Inheritance of gynandromorphism in the parasitic wasp Nasonia vitripennis
Kamping, Albert; Katju, Vaishali; Beukeboom, Leo W.; Werren, Jobn H.; Werren, John H.; Kaufman, T.C.
The parasitic wasp Nasonia vitripennis has haplo-diploid sex determination. Males develop from unfertilized eggs and are haploid, whereas females develop from fertilized eggs and are diploid. Females and males can be easily distinguished by their morphology. A strain that produces individuals with
Beukeboom, Leo W.; Kamping, Albert; van de Zande, Louis
Sex determining mechanisms are highly diverse. Like all Hymenoptera, the parasitic wasp Nasonia vitripennis reproduces by haplodiploidy: males are haploid and females are diploid. Sex in Nasonia is not determined by complementary alleles at sex loci. Evidence for several alternative models is
DNA Methylation and Sex Allocation in the Parasitoid Wasp Nasonia vitripennis.
Cook, Nicola; Pannebakker, Bart A; Tauber, Eran; Shuker, David M
2015-10-01
The role of epigenetics in the control and evolution of behavior is being increasingly recognized. Here we test whether DNA methylation influences patterns of adaptive sex allocation in the parasitoid wasp Nasonia vitripennis. Female N. vitripennis allocate offspring sex broadly in line with local mate competition (LMC) theory. However, recent theory has highlighted how genomic conflict may influence sex allocation under LMC, conflict that requires parent-of-origin information to be retained by alleles through some form of epigenetic signal. We manipulated whole-genome DNA methylation in N. vitripennis females using the hypomethylating agent 5-aza-2'-deoxycytidine. Across two replicated experiments, we show that disruption of DNA methylation does not ablate the facultative sex allocation response of females, as sex ratios still vary with cofoundress number as in the classical theory. However, sex ratios are generally shifted upward when DNA methylation is disrupted. Our data are consistent with predictions from genomic conflict over sex allocation theory and suggest that sex ratios may be closer to the optimum for maternally inherited alleles.
Haverkamp, A.; Smid, H.M.
2014-01-01
Octopamine is an important neuromodulator in the insect nervous system, influencing memory formation, sensory perception and motor control. In this study, we compare the distribution of octopamine-like immunoreactive neurons in two parasitic wasp species of the Nasonia genus, N. vitripennis and N.
Natural variation in long-term memory formation among Nasonia parasitic wasp species
Hoedjes, K.M.; Smid, H.M.
2014-01-01
Closely related species of parasitic wasps can differ substantially in memory dynamics. In this study we demonstrate differences in the number of conditioning trials required to form long-term memory between the closely related parasitic wasp species Nasonia vitripennis and Nasonia giraulti
Raychoudhury, R.; Grillenberger, B. K.; Gadau, J.; Bijlsma, R.; van de Zande, L.; Werren, J. H.; Beukeboom, L. W.
Here we report evidence of a mitochondrial-Wolbachia sweep in North American populations of the parasitoid wasp Nasonia vitripennis, a cosmopolitan species and emerging model organism for evolutionary and genetic studies. Analysis of the genetic variation of 89 N. vitripennis specimens from Europe
Cell cycle arrest in the jewel wasp Nasonia vitripennis in larval diapause.
