T: 6.2 μmol/L and reactive thiols (C: 144 vs. T: 61 μmol/L were considerably lower in transfused patients, who exert clear signs of oxidative stress (MDA, C: 1.96 vs T: 9.2 μmol/L and of tissue cell damage, i.e., high transaminases plasma levels. Non-transfused thalassemia patients have slight signs of oxidative stress, but no significant indication of cell damage. Erythrocyte membrane parameters from EPR spectroscopy differ considerably between all groups. In transfusion-dependent patients the structure of the erythrocyte membrane and the gradients of polarity and fluidity are destroyed in lipid domains; binding capacity of protein thiols in the membrane is lower and immobilized.Conclusion: In tranfusion-dependent thalassemic patients, plasma lipid pattern and oxidative stress are associated with structural damage of isolated erythrocyte membranes as measured by EPR spectroscopy with lipid and proteinthiol spin labels. (Med J Indones 2011; 20:178-84Keywords: electron paramagnetic resonance spectroscopy, erythrocyte membrane, lipoproteins, oxidative stress, thalassemia, plasma lipids.

  12. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  13. Leaf waxes of slow-growing alpine and fast-growing lowland Poa species: inherent differences and responses to UV-B radiation

    International Nuclear Information System (INIS)

    Pilon, J.J.; Lambers, H.; Baas, W.; Tosserams, M.; Rozema, J.; Atkin, O.K.

    1999-01-01

    We investigated whether alpine and lowland Poa species exhibit inherent differences in leaf cuticular waxes, leaf UV absorbing compounds and/or growth responses to UV-B treatment. All plants were grown hydroponically in a growth cabinet (constant 20°; 14 hr photoperiod; 520 μmol photons m −2 s −1 PAR). Two alpine (P. fawcettiae and P. costiniana), one sub-alpine (P. alpina) and three temperate lowland species (P. pratensis, P. compressa and P. trivialis) were grown under conditions without UV radiation for 36 days. In a subsequent experiment, four Poa species (P. costiniana, P. alpina, P. compressa and P. trivialis) were also exposed for 21 days to UV-B/(UV-A) radiation ('UV-B treatment') that resulted in daily UV-B radiation of 7.5 kJ m −2 day −1 , with control plants being grown without UV-B ('UV-A control treatment'). All treatments were carried out in the same growth cabinet. There was no altitudinal trend regarding wax concentrations per unit leaf area, when the six species grown under UV-less conditions, were compared at similar developmental stage (20–30 g shoot fresh mass). However, large differences in cuticular wax chemical composition were observed between the alpine and lowland species grown under UV-less conditions. For example, a single primary alcohol was present in the waxes of the lowland and sub-alpine species (C 26 H 53 OH), but was virtually absent in the alpine species. Although alkanes were present in all six species (primarily C 29 H 60 and C 31 H 64 ), the proportion of total wax present as alkanes was highest in the alpine species. Aldehydes were only present in the waxes of the alpine species. Conversely, substantial amounts of triterpenoids were mainly present in the three lowland species (squalene and lupeol were the dominant forms). The proportion of total wax present as long-chain esters (LCE-s) was similar in all six species grown in the absence of UV radiation. Acetates were observed only in the wax of

  14. Software module for geometric product modeling and NC tool path generation

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2003-01-01

    The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

  15. EFFECT OF BODY SIZE ON BREATHING PATTERN AND FINE PARTICLE DEPOSITION IN CHILDREN

    Science.gov (United States)

    Inter-child variability in breathing patterns may contribute to variability in fine particle, lung deposition and morbidity in children associated with those particles. Fractional deposition (DF) of fine particles (2um monodisperse, carnauba wax particles) was measured in healthy...

  16. Structural characterization of wax esters by electron ionization mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Urbanová, Klára; Vrkoslav, Vladimír; Valterová, Irena; Háková, Martina; Cvačka, Josef

    2012-01-01

    Roč. 53, č. 1 (2012), s. 204-213 ISSN 0022-2275 R&D Projects: GA ČR GA203/09/0139 Institutional research plan: CEZ:AV0Z40550506 Keywords : interpretation * neutral lipids * spectral database * waxes Subject RIV: CC - Organic Chemistry Impact factor: 4.386, year: 2012

  17. Bipolar Plasma Membrane Distribution of Phosphoinositides and Their Requirement for Auxin-Mediated Cell Polarity and Patterning in Arabidopsis

    NARCIS (Netherlands)

    Tejos, R.; Sauer, M.; Vanneste, S.; Palacios-Gomez, M.; Li, H.; Heilmann, M.; van Wijk, R.; Vermeer, J.E.M.; Heilmann, I.; Munnik, T.; Friml, J.

    2014-01-01

    Cell polarity manifested by asymmetric distribution of cargoes, such as receptors and transporters, within the plasma membrane (PM) is crucial for essential functions in multicellular organisms. In plants, cell polarity (re)establishment is intimately linked to patterning processes. Despite the

  18. Investigation of patterned and non-patterned poly(2,6-dimethyl 1,4-phenylene) oxide based anion exchange membranes for enhanced desalination and power generation in a microbial desalination cell.

    Science.gov (United States)

    Moruno, Francisco Lopez; Rubio, Juan E; Santoro, Carlo; Atanassov, Plamen; Cerrato, José M; Arges, Christopher G

    2018-01-01

    Quaternary ammonium poly(2,6-dimethyl 1,4-phenylene oxide) (QAPPO) anion exchange membranes (AEMs) with topographically patterned surfaces were assessed in a microbial desalination cell (MDC) system. The MDC results with these QAPPO AEMs were benchmarked against a commercially available AEM. The MDC with the non-patterned QAPPO AEM (Q1) displayed the best desalination rate (a reduction of salinity by 53 ± 2.7%) and power generation (189 ± 5 mW m - 2 ) when compared against the commercially available AEM and the patterned AEMs. The enhanced performance with the Q1 AEM was attributed to its higher ionic conductivity and smaller thickness leading to a reduced area specific resistance. It is important to note that Real Pacific Ocean seawater and activated sludge were used into the desalination chamber and anode chamber respectively for the MDC - which mimicked realistic conditions. Although the non-patterned QAPPO AEM displayed better performance over the patterned QAPPO AEMs, it was observed that the anodic overpotential was smaller when the MDCs featured QAPPO AEMs with larger lateral feature sizes. The results from this study have important implications for the continuous improvements necessary for developing cheaper and better performing membranes in order to optimize the MDC.

  19. MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

    Science.gov (United States)

    Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

    2018-03-01

    Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

  20. Development of polymer nano composite patterns using fused deposition modeling for rapid investment casting process

    Science.gov (United States)

    Vivek, Tiwary; Arunkumar, P.; Deshpande, A. S.; Vinayak, Malik; Kulkarni, R. M.; Asif, Angadi

    2018-04-01

    Conventional investment casting is one of the oldest and most economical manufacturing techniques to produce intricate and complex part geometries. However, investment casting is considered economical only if the volume of production is large. Design iterations and design optimisations in this technique proves to be very costly due to time and tooling cost for making dies for producing wax patterns. However, with the advent of Additive manufacturing technology, plastic patterns promise a very good potential to replace the wax patterns. This approach can be very useful for low volume production & lab requirements, since the cost and time required to incorporate the changes in the design is very low. This research paper discusses the steps involved for developing polymer nanocomposite filaments and checking its suitability for investment castings. The process parameters of the 3D printer machine are also optimized using the DOE technique to obtain mechanically stronger plastic patterns. The study is done to develop a framework for rapid investment casting for lab as well as industrial requirements.

  1. Insect Ryanodine Receptor: Distinct But Coupled Insecticide Binding Sites for [N-C3H3]Chlorantraniliprole, Flubendiamide, and [3H]Ryanodine

    OpenAIRE

    Isaacs, André K.; Qi, Suzhen; Sarpong, Richmond; Casida, John E.

    2012-01-01

    Radiolabeled anthranilic diamide insecticide [N-C3H3]chlorantraniliprole was synthesized at high specific activity and compared with phthalic diamide insecticide flubendiamide and [3H]ryanodine in radioligand binding studies with house fly muscle membranes to provide the first direct evidence with a native insect ryanodine receptor that the major anthranilic and phthalic diamide insecticides bind at different allosterically coupled sites, i.e. there are three distinct Ca2+-release channel tar...

  2. Presence of carotinoids in peat wax

    Energy Technology Data Exchange (ETDEWEB)

    Yurkevich, E.A.; Dolidovich, E.F.; Bel' kevich, P.I.; Sheremet, L.S.; Drozdovskaya, S.V.

    1986-05-01

    Discusses biologically active substances present in peat which have various pharmacological properties. Describes separation of fractions rich in carotinoids from extracts of wax tar obtained by benzine treatment of highly decomposed pine-cotton grass peat. Extraction was carried out using hot ethanol. States that although identification of individual carotinoid in the fractions separated is very difficult due to complicity of composition, the tests carried out made it possible to infer that fractions studied contain not only xanthophylls but also fucoxanthains (formed in small amounts in nature) with fairly stable structure. Ultraviolet and infrared spectra of the carotinoid containing fraction in ethanol extracts are given. 6 refs.

  3. Accelerated Thermal Cycling Test of Microencapsulated Paraffin Wax/Polyaniline Made by Simple Preparation Method for Solar Thermal Energy Storage.

    Science.gov (United States)

    Silakhori, Mahyar; Naghavi, Mohammad Sajad; Metselaar, Hendrik Simon Cornelis; Mahlia, Teuku Meurah Indra; Fauzi, Hadi; Mehrali, Mohammad

    2013-04-29

    Microencapsulated paraffin wax/polyaniline was prepared using a simple in situ polymerization technique, and its performance characteristics were investigated. Weight losses of samples were determined by Thermal Gravimetry Analysis (TGA). The microencapsulated samples with 23% and 49% paraffin showed less decomposition after 330 °C than with higher percentage of paraffin. These samples were then subjected to a thermal cycling test. Thermal properties of microencapsulated paraffin wax were evaluated by Differential Scanning Calorimeter (DSC). Structure stability and compatibility of core and coating materials were also tested by Fourier transform infrared spectrophotometer (FTIR), and the surface morphology of the samples are shown by Field Emission Scanning Electron Microscopy (FESEM). It has been found that the microencapsulated paraffin waxes show little change in the latent heat of fusion and melting temperature after one thousand thermal recycles. Besides, the chemical characteristics and structural profile remained constant after one thousand thermal cycling tests. Therefore, microencapsulated paraffin wax/polyaniline is a stable material that can be used for thermal energy storage systems.