Shimizu, Yuta; Mukai, Ayumu; Goto, Shin G
2018-04-01
Insects enter diapause to synchronise their life cycle with biotic and abiotic environmental conditions favourable for their development, reproduction, and survival. One of the most noticeable characteristics of diapause is the blockage of ontogeny. Although this blockage should occur with the cessation of cellular proliferation, i.e. cell cycle arrest, it was confirmed only in a few insect species and information on the molecular pathways involved in cell cycle arrest is limited. In the present study, we investigated developmental and cell cycle arrest in diapause larvae of the jewel wasp Nasonia vitripennis. Developmental and cell cycle arrest occur in the early fourth instar larval stage of N. vitripennis under short days. By entering diapause, the S fraction of the cell cycle disappears and approximately 80% and 20% of cells arrest their cell cycle in the G0/G1 and G2 phases, respectively. We further investigated expression of cell cycle regulatory genes and some housekeeping genes to dissect molecular mechanisms underlying the cell cycle arrest. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
B Vazirianzadeh
2008-12-01
Full Text Available "nBackground: Combination of cyromazine as an Insect Growth Regulator (IGR and Nasonia vitripennis (Hymenop¬tera: Pteromalidae a parasitic wasp may be an effective tool for reducing the house-fly populations in poultry houses and livestock farms. This study was conducted to assess the side effects of the IGR cyromazine on the level of parasit¬ism and numbers and the longevity of emerged N. vitripennis parasitoids from house fly pupae."nMethods: Cyromazine treated cloth target was used as the contaminating method of the parasitoids which was ap¬plied in this research study. "nResults: The Weibull distribution showed that there was no significant difference among controls and cyromazine treated targets for longevity data. There was no significant effect of cyromazine on the level of parasitism of N. vitripennis using 2 test. One-way ANOVA showed that the actual numbers emerging were significantly higher in the control than in two cyromazine treatments; however, it is a useful phenomenon because of reducing the hyperparasitism."nConclusion: There is a good consistency between using N. vitripennis and 1.1% or 0.9% cyromazine treated targets. There¬fore cyromazine treated targets can be applied as a safe delivery vehicle for applying the cyromazine IGR in the poultry houses and livestock farms in an Integrated Pest Management (IPM program.
Directory of Open Access Journals (Sweden)
B Vazirianzadeh
2008-12-01
Full Text Available Background: Combination of cyromazine as an Insect Growth Regulator (IGR and Nasonia vitripennis (Hymenop¬tera: Pteromalidae a parasitic wasp may be an effective tool for reducing the house-fly populations in poultry houses and livestock farms. This study was conducted to assess the side effects of the IGR cyromazine on the level of parasit¬ism and numbers and the longevity of emerged N. vitripennis parasitoids from house fly pupae.Methods: Cyromazine treated cloth target was used as the contaminating method of the parasitoids which was ap¬plied in this research study. Results: The Weibull distribution showed that there was no significant difference among controls and cyromazine treated targets for longevity data. There was no significant effect of cyromazine on the level of parasitism of N. vitripennis using 2 test. One-way ANOVA showed that the actual numbers emerging were significantly higher in the control than in two cyromazine treatments; however, it is a useful phenomenon because of reducing the hyperparasitism.Conclusion: There is a good consistency between using N. vitripennis and 1.1% or 0.9% cyromazine treated targets. There¬fore cyromazine treated targets can be applied as a safe delivery vehicle for applying the cyromazine IGR in the poultry houses and livestock farms in an Integrated Pest Management (IPM program.
Liu, Hai-Yang; Wang, Yan-Kun; Zhi, Cong-Cong; Xiao, Jin-Hua; Huang, Da-Wei
2014-06-01
Wolbachia are widespread in insects and can manipulate host reproduction. Nasonia vitripennis is a widely studied organism with a very high prevalence of Wolbachia infection. To study the effect of Wolbachia infection in Nasonia spp., it is important to obtain noninfected individuals by artificial methods. Current methods that employ sugar water-containing antibiotics can successfully eliminate Wolbachia from the parasitic wasps; however, treatment of at least three generations is required. Here, we describe a novel, feasible, and effective approach to eliminate Wolbachia from N. vitripennis by feeding fly pupae continuously offering antibiotics to Nasonia populations, which shortened the time to eliminate the pathogens to two generations. Additionally, the Wolbachia Uni and CauB strains have obviously different rifampicin-resistance abilities, which is a previously unknown phenomenon. © 2014 Federation of European Microbiological Societies. Published by John Wiley & Sons Ltd. All rights reserved.
Schurmann, Daria; Collatz, Jana; Hagenbucher, Steffen; Ruther, Joachim; Steidle, Johannes L. M.
2009-03-01
Associative learning of host-associated chemical cues was studied in Nasonia vitripennis, a parasitoid of fly pupae in nests of hole-nesting birds. When females encountered a fly pupa and performed one sequence of host recognition behaviour including drilling the ovipositor into the host in the presence of the artificial odour furfurylheptanoate (FFH), they were afterwards arrested by FFH in olfactometer experiments. The response vanished after 4 days and could be blocked after 3 days by feeding wasps with ethacrynic acid prior and after the training. This indicates the formation of an intermediate form of memory by one host experience in N. vitripennis. Interestingly, the trained wasps avoided odours that were not present during the host encounter, although naive wasps did not react to these odours. This unique behaviour probably causes wasps to focus during host searching on those chemical cues they have experienced in the host environment. Studies in nests of hole-nesting birds revealed that about 30% of all nests contained only one fly pupa, and laboratory studies showed that N. vitripennis females are able to parasitise around 100 fly pupae in their life. It is discussed that under these conditions, the formation of a non-permanent intermediate memory for host-associated odours after one host encounter is adaptive to avoid costs involved with formation and maintenance of memory for misleading cues. The demonstration of associative olfactory learning in N. vitripennis, the first parasitoid species with sequenced genome, opens the gate to study molecular mechanisms of memory formation and its ecological adaptation in parasitoids.
DEFF Research Database (Denmark)
Hauser, Frank; Neupert, Susanne; Williamson, Michael
2010-01-01
Neuropeptides and protein hormones constitute a very important group of signaling molecules, regulating central physiological processes such as reproduction, development, and behavior. Using a bioinformatics approach, we screened the recently sequenced genome of the parasitic wasp, Nasonia vitrip...... melanogaster, Aedes aegypti (both Diptera), Bombyx mori (Lepidoptera), Tribolium castaneum (Coleoptera), Apis mellifera (Hymenoptera), and Acyrthosiphon pisum (Hemiptera). This lower number of neuropeptide genes might be related to Nasonia's parasitic life....
Geuverink, Elzemiek; Rensink, Anna H; Rondeel, Inge; Beukeboom, Leo W; van de Zande, Louis; Verhulst, Eveline C
2017-11-01
In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with TRA2, encoded by a transformer-2 (tra2) ortholog, to act as a sex specific splicing regulator of the downstream transcription factors doublesex (dsx) and fruitless (fru). Here, we identify the tra2 ortholog of the haplodiploid parasitoid wasp N. vitripennis (Nv-tra2) and confirm its function in N. vitripennis sex determination. Knock down of Nv-tra2 by parental RNA interference (pRNAi) results in complete sex reversal of diploid offspring from female to male, indicating the requirement of Nv-tra2 for female sex determination. As Nv-tra2 pRNAi leads to frequent lethality in early developmental stages, maternal provision of Nv-tra2 transcripts is apparently also required for another, non-sex determining function during embryogenesis. In addition, lethality following Nv-tra2 pRNAi appears more pronounced in diploid than in haploid offspring. This diploid lethal effect was also observed following Nv-tra pRNAi, which served as a positive control in our experiments. As diploid embryos from fertilized eggs have a paternal chromosome set in addition to the maternal one, this suggests that either the presence of this paternal chromosome set or the dosage effect resulting from the diploid state is incompatible with the induced male development in N. vitripennis caused by either Nv-tra2 or Nv-tra pRNAi. The role of Nv-tra2 in activating the female sex determination pathway yields more insight into the sex determination mechanism of Nasonia. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.