  4. Effect of Zeolite Treatment on the Blooming Behavior of Paraffin Wax in Natural Rubber Composites

    Directory of Open Access Journals (Sweden)

    Bryan B. Pajarito

    2016-06-01

    Full Text Available The blooming behavior of paraffin wax in natural rubber (NR composites was studied as function of zeolite treatment. Three types of zeolite treatment were treated as factors: acid activation using hydrochloric acid (HCl solution, ion exchange using tetradecyldimethyl amine (TDA chloride salt, and organic modification using glycerol monostearate (GMS. The zeolite was treated according to a 23 full factorial design of experiment. Attenuated total reflectance – Fourier transform infrared (ATR-FTIR spectroscopy was used to characterize the chemical structure of treated zeolite. Treated zeolite was applied as filler to NR composites deliberately compounded with high amount of paraff in wax. The amount of bloomed wax in surface of NR composite sheets was monitored with time at 50oC. Results show the bloom amount to be linear with the square root of time. NR composites reinforced with untreated, acid-activated, and ion-exchanged zeolite fillers indicate reduction in wax blooming as compared to unfilled NR. The bloom rate (slope and initial bloom (y-intercept were determined from the experimental plots. Analysis of variance (ANOVA shows the bloom rate to be signif icantly increased when zeolite fillers are treated with GMS. Meanwhile, initial bloom was significantly enhanced when zeolite fillers are treated with TDA chloride salt and GMS. The significant increase in bloom rate and initial bloom can be attributed to the softening of the NR matrix at high amounts of TDA chloride salt and GMS.

  5. Output-Sensitive Pattern Extraction in Sequences

    DEFF Research Database (Denmark)

    Grossi, Roberto; Menconi, Giulia; Pisanti, Nadia

    2014-01-01

    Genomic Analysis, Plagiarism Detection, Data Mining, Intrusion Detection, Spam Fighting and Time Series Analysis are just some examples of applications where extraction of recurring patterns in sequences of objects is one of the main computational challenges. Several notions of patterns exist...... or extend them causes a loss of significant information (where the number of occurrences changes). Output-sensitive algorithms have been proposed to enumerate and list these patterns, taking polynomial time O(nc) per pattern for constant c > 1, which is impractical for massive sequences of very large length...

  6. Effect of feed flow pattern on the distribution of permeate fluxes in desalination by direct contact membrane distillation

    KAUST Repository

    Soukane, Sofiane

    2017-05-31

    The current study aims to highlight the effect of flow pattern on the variations of permeate fluxes over the membrane surface during desalination in a direct contact membrane distillation (DCMD) flat module. To do so, a three dimensional (3D) Computational Fluid Dynamics (CFD) model with embedded pore scale calculations is implemented to predict flow, heat and mass transfer in the DCMD module. Model validation is carried out in terms of average permeate fluxes with experimental data of seawater desalination using two commercially available PTFE membranes. Average permeate fluxes agree within 6% and less with experimental values without fitting parameters. Simulation results show that the distribution of permeate fluxes and seawater salinity over the membrane surface are strongly dependent on momentum and heat transport and that temperature and concentration polarization follow closely the flow distribution. The analysis reveals a drastic effect of recirculation loops and dead zones on module performance and recommendations to improve MD flat module design are drawn consequently.

  7. Oleogels of virgin olive oil with carnauba wax and monoglyceride as spreadable products

    Directory of Open Access Journals (Sweden)

    Öǧütcü, M.

    2014-09-01

    Full Text Available The oleogels of virgin olive oil with carnauba wax and monoglyceride were prepared to determine the most suitable spreadable product. The oil binding capacities of monoglyceride oleogels were higher than those of the carnauba wax oleogels. There was no true crystalline structure with carnauba wax at 3%. Although the highest solid fat content was in the 10% monoglyceride oleogel (9.38%, it was 12.15% in the commercial breakfast margarine at 20 °C. The peak melting temperature of the margarine was 47.11 °C, and among all oleogels, monoglyceride oleogel at 7% addition had the closest value (48.70 °C. The melting enthalpies of the oleogels ranged from 1.25 to 103.97 J·g−1, while it was 94.19 J·g−1 for the margarine sample. The firmness and stickiness values were usually lower in the oleogel samples than those of the margarine sample. There was no significant change in the texture parameters during storage, indicating good structural stability. The polarized light microscopy pictures revealed rod-like crystals for carnauba wax and rosette-like aggregates for monoglyceride oleogels. X-ray diffraction patterns of the samples have revealed a β´-type polymorphic structure for the oleogels. These oleogels can be used in a spreadable, breakfast margarin-like product to promote new consumption habits for this healthy oil.Se prepararon oleogeles de aceites de oliva virgen con cera de carnaúba y monoglicéridos para encontrar el producto más adecuado para untar. La capacidad de unión de aceites de oleogeles de monoglicéridos fue más alto que el de los oleogeles de cera de carnaúba. No hubo ninguna estructura cristalina verdadera con cera de carnaúba al 3%. Aunque el mayor contenido de grasa sólida fue con el 10 % de oleogeles de monoglicérido (9,38 %, fue del 12.15 % en el de margarina comercial a 20 °C. La temperatura pico de fusión de la margarina fue 47,11 ºC, y entre todos los oleogeles, los de monoglicérido al 7 % tuvo el valor m

  8. Scientific Opinion on the re-evaluation of carnauba wax (E 903) as a food additive

    OpenAIRE

    EFSA Panel on Food Additives and Nutrient Sources added to Food (ANS)

    2012-01-01

    The Panel on Food Additives and Nutrient Sources added to Food (ANS) delivers a scientific opinion re-evaluating the safety of carnauba wax (E 903). Carnauba wax (E 903) is authorised in the EU as food additive as glazing agent. It has been evaluated by the Scientific Committee on Food (SCF) and by the Joint FAO/WHO Expert Committee on Food Additives (JECFA) who allocated an Acceptable Daily Intake (ADI) of 7 mg/kg bw/day. The SCF did not establish an ADI but considered the use of ca...

  9. Leaf surface wax is a source of plant methane formation under UV radiation and in the presence of oxygen

    DEFF Research Database (Denmark)

    Bruhn, Dan; Mikkelsen, Teis Nørgaard; Rolsted, M. M. M.

    2014-01-01

    to this, we demonstrated that the UV radiation-induced CH4 emission is independent of leaf area index above unity. Further, we observed that the presence of O2 in the atmosphere was necessary for achieving the highest rates of CH4 emission. Methane formation from leaf surface wax is supposedly a two...... investigated the potential of the leaf surface wax itself as a source of UV radiationinduced leaf aerobic CH4 formation. Isolated leaf surface wax emitted CH4 at substantial rates in response to UV radiation. This discovery has implications for how the phenomenon should be scaled to global levels. In relation...

  10. Development of STEP-NC Adaptor for Advanced Web Manufacturing System

    Science.gov (United States)

    Ajay Konapala, Mr.; Koona, Ramji, Dr.

    2017-08-01

    Information systems play a key role in the modern era of Information Technology. Rapid developments in IT & global competition calls for many changes in basic CAD/CAM/CAPP/CNC manufacturing chain of operations. ‘STEP-NC’ an enhancement to STEP for operating CNC machines, creating new opportunities for collaborative, concurrent, adaptive works across the manufacturing chain of operations. Schemas and data models defined by ISO14649 in liaison with ISO10303 standards made STEP-NC file rich with feature based, rather than mere point to point information of G/M Code format. But one needs to have a suitable information system to understand and modify these files. Various STEP-NC information systems are reviewed to understand the suitability of STEP-NC for web manufacturing. Present work also deals with the development of an adaptor which imports STEP-NC file, organizes its information, allowing modifications to entity values and finally generates a new STEP-NC file to export. The system is designed and developed to work on web to avail additional benefits through the web and also to be part of a proposed ‘Web based STEP-NC manufacturing platform’ which is under development and explained as future scope.

  11. Immobilized Rhizopus oryzae lipase catalyzed synthesis of palm stearin and cetyl alcohol wax esters: Optimization by Response Surface Methodology

    Directory of Open Access Journals (Sweden)

    Gargouri Youssef

    2011-06-01

    Full Text Available Abstract Background Waxes are esters of long-chain fatty acids and long-chain alcohols. Their principal natural sources are animals (sperm whale oil and vegetables (jojoba which are expensive and not easily available. Wax esters synthesized by enzymatic transesterification, using palm stearin as raw material, can be considered as an alternative to natural ones. Results Palm stearin is a solid fraction obtained by fractionation of palm oil. Palm stearin was esterified with cetyl alcohol to produce a mixture of wax esters. A non-commercial immobilized lipase from Rhizopus oryzae was used as biocatalyst. Response surface methodology was employed to determine the effects of the temperature (30-50°C, the enzyme concentration (33.34-300 IU/mL, the alcohol/palm stearin molar ratio (3-7 mol/mol and the substrate concentration (0.06-0.34 g/mL on the conversion yield of palm stearin. Under optimal conditions (temperature, 30°C; enzyme concentration, 300 IU/mL; molar ratio 3 and substrate concentration 0.21 g/mL a high conversion yield of 98.52% was reached within a reaction time of 2 h. Conclusions Response surface methodology was successfully applied to determine the optimum operational conditions for synthesis of palm stearin based wax esters. This study may provide useful tools to develop economical and efficient processes for the synthesis of wax esters.

  12. Ultrastructure of Wax-Producing Structures on the Integument of the Melaleuca Psyllid Boreioglycaspis melaleucae (Hemiptera: Psyllidae), with Honeydew Excretion Behavior in Males and Females

    Science.gov (United States)

    Ammar, El-Desouky; Hentz, Matthew; Hall, David G.; Shatters, Robert G.