Directory of Open Access Journals (Sweden)
Monika Bohacsova
Full Text Available Arsenophonus nasoniae, a male-killing endosymbiont of chalcid wasps, was recently detected in several hard tick species. Following the hypothesis that its presence in ticks may not be linked to the direct occurrence of bacteria in tick's organs, we identified A. nasoniae in wasps emerging from parasitised nymphs. We confirmed that 28.1% of Ixodiphagus hookeri wasps parasitizing Ixodes ricinus ticks were infected by A. nasoniae. Moreover, in examined I. ricinus nymphs, A. nasoniae was detected only in those, which were parasitized by the wasp. However, in part of the adult wasps as well as in some ticks that contained wasp's DNA, we did not confirm A. nasoniae. We also found, that in spite of reported male-killing, some newly emerged adult wasp males were also infected by A. nasoniae. Additionally, we amplified the DNA of Rickettsia helvetica and Rickettsia monacensis (known to be Ixodes ricinus-associated bacteria in adult parasitoid wasps. This may be related either with the digested bacterial DNA in wasp body lumen or with a role of wasps in circulation of rickettsiae among tick vectors.
Functional and evolutionary insights from the genomes of three parasitoid Nasonia species
DEFF Research Database (Denmark)
Werren, John H; Richards, Stephen; Desjardins, Christopher A
2010-01-01
We report here genome sequences and comparative analyses of three closely related parasitoid wasps: Nasonia vitripennis, N. giraulti, and N. longicornis. Parasitoids are important regulators of arthropod populations, including major agricultural pests and disease vectors, and Nasonia is an emerging...... of genes involved in nuclear-mitochondrial interactions that are implicated in speciation. Newly developed genome resources advance Nasonia for genetic research, accelerate mapping and cloning of quantitative trait loci, and will ultimately provide tools and knowledge for further increasing the utility...
Recombination and its impact on the genome of the haplodiploid parasitoid wasp Nasonia.
Directory of Open Access Journals (Sweden)
Oliver Niehuis
2010-01-01
Full Text Available Homologous meiotic recombination occurs in most sexually reproducing organisms, yet its evolutionary advantages are elusive. Previous research explored recombination in the honeybee, a eusocial hymenopteran with an exceptionally high genome-wide recombination rate. A comparable study in a non-social member of the Hymenoptera that would disentangle the impact of sociality from Hymenoptera-specific features such as haplodiploidy on the evolution of the high genome-wide recombination rate in social Hymenoptera is missing. Utilizing single-nucleotide polymorphisms (SNPs between two Nasonia parasitoid wasp genomes, we developed a SNP genotyping microarray to infer a high-density linkage map for Nasonia. The map comprises 1,255 markers with an average distance of 0.3 cM. The mapped markers enabled us to arrange 265 scaffolds of the Nasonia genome assembly 1.0 on the linkage map, representing 63.6% of the assembled N. vitripennis genome. We estimated a genome-wide recombination rate of 1.4-1.5 cM/Mb for Nasonia, which is less than one tenth of the rate reported for the honeybee. The local recombination rate in Nasonia is positively correlated with the distance to the center of the linkage groups, GC content, and the proportion of simple repeats. In contrast to the honeybee genome, gene density in the parasitoid wasp genome is positively associated with the recombination rate; regions of low recombination are characterized by fewer genes with larger introns and by a greater distance between genes. Finally, we found that genes in regions of the genome with a low recombination frequency tend to have a higher ratio of non-synonymous to synonymous substitutions, likely due to the accumulation of slightly deleterious non-synonymous substitutions. These findings are consistent with the hypothesis that recombination reduces interference between linked sites and thereby facilitates adaptive evolution and the purging of deleterious mutations. Our results imply
The paternal-sex-ratio (PSR) chromosome in natural populations of Nasonia (Hymenoptera Chalcidoidea)
Beukeboom, L.W.; Werren, J.H.