    2015-01-01

    The melaleuca psyllid, Boreioglycaspis melaleucae (Hemiptera: Psyllidae), was introduced to Florida as a biological control agent against Melaleuca quinquenervia, an invasive evergreen tree that has invaded large areas of Florida Everglades. Colonies of B. melaleucae nymphs are normally covered by white waxy secretions, and nymphs of various instars produce long bundles of white waxy filaments extending laterally and posteriorly from their abdomen. Scanning electron microscopy of ‘naturally waxed’ and ‘dewaxed’ nymphs (cleaned from wax) revealed two types of wax pore plates located dorsally and laterally on the integument of posterior abdominal segments starting with the 4th segment. Type-1 wax pore plates, with raised rim, peripheral groove, slits and pits, produce long ribbons and filaments of waxy secretions that are wound together forming long wax bundles, whereas type-2 wax pore plates, with slits only, produce shorter wax curls. Additionally, in both nymphs and adult females, the circumanal ring contained ornate rows of wax pores that produce wax filaments covering their honeydew excretions. Video recordings with stereomicroscopy showed that adult females produce whitish honeydew balls, powerfully propelled away from their body, probably to get these sticky excretions away from their eggs and newly hatched nymphs. Adult males, however, produce clear droplets of honeydew immediately behind them, simply by bending the posterior end of the abdomen downward. The possible role(s) of waxy secretions by nymphs and adults of B. melaleucae in reducing contamination of their colonies with honeydew, among other possibilities, are discussed. PMID:25793934

  13. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  14. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  15. Evolutionary Conserved Function of Barley and Arabidopsis 3-KETOACYL-CoA SYNTHASES in Providing Wax Signals for Germination of Powdery Mildew Fungi1[C][W

    Science.gov (United States)

    Weidenbach, Denise; Jansen, Marcus; Franke, Rochus B.; Hensel, Goetz; Weissgerber, Wiebke; Ulferts, Sylvia; Jansen, Irina; Schreiber, Lukas; Korzun, Viktor; Pontzen, Rolf; Kumlehn, Jochen; Pillen, Klaus; Schaffrath, Ulrich

    2014-01-01

    For plant pathogenic fungi, such as powdery mildews, that survive only on a limited number of host plant species, it is a matter of vital importance that their spores sense that they landed on the right spot to initiate germination as quickly as possible. We investigated a barley (Hordeum vulgare) mutant with reduced epicuticular leaf waxes on which spores of adapted and nonadapted powdery mildew fungi showed reduced germination. The barley gene responsible for the mutant wax phenotype was cloned in a forward genetic screen and identified to encode a 3-KETOACYL-CoA SYNTHASE (HvKCS6), a protein participating in fatty acid elongation and required for synthesis of epicuticular waxes. Gas chromatography-mass spectrometry analysis revealed that the mutant has significantly fewer aliphatic wax constituents with a chain length above C-24. Complementation of the mutant restored wild-type wax and overcame germination penalty, indicating that wax constituents less present on the mutant are a crucial clue for spore germination. Investigation of Arabidopsis (Arabidopsis thaliana) transgenic plants with sense silencing of Arabidopsis REQUIRED FOR CUTICULAR WAX PRODUCTION1, the HvKCS6 ortholog, revealed the same germination phenotype against adapted and nonadapted powdery mildew fungi. Our findings hint to an evolutionary conserved mechanism for sensing of plant surfaces among distantly related powdery mildews that is based on KCS6-derived wax components. Perception of such a signal must have been evolved before the monocot-dicot split took place approximately 150 million years ago. PMID:25201879

  16. 78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-09-04

    ...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

  17. Effect of maleic hydrazide and waxing on quality and shelf life of papaya (carica papaya L.) fruits

    International Nuclear Information System (INIS)

    Abu-Goukh, A. A.; Shattir, A. E.

    2012-01-01

    The effect of post harvest treatment of maleic hydrazide (MH) with and with out waxing on the quality and shelf-life of Baladi and Ekostika I papaya fruits at 18 ±1°C and 85%-90% relative humidity was evaluated. Maleic hydrazide at 250 and 500 ppm significantly delayed fruit ripening by two and three days in both papaya cultivars, respectively, compared with untreated fruits. The higher the concentration, the more was the delay in fruit ripening. The results also showed that waxing addition to MH resulted in a delay of two more days in fruit ripening that treatment with MH alone. The effect of MH and waxing treatments in delaying papaya fruits ripening was manifested in retarded respiratory climacteric, reduced weight loss and delayed fruit softening and increase in total soluble solids and ascorbic acid content.(Author)

  18. Fuel Pellets from Wheat Straw: The Effect of Lignin Glass Transition and Surface Waxes on Pelletizing Properties

    DEFF Research Database (Denmark)

    Stelte, Wolfgang; Clemons, Craig; Holm, Jens K.

    2012-01-01

    and a high concentration of hydrophobic waxes on its outer surface that may limit the pellet strength. The present work studies the impact of the lignin glass transition on the pelletizing properties of wheat straw. Furthermore, the effect of surface waxes on the pelletizing process and pellet strength...... are investigated by comparing wheat straw before and after organic solvent extraction. The lignin glass transition temperature for wheat straw and extracted wheat straw is determined by dynamic mechanical thermal analysis. At a moisture content of 8%, transitions are identified at 53°C and 63°C, respectively....... Pellets are pressed from wheat straw and straw where the waxes have been extracted from. Two pelletizing temperatures were chosen—one below and one above the glass transition temperature of lignin. The pellets compression strength, density, and fracture surface were compared to each other. Pellets pressed...

  19. Control of the wax moth Galleria mellonella L. (Lepidoptera: Pyralidae by the male sterile technique (MST

    Directory of Open Access Journals (Sweden)

    Jafari Reza

    2010-01-01

    Full Text Available In this study we examined the control of wax moth using the male sterile technique (MST with gamma-rays. To determine the safe and effective dosage of gamma-rays capable of sterilizing male pupae of the wax moth, male pupae were exposed to increasing single doses of gamma-rays (250, 300, 350 and 400 Gy. The release ratio of sterile to normal males was also studied in a similar experiment. Treatments included sterile males, normal males and virgin females at the following ratios: 1:1:1, 2:1:1, 3:1:1, 4:1:1 and 5:1:1. Possible parthenogenetic reproduction of this pest was also examined. The results showed that 350 Gy was the most effective dose capable of sterilizing the male pupae of the wax moth. The best release ratio was established at four sterile males, one normal male for each normal female (4:1:1. Also females were incapable of producing offspring without males.

  20. Investigation of Carnuba Wax as Matrix in the Formulation of Solid ...

    African Journals Online (AJOL)

    This study was carried out to investigate the drug entrapment efficiency, release potential and drug release mechanisms of solid lipid microparticles (SLMs) prepared with different concentrations of two non ionic surfactants using carnauba wax as the lipid matrix. SLMs were prepared by melt dispersion technique, whereby ...

  1. Carnauba wax as a promising excipient in melt granulation targeting the preparation of mini-tablets for sustained release of highly soluble drugs.

    Science.gov (United States)

    Nart, Viviane; Beringhs, André O'Reilly; França, Maria Terezinha; de Espíndola, Brenda; Pezzini, Bianca Ramos; Stulzer, Hellen Karine

    2017-01-01

    Mini-tablets are a new tendency in solid dosage form design for overcoming therapeutic obstacles such as impaired swallowing and polypharmacy therapy. Among their advantages, these systems offer therapeutic benefits such as dose flexibility and combined drug release patterns. The use of lipids in the formulation has also drawn considerable interest as means to modify the drug release from the dosage form. Therefore, this paper aimed at developing sustained release mini-tablets containing the highly soluble drugs captopril and metformin hydrochloride. Carnauba wax was used as a lipid component in melt granulation, targeting the improvement of the drugs poor flowability and tabletability, as well as to sustain the drug release profiles in association with other excipients. To assist sustaining the drug release, Ethocel™ (EC) and Kollicoat® SR 30D associated with Opadry® II were employed as matrix-forming and reservoir-forming materials, respectively. The neat drugs, granules and the bulk formulations were evaluated for their angle of repose, compressibility index, Hausner ratio and tabletability. Mini-tablets were evaluated for their weight variation, hardness, friability, drug content and in-vitro drug release. The results indicated that melt granulation with carnauba wax improved the flow and the tabletability of the drugs, allowing the preparation of mini-tablets with adequate tensile strength under reduced compaction pressures. All mini-tablet formulations showed acceptable hardness (within the range of 1.16 to 3.93Kp) and friability (carnauba wax proved to be a promising excipient in melt granulation targeting the preparation of mini-tablets for sustained release of soluble drugs. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Rapid fabrication of microfluidic polymer electrolyte membrane fuel cell in PDMS by surface patterning of perfluorinated ion-exchange resin

    Energy Technology Data Exchange (ETDEWEB)

    Song, Yong-Ak; Han, Jongyoon [Department of Electrical Engineering and Computer Science, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Department of Biological Engineering, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States); Batista, Candy [Roxbury Community College, 1234 Columbus Ave., Roxbury Crossing, MA 02120 (United States); Sarpeshkar, Rahul [Department of Electrical Engineering and Computer Science, Massachusetts Institute of Technology, 77 Massachusetts Ave., Cambridge, MA 02139 (United States)

    2008-09-01

    In this paper we demonstrate a simple and rapid fabrication method for a microfluidic polymer electrolyte membrane (PEM) fuel cell using polydimethylsiloxane (PDMS), which has become the de facto standard material in BioMEMS. Instead of integrating a Nafion sheet film between two layers of a PDMS device in a traditional ''sandwich format,'' we pattern a perfluorinated ion-exchange resin such as a Nafion resin on a glass substrate using a reversibly bonded PDMS microchannel to generate an ion-selective membrane between the fuel-cell electrodes. After this patterning step, the assembly of the microfluidic fuel cell is accomplished by simple oxygen plasma bonding between the PDMS chip and the glass substrate. In an example implementation, the planar PEM microfluidic fuel cell generates an open circuit voltage of 600-800 mV and delivers a maximum current output of nearly 4 {mu}A. To enhance the power output of the fuel cell we utilize self-assembled colloidal arrays as a support matrix for the Nafion resin. Such arrays allow us to increase the thickness of the ion-selective membrane to 20 {mu}m and increase the current output by 166%. Our novel fabrication method enables rapid prototyping of microfluidic fuel cells to study various ion-exchange resins for the polymer electrolyte membrane. Our work will facilitate the development of miniature, implantable, on-chip power sources for biomedical applications. (author)

  3. Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

    Directory of Open Access Journals (Sweden)

    Lesley Joan Collins

    2011-12-01

    Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

  4. Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

    Science.gov (United States)

    Collins, Lesley Joan

    2011-01-01

    ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

  5. A highly sensitive pressure sensor using a Au-patterned polydimethylsiloxane membrane for biosensing applications

    International Nuclear Information System (INIS)

    Liu, Xinchuan; Zhu, Yihao; Nomani, Md W; Koley, Goutam; Wen, Xuejun; Hsia, Tain-Yen

    2013-01-01

    We report on the fabrication and characterization of a highly sensitive pressure sensor using a Au film patterned on a polydimethylsiloxane (PDMS) membrane. The strain-induced change in the film resistance was utilized to perform the quantitative measurement of absolute pressure. The highest sensitivity obtained for a 200 µm thick PDMS film sensor was 0.23/KPa with a range of 50 mm Hg, which is the best result reported so far, over that range, for any pressure sensor on a flexible membrane. The noise-limited pressure resolution was found to be 0.9 Pa (0.007 mm Hg), and a response time of ∼200 ms, are the best reported results for these sensors. The ultrahigh sensitivity is attributed to the strain-induced formation of microcracks, the effect of which on the resistance change was found to be highly reversible within a certain pressure range. A physical model correlating the sensitivity with the sensor parameters and crack geometry has been proposed. (paper)