2000-01-01
Selfish genetic elements may be important in promoting evolutionary change. Paternal sex ratio (PSR) is a selfish B chromosome that causes all-male families in the haplodiploid parasitic wasp Nasonia vitripennis, by inducing paternal genome loss in fertilized eggs. The natural distribution and
Akbari, Omar S; Antoshechkin, Igor; Hay, Bruce A; Ferree, Patrick M
2013-09-04
A widespread phenomenon in nature is sex ratio distortion of arthropod populations caused by microbial and genetic parasites. Currently little is known about how these agents alter host developmental processes to favor one sex or the other. The paternal sex ratio (PSR) chromosome is a nonessential, paternally transmitted centric fragment that segregates in natural populations of the jewel wasp, Nasonia vitripennis. To persist, PSR is thought to modify the hereditary material of the developing sperm, with the result that all nuclear DNA other than the PSR chromosome is destroyed shortly after fertilization. This results in the conversion of a fertilized embryo--normally a female--into a male, thereby insuring transmission of the "selfish" PSR chromosome, and simultaneously leading to wasp populations that are male-biased. To begin to understand this system at the mechanistic level, we carried out transcriptional profiling of testis from WT and PSR-carrying males. We identified a number of transcripts that are differentially expressed between these conditions. We also discovered nine transcripts that are uniquely expressed from the PSR chromosome. Four of these PSR-specific transcripts encode putative proteins, whereas the others have very short open reading frames and no homology to known proteins, suggesting that they are long noncoding RNAs. We propose several different models for how these transcripts could facilitate PSR-dependent effects. Our analyses also revealed 15.71 MB of novel transcribed regions in the N. vitripennis genome, thus increasing the current annotation of total transcribed regions by 53.4%. Finally, we detected expression of multiple meiosis-related genes in the wasp testis, despite the lack of conventional meiosis in the male sex.
Directory of Open Access Journals (Sweden)
Renata da Silva Mello
2010-02-01
Full Text Available To test the assumption that exposure of the host to parasitoid for long periods could provoke superparasitism, the aim of this work was to test the consequences on the immature development time, productivity of parasitoids per pupa, sex ratio and rate of parasitism of Nasonia vitripennis bred in Chrysomya megacephala pupae. Each individual pupa was placed in a glass tube with one parasitoid female for 24, 48, 72 and 96 h period of exposure, under controlled laboratory conditions. Twenty replicates of each period were performed. ANOVA with a 5% significance level was applied. The 72 h exposure caused the immature development time to increase. The mean parasitoids emergence per pupa did not vary significantly with the time of exposure. There were a significantly higher number of females than males and a trend in sex ratio deviation towards the females in all of the treatments. An increase in the number of unviable pupae rates were observed with increased exposure time.Para testar a hipótese que longos períodos de exposição do hospedeiro ao parasitóide podem ocasionar o superparasitismo, o presente estudo teve como objetivo testar as conseqüências sobre o tempo de desenvolvimento do imaturo, a produtividade de parasitóides, razão sexual e taxa de parasitismo de Nasonia vitripennis criadas em pupas de Chrysomya megacephala. Cada pupa foi individualizada e alocada em um tudo de ensaio com uma fêmea de N. vitripennis por 24, 48, 72 ou 96 h, sob condições laboratoriais controladas. Foram realizadas 20 réplicas para cada período de exposição. ANOVA com significância de 5 % foi aplicada. A exposição de 72 h causou um aumento no tempo desenvolvimento. A média de emergência de parasitóides não variou significativamente entre os tempos de exposição. Houve um número significativamente maior de fêmeas e uma tendência ao desvio da razão sexual para fêmeas em todos os tratamentos. Foi verificado um aumento no número de pupas invi
Directory of Open Access Journals (Sweden)
David B. Rivers
2011-01-01
Full Text Available This study tested the hypothesis that venom from the ectoparasitic wasp Nasonia vitripennis targets brain tissue and fat body from its flesh fly host, Sarcophaga bullata. By 1 h postenvenomation, some brain neurons began to show irregularities in nuclear shape, and though they were predominately euchromatic, there was evidence of heterochromatin formation. Irregularity in the nuclear envelope became more prominent by 3 h after envenomation, as did the condensation of heterochromatin. The severity of ultrastructural changes continued to increase until at least 24 h after parasitoid attack. At this point, cellular swelling and extensive heterochromatic inclusions were evident, multivesicular bodies occurred in the cytoplasm of some cells, and the rough endoplasmic reticulum was dilated in many of the cells. Immunohistochemical staining revealed significant apoptosis in neurons located in brain tissues. By contrast, there was no evidence of any morphological or ultrastructural disturbances in fat body tissues up to 24 h after envenomation, nor did any of the cells display signs of cell death.