  6. Environmental controls on the 2H/1H values of terrestrial leaf waxes in the eastern Canadian Arctic

    Science.gov (United States)

    Shanahan, Timothy M.; Hughen, Konrad A.; Ampel, Linda; Sauer, Peter E.; Fornace, Kyrstin

    2013-10-01

    The hydrogen isotope composition of plant waxes preserved in lacustrine sediments is a potentially valuable tool for reconstructing paleoenvironmental changes in the Arctic. However, in contrast to the mid- and low-latitudes, significantly less effort has been directed towards understanding the factors controlling D/H fractionation in high latitude plant waxes and the impact of these processes on the interpretation of sedimentary leaf wax δD records. To better understand these processes, we examined the D/H ratios of long chain fatty acids in lake surface sediments spanning a temperature and precipitation gradient on Baffin Island in the eastern Canadian Arctic. D/H ratios of plant waxes increase with increasing temperature and aridity, with values ranging from -240‰ to -160‰ over the study area. Apparent fractionation factors between n-alkanoic acids in Arctic lake sediments and precipitation(εFA-ppt) are less negative than those of mid-latitude lakes and modern plants by 25‰ to 65‰, consistent with n-alkane data from modern Arctic plants (Yang et al., 2011). Furthermore, εFA-ppt values from Arctic lakes become systematically more positive with increasing evaporation, in contrast to mid-latitude sites, which show little to no change in fractionation with aridity. These data are consistent with enhanced water loss and isotope fractionation at higher latitude in the Arctic summer, when continuous sunlight supports increased daily photosynthesis. The dominant control on δDFA variations on Baffin Island is temperature. However, changing εFA-ppt result in steeper δDFA-temperature relationships than observed for modern precipitation. The application of this δDFA-based paleotemperature calibration to existing δDFA records from Baffin Island produces much more realistic changes in late Holocene temperature and highlights the importance of these effects in influencing the interpretation of Arctic δDFA records. A better understanding of the controls on

  7. In vitro and In vivo Characterisation of Piroxicam-Loaded Dika Wax ...

    African Journals Online (AJOL)

    Purpose: To formulate piroxicam-loaded lipospheres and evaluate their in vitro and in vivo properties. Method: Piroxicam-loaded lipospheres were prepared by hot homogenization technique using dika wax and Phospholipon® 90G (1:1, 1:2 and 2:1) as the lipid matrix. Characterisation, based on particle size

  8. Introducing Membrane Charge and Membrane Potential to T Cell Signaling

    Directory of Open Access Journals (Sweden)

    Yuanqing Ma

    2017-11-01

    Full Text Available While membrane models now include the heterogeneous distribution of lipids, the impact of membrane charges on regulating the association of proteins with the plasma membrane is often overlooked. Charged lipids are asymmetrically distributed between the two leaflets of the plasma membrane, resulting in the inner leaflet being negatively charged and a surface potential that attracts and binds positively charged ions, proteins, and peptide motifs. These interactions not only create a transmembrane potential but they can also facilitate the formation of charged membrane domains. Here, we reference fields outside of immunology in which consequences of membrane charge are better characterized to highlight important mechanisms. We then focus on T cell receptor (TCR signaling, reviewing the evidence that membrane charges and membrane-associated calcium regulate phosphorylation of the TCR–CD3 complex and discuss how the immunological synapse exhibits distinct patterns of membrane charge distribution. We propose that charged lipids, ions in solution, and transient protein interactions form a dynamic equilibrium during T cell activation.

  9. Composition of secondary alcohols, ketones, alkanediols, and ketols in Arabidopsis thaliana cuticular waxes

    Science.gov (United States)

    Wen, Miao; Jetter, Reinhard

    2009-01-01

    Arabidopsis wax components containing secondary functional groups were examined (i) to test the biosynthetic relationship between secondary alcohols and ketols and (ii) to determine the regiospecificity and substrate preference of the enzyme involved in ketol biosynthesis. The stem wax of Arabidopsis wild type contained homologous series of C27 to C31 secondary alcohols (2.4 μg cm−2) and C28 to C30 ketones (6.0 μg cm−2) dominated by C29 homologues. In addition, compound classes containing two secondary functional groups were identified as C29 diols (∼0.05 μg cm−2) and ketols (∼0.16 μg cm−2). All four compound classes showed characteristic isomer distributions, with functional groups located between C-14 and C-16. In the mah1 mutant stem wax, diols and ketols could not be detected, while the amounts of secondary alcohols and ketones were drastically reduced. In two MAH1-overexpressing lines, equal amounts of C29 and C31 secondary alcohols were detected. Based on the comparison of homologue and isomer compositions between the different genotypes, it can be concluded that biosynthetic pathways lead from alkanes to secondary alcohols, and via ketones or diols to ketols. It seems plausible that MAH1 is the hydroxylase enzyme involved in all these conversions in Arabidopsis thaliana. PMID:19346242

  10. Nephritogenic antigen determinants in epidermal and renal basement membranes of kindreds with Alport-type familial nephritis.

    Science.gov (United States)

    Kashtan, C; Fish, A J; Kleppel, M; Yoshioka, K; Michael, A F

    1986-10-01

    We probed epidermal basement membranes (EBM) of acid-urea denatured skin from members of kindreds with Alport-type familial nephritis (FN) for the presence of antigens reactive with Goodpasture sera (GPS) and serum (FNS) from an Alport patient who developed anti-glomerular basement membrane (GBM) nephritis in a renal allograft. By immunoblotting, GPS reacted primarily with the 28,000 molecular weight (mol wt) monomer but also the 24,000 mol wt and 26,000 mol wt monomers of the noncollagenous globular domain (NC1) of type IV collagen from normal human GBM, while FNS identified only the 26,000-mol wt monomer. FNS reacted with EBM of 12 controls and nine unaffected male kindred members but not EBM of eight affected males. Five affected females exhibited interrupted reactivity of FNS with EBM. GPS showed variable reactivity with EBM and was not discriminating with respect to Alport-type FN. FNS did not stain renal basement members of five affected males. However, the EBM, tubular basement membrane, and Bowman's capsules of affected males contained antigens reactive with GPS. These immunochemical studies suggest that the FNS antigen is distinct from Goodpasture antigen(s). The expression of FNS antigen located on the NC1 domain of type IV collagen is altered in basement membranes of patients with Alport-type FN, and the distribution of this antigenic anomaly within kindreds suggests X-linked dominant transmission of a defective gene.

  11. Antibacterial and antifungal effect of high pH and paraffin wax ...

    African Journals Online (AJOL)

    The antibacterial and antifungal effects of high pH (9, 10) and paraffin wax were determined. Determination of antibacterial and antifungal activity of the combined treatments was achieved by aerobic mesophilic count of bacteria and fungi on the surface of the tomatoes, peppers and oranges using serial dilution and pour ...

  12. A comparison of epicuticular wax of Pinus sylvestris needles from three sites in Ireland

    International Nuclear Information System (INIS)

    Donnelly, A.; Dowding, P.

    1994-01-01

    Three forest stands of Pinus sylvestris were chosen for comparison in Ireland. Needles from three year classes were collected. Cuticular transpiration curves showed that the rate of water loss from 1-year-old needles was faster than either 2-year-old or current-year needles at all sites. The amount of epicuticular wax extracted was similar to that reported in the literature. Needle wettability increased with needle age. Amorphous wax coverage was estimated using scanning electron microscopy (SEM) and was found to increase with needle age. Algal cells were noted on needles of all ages at one site and appeared to affect transpiration and microroughness. The presence of fungal hyphae was also noted. (orig.)

  13. Study of Plant Waxes Using Low Temperature Method for ESEM

    Czech Academy of Sciences Publication Activity Database

    Neděla, Vilém; Tihlaříková, Eva; Schiebertová, P.; Zajícová, I.; Schwarzerová, K.

    2016-01-01

    Roč. 22, S3 (2016), s. 1180-1181 ISSN 1431-9276 R&D Projects: GA ČR(CZ) GA14-22777S; GA MŠk ED0017/01/01 Grant - others:GA MŠk(CZ) LO1211 Institutional support: RVO:68081731 Keywords : ESEM * plant waxes * low temperature method Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.891, year: 2016

  14. "Wax bloom" on beeswax cultural heritage objects: exploring the causes of the phenomenon

    Czech Academy of Sciences Publication Activity Database

    Bartl, B.; Kobera, Libor; Drábková, K.; Ďurovič, M.; Brus, Jiří

    2015-01-01

    Roč. 53, č. 7 (2015), s. 509-513 ISSN 0749-1581 Institutional support: RVO:61389013 Keywords : 13-C NMR * wax bloom * efflorescence Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.226, year: 2015

  15. Phase Change Material Trade Study: A Comparison Between Wax and Water for Manned Spacecraft

    Science.gov (United States)

    Quinn, Gregory; Hodgson, Ed; Stephan, Ryan A,

    2011-01-01

    Phase change material heat sinks have been recognized as an important tool in optimizing thermal control systems for space exploration vehicles and habitats that must deal with widely varying thermal loads and environments. In order to better focus technology investment in this arena, NASA has supported a trade study with the objective of identifying where the best potential pay-off can be found among identified aqueous and paraffin wax phase change materials and phase change material heat sink design approaches. The study used a representative exploration mission with well understood parameters to support the trade. Additional sensitivity studies were performed to ensure the applicability of study results across varying systems and destinations. Results from the study indicate that replacing a wax PCM heat sink with a water ice PCM heat sink has the potential to decrease the equivalent system mass of the mission s vehicle through a combination of a smaller heat sink and a slight 5% increase in radiator size or the addition of a lightweight heat pump. An evaluation of existing and emerging PCM heat sink technologies indicates that further mass savings should be achievable through continued development of those technologies. The largest mass savings may be realized by eliminating the melting and freezing pressure of wax and water, respectively.

  16. Hydrodynamic and Membrane Binding Properties of Purified Rous Sarcoma Virus Gag Protein

    Energy Technology Data Exchange (ETDEWEB)

    Dick, Robert A.; Datta, Siddhartha A.K.; Nanda, Hirsh; Fang, Xianyang; Wen, Yi; Barros, Marilia; Wang, Yun-Xing; Rein, Alan; Vogt, Volker M. (NCI); (Cornell); (CM); (NIST)

    2016-05-06

    Previously, no retroviral Gag protein has been highly purified in milligram quantities and in a biologically relevant and active form. We have purified Rous sarcoma virus (RSV) Gag protein and in parallel several truncation mutants of Gag and have studied their biophysical properties and membrane interactionsin vitro. RSV Gag is unusual in that it is not naturally myristoylated. From its ability to assemble into virus-like particlesin vitro, we infer that RSV Gag is biologically active. By size exclusion chromatography and small-angle X-ray scattering, Gag in solution appears extended and flexible, in contrast to previous reports on unmyristoylated HIV-1 Gag, which is compact. However, by neutron reflectometry measurements of RSV Gag bound to a supported bilayer, the protein appears to adopt a more compact, folded-over conformation. At physiological ionic strength, purified Gag binds strongly to liposomes containing acidic lipids. This interaction is stimulated by physiological levels of phosphatidylinositol-(4,5)-bisphosphate [PI(4,5)P2] and by cholesterol. However, unlike HIV-1 Gag, RSV Gag shows no sensitivity to acyl chain saturation. In contrast with full-length RSV Gag, the purified MA domain of Gag binds to liposomes only weakly. Similarly, both an N-terminally truncated version of Gag that is missing the MA domain and a C-terminally truncated version that is missing the NC domain bind only weakly. These results imply that NC contributes to membrane interactionin vitro, either by directly contacting acidic lipids or by promoting Gag multimerization.

    Retroviruses like HIV assemble at and bud from the plasma membrane of cells. Assembly requires the interaction between thousands of Gag molecules to form a lattice. Previous work indicated that lattice formation at the plasma membrane is influenced by the conformation of monomeric HIV. We have extended this work to the more tractable RSV Gag. Our

  17. Designing maleic anhydride-{alpha}-olifin copolymeric combs as wax crystal growth nucleators

    Energy Technology Data Exchange (ETDEWEB)

    Soni, Hemant P. [Department of Chemistry, Faculty of Science, The Maharaja Sayajirao University of Baroda, Vadodara-390 002 (India); Kiranbala; Bharambe, D.P. [Department of Applied Chemistry, Faculty of Technology and Engineering, The Maharaja Sayajirao University of Baroda, Vadodara-390 001 (India); Agrawal, K.S. [Department of Petrochemical Technology, Polytechnic, The Maharaja Sayajirao University of Baroda, Vadodara-390 002 (India); Nagar, A. [MH ASSET, ONGC, Mumbai (India)

    2010-09-15

    Modification of the wax crystal habit is of great practical interest during transportation and processing of crude oil at low temperature. Various pour point depressant (PPD) additives can facilitate this modification by different mechanisms. Comb shaped polymer additives are known to depress the pour point of crude oil by providing different nucleation sites for the precipitation of wax. This paper describes performance based design, synthesis, characterization and evaluation of comb shaped polymeric diesters. Copolymers of maleic anhydride with different unsaturated C{sub 22} esters were synthesized and copolymers then reacted with two unsaturated fatty alcohols. All products were characterized by Fourier Transform Infra Red (FTIR) spectroscopy and Gel Permeation Chromatography (GPC). Rheological properties of crude (with and without additive) were studied by Advance Rheometer AR-500. In this study the additive based on oleic acid was evaluated as good PPD and rheology modifier. (author)

  18. SAXS-WAXS studies of the low-resolution structure in solution of xylose/glucose isomerase from Streptomyces rubiginosus

    Science.gov (United States)

    Kozak, Maciej; Taube, Michał

    2009-10-01

    The structure and conformation of molecule of xylose/glucose isomerase from Streptomyces rubiginosus in solution (at pH 6 and 7.6; with and without the substrate) has been studied by small- and wide-angle scattering of synchrotron radiation (SAXS-WAXS). On the basis of the SAXS-WAXS data, the low-resolution structure in solution has been reconstructed using ab inito methods. A comparison of the models of glucose isomerase shows only small differences between the model in solution and the crystal structure.

  19. The baryon vector current in the combined chiral and 1/Nc expansions

    Energy Technology Data Exchange (ETDEWEB)

    Flores-Mendieta, Ruben; Goity, Jose L [JLAB

    2014-12-01

    The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

  20. 33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

  1. A case of butane hash oil (marijuana wax)-induced psychosis.

    Science.gov (United States)

    Keller, Corey J; Chen, Evan C; Brodsky, Kimberly; Yoon, Jong H

    2016-01-01

    Marijuana is one of the most widely used controlled substances in the United States. Despite extensive research on smoked marijuana, little is known regarding the potential psychotropic effects of marijuana "wax," a high-potency form of marijuana that is gaining in popularity. The authors present a case of "Mr. B," a 34-year-old veteran who presented with profound psychosis in the setting of recent initiation of heavy, daily marijuana wax use. He exhibited incoherent speech and odd behaviors and appeared to be in a dream-like state with perseverating thoughts about his combat experience. His condition persisted despite treatment with risperidone 4 mg twice a day (BID), but improved dramatically on day 8 of hospitalization with the return of baseline mental function. Following discharge, Mr. B discontinued all marijuana use and did not exhibit the return of any psychotic symptoms. This study highlights the need for future research regarding the potential medical and psychiatric effects of new, high-potency forms of marijuana. Could cannabis have a dose-dependent impact on psychosis? What other potential psychiatric effects could emerge heretofore unseen in lower potency formulations? Given the recent legalization of marijuana, these questions merit timely exploration.

  2. Flow restrictor silicon membrane microvalve actuated by optically controlled paraffin phase transition

    International Nuclear Information System (INIS)

    Kolari, K; Havia, T; Stuns, I; Hjort, K

    2014-01-01

    Restrictor valves allow proportional control of fluid flow but are rarely integrated in microfluidic systems. In this study, an optically actuated silicon membrane restrictor microvalve is demonstrated. Its actuation is based on the phase transition of paraffin, using a paraffin wax mixed with a suitable concentration of optically absorbing nanographite particles. Backing up the membrane with oil (the melted paraffin) allows for a compliant yet strong contact to the valve seat, which enables handling of high pressures. At flow rates up to 30 µL min −1 and at a pressure of 2 bars, the valve can successfully be closed and control the flow level by restriction. The use of this paraffin composite as an adhesive layer sandwiched between the silicon valve and glass eases fabrication. This type of restrictor valve is best suited for high pressure, low volume flow silicon-based nanofluidic systems. (paper)

  3. Anti-botrytis activity in epicuticular waxes of young grape berries of Vitis vinifera (Pinot noir

    Directory of Open Access Journals (Sweden)

    Pascal Comménil

    1996-03-01

    The evidence of a substance which exhibits a strong inhibition on the conidial germination of Botrytis cinerea was made after epicuticular waxes chromatographic analysis and biological tests. This compound, characterized by a Rf (0,2 closely related to the Rf of the primary alcohols, was present in the wax extracts originated from bloom and immature grape berries stages and it was absent in the extracts issued to the mature grape berries. The concentration of the conidial germination inhibitor was markedly different between the sensible (S792 and tolerant (T7613 cultivars of Pinot vineyards. Also this antifungal product would be considereted as an hypothetical resistance marked against Botrytis cinerea.

  4. Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

    Science.gov (United States)

    Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

    1997-06-01

    Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

  5. Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

    Science.gov (United States)

    Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

    1997-01-01

    Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

  6. Autoimmune responses in patients with linear IgA bullous dermatosis: both autoantibodies and T lymphocytes recognize the NC16A domain of the BP180 molecule.

    Science.gov (United States)

    Lin, Mong-Shang; Fu, Chang-Ling; Olague-Marchan, Monica; Hacker, Mary K; Zillikens, Detlef; Giudice, George J; Fairley, Janet A

    2002-03-01

    Linear IgA bullous disease (LABD) is an autoimmune skin disease characterized by subepidermal blisters and IgA autoantibodies directed against the epidermal basement membrane zone (BMZ) of the skin. Various antigens have been identified as targets of IgA autoantibodies including BP180, a type II glycoprotein that spans the BMZ and lamina lucida. Previously, we have identified a subset of LABD patients whose sera contained IgA antibodies against the 16th noncollagenous (NC16A) domain of BP180. NC16A was previously shown to harbor epitopes that are recognized by both autoantibodies and T cells from patients with bullous pemphigoid and herpes gestationis and is thought to be associated with the development of these immunobullous diseases. The aim of this study was to determine whether T lymphocytes from LABD patients with anti-NC16A IgA autoantibodies respond to epitopes in the same region of the BP180 protein. Indeed, of the four LABD patients in our study, all had T cells that specifically proliferated in response to NC16A. Moreover, two subfragments of NC16A were identified as the predominant targets of LABD T cells. Further analysis of T cell lines and clones derived from these patients revealed that these cells express a CD4 memory T cell phenotype and secrete a Th1/Th2 mixed-cytokine profile, characteristics similar to those of T cells in bullous pemphigoid patients. Our data suggest that the BP180 protein, typically the NC16A region, is the common target of both cellular and humoral immune responses in some LABD patients. This information helps to further elucidate the autoimmune mechanisms in this disease.

  7. Physical characteristics of tetrahydroxy and acylated derivatives of jojoba liquid wax

    Science.gov (United States)

    Jojoba liquid wax is a mixture of esters of long chain fatty acids and fatty alcohols, mainly (C38:2-C46:2). The oil exhibits excellent emolliency on the skin and therefore is a component in many personal care cosmetic formulations. The virgin oil is a component of the seed of the Jojoba (Simmondsia...

  8. 5-Fluorouracil:carnauba wax microspheres for chemoembolization: an in vitro evaluation.

    Science.gov (United States)

    Benita, S; Zouai, O; Benoit, J P

    1986-09-01

    5-Fluorouracil:carnauba wax microspheres were prepared using a meltable dispersion process with the aid of a surfactant as a wetting agent. It was noted that only hydrophilic surfactants were able to wet the 5-fluorouracil and substantially increased its content in the microspheres. No marked effect was observed in the particle size distribution of the solid microspheres as a function of the nature of the surfactant. Increasing the stirring rate in the preparation process decreased, first, the mean droplet size of the emulsified melted dispersion in the vehicle during the heating process, and, consequently, the mean particle size of the solidified microspheres during the cooling process. 5-Fluorouracil cumulative release from the microspheres followed first-order kinetics, as shown by nonlinear regression analysis. Although the kinetic results were not indicative of the true release mechanism from a single microsphere, it was believed that 5-fluorouracil release from the microspheres was probably governed by a dissolution process, rather than by a leaching process through the carnauba wax microspheres.