Danneels, Ellen L.; Gerlo, Sarah; Heyninck, Karen; Van Craenenbroeck, Kathleen; De Bosscher, Karolien; Haegeman, Guy; de Graaf, Dirk C.
2014-01-01
With more than 150,000 species, parasitoids are a large group of hymenopteran insects that inject venom into and then lay their eggs in or on other insects, eventually killing the hosts. Their venoms have evolved into different mechanisms for manipulating host immunity, physiology and behavior in such a way that enhance development of the parasitoid young. The venom from the ectoparasitoid Nasonia vitripennis inhibits the immune system in its host organism in order to protect their offspring from elimination. Since the major innate immune pathways in insects, the Toll and Imd pathways, are homologous to the NF-κB pathway in mammals, we were interested in whether a similar immune suppression seen in insects could be elicited in a mammalian cell system. A well characterized NF-κB reporter gene assay in fibrosarcoma cells showed a dose-dependent inhibition of NF-κB signaling caused by the venom. In line with this NF-κB inhibitory action, N. vitripennis venom dampened the expression of IL-6, a prototypical proinflammatory cytokine, from LPS-treated macrophages. The venom also inhibited the expression of two NF-κB target genes, IκBα and A20, that act in a negative feedback loop to prevent excessive NF-κB activity. Surprisingly, we did not detect any effect of the venom on the early events in the canonical NF-κB activation pathway, leading to NF-κB nuclear translocation, which was unaltered in venom-treated cells. The MAP kinases ERK, p38 and JNK are other crucial regulators of immune responses. We observed that venom treatment did not affect p38 and ERK activation, but induced a prolonged JNK activation. In summary, our data indicate that venom from N. vitripennis inhibits NF-κB signaling in mammalian cells. We identify venom-induced up regulation of the glucocorticoid receptor-regulated GILZ as a most likely molecular mediator for this inhibition. PMID:24821138
Circadian rhythms differ between sexes and closely related species of Nasonia wasps.
Directory of Open Access Journals (Sweden)
Rinaldo C Bertossa
Full Text Available Activity rhythms in 24 h light-dark cycles, constant darkness, and constant light conditions were analyzed in four different Nasonia species for each sex separately. Besides similarities, clear differences are evident among and within Nasonia species as well as between sexes. In all species, activity in a light-dark cycle is concentrated in the photophase, typical for diurnal organisms. Contrary to most diurnal insect species so far studied, Nasonia follows Aschoff's rule by displaying long (>24 h internal rhythms in constant darkness but short (<24 h in constant light. In constant light, N. vitripennis males display robust circadian activity rhythms, whereas females are usually arrhythmic. In contrast to other Nasonia species, N. longicornis males display anticipatory activity, i.e. activity shortly before light-on in a light-dark cycle. As expected, N. oneida shows activity patterns similar to those of N. giraulti but with important differences in key circadian parameters. Differences in circadian activity patterns and parameters between species may reflect synchronization of specific life-history traits to environmental conditions. Scheduling mating or dispersion to a specific time of the day could be a strategy to avoid interspecific hybridization in Nasonia species that live in sympatry.
Data from: Development of a Nasonia vitripennis outbred laboratory population for genetic analysis
Zande, van de L.; Ferber, S.; Haan, de A.; Beukeboom, L.W.; Heerwaarden, van J.; Pannebakker, B.A.
2013-01-01
The parasitoid wasp genus Nasonia has rapidly become a genetic model system for developmental and evolutionary biology. The release of its genome sequence led to the development of high-resolution genomic tools, for both interspecific and intraspecific research, which has resulted in great advances
Quantitative trait locus analysis of mating behavior and male sex pheromones in Nasonia wasps
Diao, Wenwen; Mousset, Mathilde; Horsburgh, Gavin J.; Vermeulen, Cornelis J.; Johannes, Frank; van de Zande, Louis; Ritchie, Michael G.; Schmitt, Thomas; Beukeboom, Leo W.