  9. Paraffin wax passivation layer improvements in electrical characteristics of bottom gate amorphous indium–gallium–zinc oxide thin-film transistors

    International Nuclear Information System (INIS)

    Chang, Geng-Wei; Chang, Ting-Chang; Syu, Yong-En; Tsai, Tsung-Ming; Chang, Kuan-Chang; Tu, Chun-Hao; Jian, Fu-Yen; Hung, Ya-Chi; Tai, Ya-Hsiang

    2011-01-01

    In this research, paraffin wax is employed as the passivation layer of the bottom gate amorphous indium–gallium–zinc oxide thin-film transistors (a-IGZO TFTs), and it is formed by sol–gel process in the atmosphere. The high yield and low cost passivation layer of sol–gel process technology has attracted much attention for current flat-panel-display manufacturing. Comparing with passivation-free a-IGZO TFTs, passivated devices exhibit a superior stability against positive gate bias stress in different ambient gas, demonstrating that paraffin wax shows gas-resisting characteristics for a-IGZO TFTs application. Furthermore, light-induced stretch-out phenomenon for paraffin wax passivated device is suppressed. This superior stability of the passivated device was attributed to the reduced total density of states (DOS) including the interfacial and semiconductor bulk trap densities.

  10. The Effect of Paraffin Wax to Properties of Radiation Vulcanization Natural Rubber Latex (RVNRL)

    International Nuclear Information System (INIS)

    Mohd Noorwadi Mat Lazim; Sofian Ibrahim; Muhammad Saiful Omar

    2015-01-01

    Dipping factories often encounter a serious problem with high tackiness of the finish products during storage. The tackiness effect can be lead to rejection of products. This tackiness effect of natural (NR) rubber film originates in the free rubber chain ends at the surface of the film. The tackiness is not depends on the degree of crosslinking (vulcanization), since radiation itself unable to reduce the tackiness effect. The RVNRL requires addition of additive or anti-tack agent into formulation to reduce tackiness effect. In this experiment, paraffin wax manufactured by Emulco Sdn Bhd under the trade name Aquawax 48 was added into RVNRL formulation as anti-tack and the effect of paraffin wax to physical and mechanical properties of RVNRL was study. (author)

  11. Novel nanoparticulate carrier system based on carnauba wax and decyl oleate for the dispersion of inorganic sunscreens in aqueous media.

    Science.gov (United States)

    Villalobos-Hernández, J R; Müller-Goymann, C C

    2005-05-01

    The purpose of this study was to characterize carrier systems for inorganic sunscreens based on a matrix composed of carnauba wax and decyl oleate. Ultraviolet radiation attenuators like barium sulfate, strontium carbonate and titanium dioxide were tested. The lipid matrices were used either as capsules or as accompanying vehicles for the pigments in aqueous dispersions. Manufacturing was performed using high pressure homogenization at 300bar and a temperature of 75 degrees C. To evaluate the effect of the pigments on the crystalline structure of the wax-oil mixture, X-ray diffraction and differential scanning calorimetry were used. Further parameters determined were particle size, polydispersity index, z-potential, viscosity and sun protection factor (SPF). Transmission electron microscopy was also applied for visualization of nanoparticles. The X-ray diffraction patterns and the melting points of the lipid mixtures remained unchanged after the pigments were added. The particle sizes of the encapsulated species ranged from 239 to 749.9nm showing polydispersity values between 0.100 and 0.425. Surface charge measurements comprising values up to -40.8mV denoted the presence of stable dispersions. The formulations could be described as ideal viscous presenting viscosities in a range of 1.40-20.5mPas. Significant increases in SPF up to about 50 were reported after the encapsulation of titanium dioxide. Freeze fracture micrographs confirmed the presence of encapsulated inorganic crystals.

  12. Biodiesel from Jojoba oil-wax: Transesterification with methanol and properties as a fuel

    Energy Technology Data Exchange (ETDEWEB)

    Canoira, Laureano; Alcantara, Ramon; Garcia-Martinez, Jesus; Carrasco, Jesus [Department of Chemical Engineering and Fuels, School of Mines, Polytechnic University of Madrid, Rios Rosas 21, 28003-Madrid (Spain)

    2006-01-15

    The Jojoba oil-wax is extracted from the seeds of the Jojoba (Simmondsia chinensis Link Schneider), a perennial shrub that grows in semi desert areas in some parts of the world. The main uses of Jojoba oil-wax are in the cosmetics and pharmaceutical industry, but new uses could arise related to the search of new energetic crops. This paper summarizes a process to convert the Jojoba oil-wax to biodiesel by transesterification with methanol, catalysed with sodium methoxide (1wt% of the oil). The transesterification reaction has been carried out in an autoclave at 60 deg C, with a molar ratio methanol/oil 7.5:1, and vigorous stirring (600rpm), reaching a quantitative conversion of the oil after 4h. The separation of the fatty acid methyl esters (the fraction rich in FAME, 79% FAME mixture; 21% fatty alcohols; 51% of methyl cis-11-eicosenoate) from the fatty alcohols rich fraction (72% fatty alcohols; 28% FAME mixture; 26% of cis-11-eicosen-1-ol, 36% of cis-13-docosen-1-ol) has been accomplished in a single crystallization step at low temperature (-18 deg C) from low boiling point petroleum ether. The fraction rich in FAME has a density (at 15 deg C), a kinematic viscosity (at 40 deg C), a cold filter plugging point and a high calorific value in the range of the European standard for biodiesel (EN 14214)

  13. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G.

    2012-01-01

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct

  14. Patterning of super-hydrophobic structures on permeable sensor membranes

    NARCIS (Netherlands)

    Pelt, van S.; Eggermont, J.; Frijns, A.J.H.; Dietzel, A.H.; Colin, S; Morini, GL; Brandner, JJ

    2012-01-01

    For a disposable smart food monitoring system, a gas sensor membrane is needed that isolates the sensor surface from (dust) particles water droplets. At the same time, this membrane must have a high permeability, a sufficiently fast response times and should be water repellent to avoid blocking of

  15. Evaluation of thermal stability of paraffin wax by differential scanning calorimetry; Avaliacao da estabilidade termica de parafina por calorimetria diferencial de varredura

    Energy Technology Data Exchange (ETDEWEB)

    Godinho, K.O.; Silva, A.G.P.; Holanda, J.N.F. [Universidade Estadual do Norte Fluminense (LAMAV/UENF), Campos dos Goytacazes, RJ (Brazil). Grupo de Materiais Ceramicos], Email: holanda@uenf.br

    2010-07-01

    Phase change materials for heat storage are used as passive solar energy storage materials, which can be impregnated into construction materials. In this work the thermal stability (heating/cooling cycle) of the paraffin wax was investigated using differential scanning calorimetry. The latent heat and fusion temperature were determined for the following thermal cycles: 0, 30, 180 and 360. The thermal stability for paraffin wax infiltrated in support of gypsum was also determined. The experimental results showed that the paraffin wax showed good thermal stability in the states pure and infiltrated for up to 360 thermal cycles. (author)

  16. Cgl2 plays an essential role in cuticular wax biosynthesis in cabbage (Brassica oleracea L. var. capitata).

    Science.gov (United States)

    Liu, Dongming; Tang, Jun; Liu, Zezhou; Dong, Xin; Zhuang, Mu; Zhang, Yangyong; Lv, Honghao; Sun, Peitian; Liu, Yumei; Li, Zhansheng; Ye, Zhibiao; Fang, Zhiyuan; Yang, Limei

    2017-11-28

    The aerial parts of most land plants are covered with cuticular wax which is important for plants to avoid harmful factors. There is still no cloning study about wax synthesis gene of the alcohol-forming pathway in Brassica species. Scanning electron microscopy (SEM) showed that, compared with wild type (WT), wax crystal are severely reduced in both the adaxial and abaxial sides of cabbage (Brassica oleracea L. var. capitata L.) leaves from the LD10GL mutant. Genetic analysis results revealed that the glossy trait of LD10GL is controlled by a single recessive gene, and fine mapping results revealed that the target gene Cgl2 (Cabbage glossy 2) is located within a physical region of 170 kb on chromosome 1. Based on sequence analysis of the genes in the mapped region, the gene designated Bol013612 was speculated to be the candidate gene. Gene Bol013612 is homologous to Arabidopsis CER4, which encodes fatty acyl-coenzyme A reductase. Sequencing identified a single nucleotide substitution at an intron/exon boundary that results in an insertion of six nucleotides in the cDNA of Bol013612 in LD10GL. The phenotypic defect of LD10GL was confirmed by a functional complementation test with Arabidopsis mutant cer4. Our results indicated that wax crystals of cabbage mutant LD10GL are severely reduced and mutation of gene Bol013612 causes a glossy phenotype in the LD10GL mutant.

  17. Waxing and waning of abdominal organ 67Ga uptake in a male with lupus: a potential for organ-specific therapy

    International Nuclear Information System (INIS)

    Spencer, R.P.; Sziklas, J.J.; Rosenberg, R.J.

    1987-01-01

    A 33 year old male with a long history of lupus erythematosus, had serial radiogallium images. These showed a 'waxing and waning' of activity in the spleen and kidneys (coming and going of uptake). This may have been related to the changing pattern of vasculitis that occurs in lupus. The finding raises the possibility of ultilizing radiogallium to indicate individual organ involvement, and suggests that therapy of the involved organs might be tried (without necessarily attempting systemic therapy). Further work is needed to determine if patients with lupus are particularly susceptible to infection at the time that the spleen is involved (as shown by radiogallium accumulation), and whether antibiotics should be administered during such episodes. (author)

  18. Human serum albumin supported lipid patterns for the targeted recognition of microspheres coated by membrane based on ss-DNA hybridization

    International Nuclear Information System (INIS)

    Zhang Xiaoming; He Qiang; Cui Yue; Duan Li; Li Junbai

    2006-01-01

    Human serum albumin (HSA) patterns have been successfully fabricated for the deposition of lipid bilayer, 1,2-dimyristoyl-sglycerophosphate (DMPA), by making use of the micro-contact printing (μCP) technique and liposome fusion. Confocal laser scanning microscopy (CLSM) results indicate that lipid bilayer has been assembled in HSA patterns with a good stability. Such well-defined lipid patterns formed on HSA surface create possibility to incorporate specific components like channels or receptors for specific recognition. In view of this, microspheres coated with lipid membranes were immobilized in HSA-supported lipid patterns via the hybridization of complementary ss-DNAs. This procedure enables to transfer solid materials to a soft surface through a specific recognition

  19. Conservação de goiabas tratadas com emulsões de cera de carnaúba Postharvest conservation of guavas through carnauba wax emulsion applications

    Directory of Open Access Journals (Sweden)

    Angelo Pedro Jacomino

    2003-12-01

    Full Text Available A goiaba é um fruto muito perecível. Assim, objetivou-se avaliar os efeitos de ceras à base de carnaúba na conservação pós-colheita de goiabas Pedro Sato sob condição ambiente. Utilizaram-se cinco ceras comerciais: Citrosol AK (18%, Citrosol M (10%, Fruit wax (18 a 21%, Meghwax ECF-100 (30% e Cleantex wax (18,5 a 20,5%, as quais foram aplicadas manualmente, na proporção de 0,15 a 0,20mL por fruta. Frutas sem aplicação de cera foram utilizadas como controle. O delineamento experimental foi inteiramente casualizado com 6 tratamentos, 4 repetições e 5 frutas por parcela. As goiabas foram caracterizadas imediatamente após a colheita e avaliadas aos 2, 4 e 6 dias após a aplicação dos tratamentos. As ceras exerceram pouca influência nos teores de sólidos solúveis totais, acidez total titulável e ácido ascórbico, porém, foram eficientes em retardar o amadurecimento, reduzir a perda de massa e a incidência de podridões. A cera Meghwax ECF-100 apresenta potencial para utilização em goiabas, porém há necessidade de ser avaliada em maior diluição, para evitar alterações indesejáveis.Guavas are very perishable fruits. Therefore, the objective of the present work was to evaluate the effects of several carnauba based waxes in the postharvest life of Pedro Sato guavas under room conditions. Five commercial waxes were used: Citrosol AK (18%, Citrosol M (10%, Fruit wax (18 a 21%, Meghwax ECF-100 (30% e Cleantex wax (18,5 a 20,5%. The waxes were applied manualy in the rate of 0.15 to 0.20mL of wax per fruit. Control fruits were not treated. The experiment was conducted in a completely randomized design with 6 treatments, 4 replicates per treatment and 5 fruits as experimental unit. Guavas were evaluated at harvest and at every 2 days until the 6th day after treatments. Waxing had little effect on total soluble solids, total titratable acidity and ascorbic acid contents. However, the waxes were efficient in delaying ripening

  20. Membrane tension regulates clathrin-coated pit dynamics

    Science.gov (United States)

    Liu, Allen

    2014-03-01

    Intracellular organization depends on close communication between the extracellular environment and a network of cytoskeleton filaments. The interactions between cytoskeletal filaments and the plasma membrane lead to changes in membrane tension that in turns help regulate biological processes. Endocytosis is thought to be stimulated by low membrane tension and the removal of membrane increases membrane tension. While it is appreciated that the opposing effects of exocytosis and endocytosis have on keeping plasma membrane tension to a set point, it is not clear how membrane tension affects the dynamics of clathrin-coated pits (CCPs), the individual functional units of clathrin-mediated endocytosis. Furthermore, although it was recently shown that actin dynamics counteracts membrane tension during CCP formation, it is not clear what roles plasma membrane tension plays during CCP initiation. Based on the notion that plasma membrane tension is increased when the membrane area increases during cell spreading, we designed micro-patterned surfaces of different sizes to control the cell spreading sizes. Total internal reflection fluorescence microscopy of living cells and high content image analysis were used to quantify the dynamics of CCPs. We found that there is an increased proportion of CCPs with short (<20s) lifetime for cells on larger patterns. Interestingly, cells on larger patterns have higher CCP initiation density, an effect unexpected based on the conventional view of decreasing endocytosis with increasing membrane tension. Furthermore, by analyzing the intensity profiles of CCPs that were longer-lived, we found CCP intensity decreases with increasing cell size, indicating that the CCPs are smaller with increasing membrane tension. Finally, disruption of actin dynamics significantly increased the number of short-lived CCPs, but also decreased CCP initiation rate. Together, our study reveals new mechanistic insights into how plasma membrane tension regulates

  1. Pyro-electrification of polymer membranes for cell patterning

    Energy Technology Data Exchange (ETDEWEB)

    Rega, R.; Gennari, O.; Mecozzia, L.; Grilli, S.; Pagliarulo, V.; Ferraro, P. [National Council of Research, Institute of Applied Science & Intelligent Systems (ISASI) ‘E. Caianiello’, Via Campi Flegrei 34, 80078 Pozzuoli (Italy)

    2016-05-18

    In the recent years, much attention has been devoted to the possibility of charging polymer-based materials, due to their potential in developing large-scale and inexpensive flexible thin-film technology. The availability of localized electrostatic fields is in of great interest for a huge amount of applications such as distribution of biomolecules and cells from the liquid phase. Here we report a voltage-free pyro-electrification (PE) process able to induce permanent dipoles into polymer layers; the lithium niobate (LN) crystal is the key component that plays the multi-purpose role of sustaining, heating and poling the polymer layer that is then peeled-off easily in order to have a free-standing charged membrane. The results show the fascinating application for the living cell patterning. It well known that cell behaviour is affected by chemical and topographical cues of substrate. In fact, polymers, such as polystyrene (PS) and poly(methyl methacrylate) (PMMA), are naturally cytophobic and require specific functionalization treatments in order to promote cell adhesion. Through our proposal technique, it’s possible to obtain spontaneous organization and a driven growth of SH-SY5Y cells that is solely dictated by the nature of the charge polymer surface, opening, in this way, the innovative chance to manipulate and transfer biological samples on a free-standing polymer layer [1].

  2. Noise in NC-AFM measurements with significant tip–sample interaction

    Directory of Open Access Journals (Sweden)

    Jannis Lübbe

    2016-12-01

    Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

  3. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  4. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  5. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  6. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  7. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  8. Calculation of the store house worker dose in a lost wax foundry using MCNP-4C.

    Science.gov (United States)

    Alegría, Natalia; Legarda, Fernando; Herranz, Margarita; Idoeta, Raquel

    2005-01-01

    Lost wax casting is an industrial process which permits the transmutation into metal of models made in wax. The wax model is covered with a silicaceous shell of the required thickness and once this shell is built the set is heated and wax melted. Liquid metal is then cast into the shell replacing the wax. When the metal is cool, the shell is broken away in order to recover the metallic piece. In this process zircon sands are used for the preparation of the silicaceous shell. These sands have varying concentrations of natural radionuclides: 238U, 232Th and 235U together with their progenics. The zircon sand is distributed in bags of 50 kg, and 30 bags are on a pallet, weighing 1,500 kg. The pallets with the bags have dimensions 80 cm x 120 cm x 80 cm, and constitute the radiation source in this case. The only pathway of exposure to workers in the store house is external radiation. In this case there is no dust because the bags are closed and covered by plastic, the store house has a good ventilation rate and so radon accumulation is not possible. The workers do not touch with their hands the bags and consequently skin contamination will not take place. In this study all situations of external irradiation to the workers have been considered; transportation of the pallets from vehicle to store house, lifting the pallets to the shelf, resting of the stock on the shelf, getting down the pallets, and carrying the pallets to production area. Using MCNP-4C exposure situations have been simulated, considering that the source has a homogeneous composition, the minimum stock in the store house is constituted by 7 pallets, and the several distances between pallets and workers when they are at work. The photons flux obtained by MCNP-4C is multiplied by the conversion factor of Flux to Kerma for air by conversion factor to Effective Dose by Kerma unit, and by the number of emitted photons. Those conversion factors are obtained of ICRP 74 table 1 and table 17 respectively. This

  9. Calculation of the store house worker dose in a lost wax foundry using MCNP-4C

    International Nuclear Information System (INIS)

    Alegria, N.; Legarda, F.; Herranz, M.; Idoeta, R.

    2005-01-01

    Lost wax casting is an industrial process which permits the transmutation into metal of models made in wax. The wax model is covered with a siliceous shell of the required thickness and once this shell is built the set is heated and wax melted. Liquid metal is then cast into the shell replacing the wax. When the metal is cool, the shell is broken away in order to recover the metallic piece. In this process zircon sands are used for the preparation of the siliceous shell. These sands have varying concentrations of natural radionuclides: 238 U, 232 Th and 235 U together with their progenics. The zircon sand is distributed in bags of 50 kg, and 30 bags are on a pallet, weighing 1,500 kg. The pallets with the bags have dimensions 80 cm x 120 cm x 80 cm, and constitute the radiation source in this case. The only pathway of exposure to workers in the store house is external radiation. In this case there is no dust because the bags are closed and covered by plastic, the store house has a good ventilation rate and so radon accumulation is not possible. The workers do not touch with their hands the bags and consequently skin contamination will not take place. In this study all situations of external irradiation to the workers have been considered; transportation of the pallets from vehicle to store house, lifting the pallets to the shelf, resting of the stock on the shelf, getting down the pallets, and carrying the pallets to production area. Using MCNP-4C exposure situations have been simulated, considering that the source has a homogeneous composition, the minimum stock in the store house is constituted by 7 pallets, and the several distances between pallets and workers when they are at work. The photons flux obtained by MCNP-4C is multiplied by the conversion factor of Flux to Kerma for air by conversion factor to Effective Dose by Kerma unit, and by the number of emitted photons. Those conversion factors are obtained of ICRP 74 table 1 and table 17 respectively. This is

  10. Laser-assisted fabrication of batteries on wax paper

    International Nuclear Information System (INIS)

    Chitnis, G; Ziaie, B; Tan, T

    2013-01-01

    The functionality of paper-based diagnostic devices can be significantly enhanced by their integration with an on-board energy source. Here, we demonstrate the fabrication of paper-based electrochemical cells on wax paper using CO 2 laser surface treatment and micromachining. A four cell zinc–copper battery shows a steady open-circuit voltage of ∼3 V and can provide 0.25 mA for at least 30 min when connected to a 10 kΩ load. Higher voltages and current values can be obtained by adjusting the number and size of electrochemical cells in the battery without changing the fabrication process. (paper)

  11. Effect of enhanced UV-B radiation of adaxial leaf surface micromorphology and epicuticular wax biosynthesis of sugar maple

    International Nuclear Information System (INIS)

    Gordon, D.C.; Percy, K.E.; Riding, R.T.

    1998-01-01

    Sugar maple (Acer saccharum [Marsh.]) seedlings were exposed to UV-B BE ranging from 0.61 kJ m -2 d -1 to 12.48 kJ m -2 d -1 . Increasing UV-B intensity was associated with changes in micromorphological characteristics of the adaxial leaf surface. In vivo incorporation of [1- 14 C] acetate into sugar maple adaxial leaf surface epicuticular wax indicated (p<0.05) a UV-B sensitivity threshold at or near 6.2 kJ m -2 d -1 . Exposure to dosages greater than 6.2 kJ m -2 d -1 resulted in a significant (p<0.05) decrease in wax biosynthesis. The proportion of [1- 14 C] acetate incorporated into each of the different epicuticular wax classes changed with increasing UV-B. Incorporation of [1- 14 C] acetate into alkyl esters decreased while incorporation into alkanes increased with increasing UV-B dose. The effects of enhanced UV-B dose recorded in this experiment may have implications for cuticle function. (author)

  12. Constructing Repairable Meta-Structures of Ultra-Broad-Band Electromagnetic Absorption from Three-Dimensional Printed Patterned Shells.

    Science.gov (United States)

    Song, Wei-Li; Zhou, Zhili; Wang, Li-Chen; Cheng, Xiao-Dong; Chen, Mingji; He, Rujie; Chen, Haosen; Yang, Yazheng; Fang, Daining

    2017-12-13

    Ultra-broad-band electromagnetic absorption materials and structures are increasingly attractive for their critical role in competing with the advanced broad-band electromagnetic detection systems. Mechanically soft and weak wax-based materials composites are known to be insufficient to serve in practical electromagnetic absorption applications. To break through such barriers, here we developed an innovative strategy to enable the wax-based composites to be robust and repairable meta-structures by employing a three-dimensional (3D) printed polymeric patterned shell. Because of the integrated merits from both the dielectric loss wax-based composites and mechanically robust 3D printed shells, the as-fabricated meta-structures enable bear mechanical collision and compression, coupled with ultra-broad-band absorption (7-40 and 75-110 GHz, reflection loss  smaller than -10 dB) approaching state-of-the-art electromagnetic absorption materials. With the assistance of experiment and simulation methods, the design advantages and mechanism of employing such 3D printed shells for substantially promoting the electromagnetic absorption performance have been demonstrated. Therefore, such universal strategy that could be widely extended to other categories of wax-based composites highlights a smart stage on which high-performance practical multifunction meta-structures with ultra-broad-band electromagnetic absorption could be envisaged.

  13. Characterisation of wax works of art by gas chromatographic procedures.

    Science.gov (United States)

    Regert, M; Langlois, J; Colinart, S

    2005-10-14

    To identify the various natural and synthetic substances used by sculptors at the end of the 19th century, several contemporary reference samples were investigated by high temperature gas chromatography (HT GC) and HT GC-MS. Using specific chromatographic conditions and minimising sample preparation, we could separate, detect and identify a wide range of biomolecular markers covering a great variety of molecular weights and volatilities, with a minimum amount of sample, in a single run. Beeswax, spermaceti, carnauba, candellila and Japan waxes as well as pine resin derivatives, animal fats, paraffin, ozokerite and stearin, used as additives in wax works of art, were chemically investigated. In the case of low volatile compounds, transbutylation was performed. The structure of long-chain esters of spermaceti was elucidated for the first time by HT GC-MS analysis. Such a method was then carried out on 10 samples collected on a statuette of Junon by Antoine-Louis Barye (Louvre Museum, Paris, France) and on a sculpture by Aimé-Jules Dalou (Musée de la Révolution Française, Vizille, France). The analytical results obtained provide new data on the complex recipes elaborated by sculptors at the end of the 19th century.

  14. Fullerene inhibits benzo(a)pyrene Efflux from Cyprinus carpio hepatocytes by affecting cell membrane fluidity and P-glycoprotein expression.

    Science.gov (United States)

    Chen, Qiqing; Hu, Xialin; Wang, Rui; Yuan, Jin; Yin, Daqiang

    2016-05-01

    P-Glycoprotein (P-gp) can protect cells by pumping out toxic compounds, and has been found widely expressed in fish tissues. Here, we illustrate the P-gp efflux ability for benzo(a)pyrene (BaP) in the hepatocytes of common carp (Cyprinus carpio) after exposing to fullerene aqueous suspension (nC60). The results revealed that nC60 increased the membrane fluidity by decreasing the ratio of saturated to unsaturated fatty acids, and increased the cholesterol contents. These findings, combined with 10-38% and 70-75% down-regulation of P-gp mRNA and protein respectively, suggested that nC60 caused inhibition on P-gp efflux transport system. Therefore, we further investigated the cellular efflux ability for BaP. Results showed unequivocally that nC60 is a potent P-gp inhibitor. The retaining BaP amounts after efflux were elevated by 1.7-2.8 fold during the 10 day exposure. Meanwhile, 5mg/L humic acid (one of the important fractions of natural organic matter, which is ubiquitous in aquatic environment) alleviated the nC60 damage to hepatocytes in terms of oxidative damage, cholesterol increment, and P-gp content reduction; and finally attenuated the suppressed P-gp efflux ability. Collectively, this study provides the first evidence of nC60 toxicity to P-gp functionality in fish and illustrates the possible mechanism of the suppressed P-gp efflux ability for BaP. Copyright © 2016 Elsevier B.V. All rights reserved.

  15. Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

    Science.gov (United States)

    Das, Debajyoti; Mondal, Praloy

    2017-09-01

    Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

  16. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  17. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  18. Tröger’s Base Ladder Polymer for Membrane-Based Hydrocarbon Separation

    KAUST Repository

    Alhazmi, Abdulrahman

    2017-05-01

    The use of polymeric membranes for natural gas separation has rapidly increased during the past three decades, particularly for carbon dioxide separation from natural gas. Another valuable application is the separation of heavy hydrocarbons from methane (fuel gas conditioning), more importantly for remote area and off-shore applications. A new potential polymeric membrane that might be utilized for natural gas separations is a Tröger’s base ladder polymer (PIM-Trip-TB-2). This glassy polymeric membrane was synthesized by the polymerization reaction of 9, 10-dimethyl-2,6 (7) diaminotriptycene with dimethoxymethane. In this research, the polymer was selected due to its high surface area and highly interconnected microporous structure. Sorption isotherms of nitrogen (N2), oxygen (O¬2), methane (CH4), carbon dioxide (CO2), ethane (C2H6), propane (C3H8), and n-butane (n-C4H10) were measured at 35 °C over a range of pressures using a Hiden Intelligent Gravimetric Analyzer, IGA. The more condensable gases (C2H6, CO2, C3H8, and n-C4H10) showed high solubility due to their high affinity to the polymer matrix. The permeation coefficients were determined for various gases at 35 °C and pressure difference of 5 bar via the constant-pressure/variable-volume method. The PIM-Trip-TB-2 film exhibited high performance for several high-impact applications, such as O2/N2, H2/N2 and H2/CH4. Also, physical aging for several gases was examined by measuring the permeability coefficients at different periods of time. Moreover, a series of mixed-gas permeation tests was performed using 2 vol.% n-C4H10/98 vol.% CH4 and the results showed similar transport characteristics to other microporous polymers with pores of less than 2 nm. The work performed in this research suggested that PIM-Trip-TB-2 is suitable for the separation of: (i) higher hydrocarbons from methane and (ii) small, non-condensable gases such as O2/N2 and H2/CH4.

  19. A method to estimate the fractional fat volume within a ROI of a breast biopsy for WAXS applications: Animal tissue evaluation

    International Nuclear Information System (INIS)

    Tang, Robert Y.; McDonald, Nancy; Laamanen, Curtis; LeClair, Robert J.

    2014-01-01

    Purpose: To develop a method to estimate the mean fractional volume of fat (ν ¯ fat ) within a region of interest (ROI) of a tissue sample for wide-angle x-ray scatter (WAXS) applications. A scatter signal from the ROI was obtained and use of ν ¯ fat in a WAXS fat subtraction model provided a way to estimate the differential linear scattering coefficient μ s of the remaining fatless tissue. Methods: The efficacy of the method was tested using animal tissue from a local butcher shop. Formalin fixed samples, 5 mm in diameter 4 mm thick, were prepared. The two main tissue types were fat and meat (fibrous). Pure as well as composite samples consisting of a mixture of the two tissue types were analyzed. For the latter samples, ν fat for the tissue columns of interest were extracted from corresponding pixels in CCD digital x-ray images using a calibration curve. The means ν ¯ fat were then calculated for use in a WAXS fat subtraction model. For the WAXS measurements, the samples were interrogated with a 2.7 mm diameter 50 kV beam and the 6° scattered photons were detected with a CdTe detector subtending a solid angle of 7.75 × 10 −5 sr. Using the scatter spectrum, an estimate of the incident spectrum, and a scatter model, μ s was determined for the tissue in the ROI. For the composite samples, a WAXS fat subtraction model was used to estimate the μ s of the fibrous tissue in the ROI. This signal was compared to μ s of fibrous tissue obtained using a pure fibrous sample. Results: For chicken and beef composites, ν ¯ fat =0.33±0.05 and 0.32 ± 0.05, respectively. The subtractions of these fat components from the WAXS composite signals provided estimates of μ s for chicken and beef fibrous tissue. The differences between the estimates and μ s of fibrous obtained with a pure sample were calculated as a function of the momentum transfer x. A t-test showed that the mean of the differences did not vary from zero in a statistically significant way thereby

  20. Non-Invasive Delivery of dsRNA into De-Waxed Tick Eggs by Electroporation

    Science.gov (United States)

    Ruiz, Newton; de Abreu, Leonardo Araujo; Parizi, Luís Fernando; Kim, Tae Kwon; Mulenga, Albert; Braz, Gloria Regina Cardoso; Vaz, Itabajara da Silva; Logullo, Carlos

    2015-01-01

    RNA interference-mediated gene silencing was shown to be an efficient tool for validation of targets that may become anti-tick vaccine components. Here, we demonstrate the application of this approach in the validation of components of molecular signaling cascades, such as the Protein Kinase B (AKT) / Glycogen Synthase Kinase (GSK) axis during tick embryogenesis. It was shown that heptane and hypochlorite treatment of tick eggs can remove wax, affecting corium integrity and but not embryo development. Evidence of AKT and GSK dsRNA delivery into de-waxed eggs of via electroporation is provided. Primers designed to amplify part of the dsRNA delivered into the electroporated eggs dsRNA confirmed its entry in eggs. In addition, it was shown that electroporation is able to deliver the fluorescent stain, 4',6-diamidino-2-phenylindole (DAPI). To confirm gene silencing, a second set of primers was designed outside the dsRNA sequence of target gene. In this assay, the suppression of AKT and GSK transcripts (approximately 50% reduction in both genes) was demonstrated in 7-day-old eggs. Interestingly, silencing of GSK in 7-day-old eggs caused 25% reduction in hatching. Additionally, the effect of silencing AKT and GSK on embryo energy metabolism was evaluated. As expected, knockdown of AKT, which down regulates GSK, the suppressor of glycogen synthesis, decreased glycogen content in electroporated eggs. These data demonstrate that electroporation of de-waxed R. microplus eggs could be used for gene silencing in tick embryos, and improve the knowledge about arthropod embryogenesis. PMID:26091260

Some links on this page may take you to non-federal websites. Their policies may differ from this site.