A major focus in speciation genetics is to identify the chromosomal regions and genes that reduce hybridization and gene flow. We investigated the genetic architecture of mating behavior in the parasitoid wasp species pair Nasonia giraulti and Nasonia oneida that exhibit strong prezygotic isolation.
Koevoets, T; Niehuis, O; van de Zande, L; Beukeboom, L W
2012-03-01
The occurrence of hybrid incompatibilities forms an important stage during the evolution of reproductive isolation. In early stages of speciation, males and females often respond differently to hybridization. Haldane's rule states that the heterogametic sex suffers more from hybridization than the homogametic sex. Although haplodiploid reproduction (haploid males, diploid females) does not involve sex chromosomes, sex-specific incompatibilities are predicted to be prevalent in haplodiploid species. Here, we evaluate the effect of sex/ploidy level on hybrid incompatibilities and locate genomic regions that cause increased mortality rates in hybrid males of the haplodiploid wasps Nasonia vitripennis and Nasonia longicornis. Our data show that diploid F(1) hybrid females suffer less from hybridization than haploid F(2) hybrid males. The latter not only suffer from an increased mortality rate, but also from behavioural and spermatogenic sterility. Genetic mapping in recombinant F(2) male hybrids revealed that the observed hybrid mortality is most likely due to a disruption of cytonuclear interactions. As these sex-specific hybrid incompatibilities follow predictions based on Haldane's rule, our data accentuate the need to broaden the view of Haldane's rule to include species with haplodiploid sex determination, consistent with Haldane's original definition.
Disentangling a holobiont – recent advances and perspectives in Nasonia wasps
Directory of Open Access Journals (Sweden)
Jessica Dittmer
2016-09-01
Full Text Available The parasitoid wasp genus Nasonia (Hymenoptera: Chalcidoidea is a well-established model organism for insect development, evolutionary genetics, speciation and symbiosis. The host-microbiota assemblage which constitutes the Nasonia holobiont (a host together with all its associated microbes consists of viruses, two heritable bacterial symbionts and a bacterial community dominated in abundance by a few taxa in the gut. In the wild, all four Nasonia species are systematically infected with the obligate intracellular bacterium Wolbachia and can additionally be co-infected with Arsenophonus nasoniae. These two reproductive parasites have different transmission modes and host manipulations (cytoplasmic incompatibility vs. male-killing, respectively. Pioneering studies on Wolbachia in Nasonia demonstrated that closely-related Nasonia species harbor multiple and mutually incompatible Wolbachia strains, resulting in strong symbiont-mediated reproductive barriers that evolved early in the speciation process. Moreover, research on host-symbiont interactions and speciation has recently broadened from its historical focus on heritable symbionts to the entire microbial community. In this context, each Nasonia species hosts a distinguishable community of gut bacteria that experiences a temporal succession during host development and members of this bacterial community cause strong hybrid lethality during larval development. In this review, we present the Nasonia species complex as a model system to experimentally investigate questions regarding: (i the impact of different microbes, including (but not limited to heritable endosymbionts, on the extended phenotype of the holobiont, (ii the establishment and regulation of a species-specific microbiota, (iii the role of the microbiota in speciation, and (iv the resilience and adaptability of the microbiota in wild populations subjected to different environmental pressures. We discuss the potential for easy
Directory of Open Access Journals (Sweden)
Marlène Chirault
Full Text Available In recent years, several studies have shown a decline in reproductive success in males in both humans and wildlife. Research on male fertility has largely focused on vertebrates, although invertebrates constitute the vast majority of terrestrial biodiversity. The reduction of their reproductive capacities due to environmental stresses can have strong negative ecological impacts, and also dramatic consequences on world food production if it affects the reproductive success of biological control agents, such as parasitic wasps used to control crop pests. Here Nasonia vitripennis, a parasitic wasp of various fly species, was studied to test the effects of 24h-heat stress applied during the first pupal stage on male fertility. Results showed that only primary spermatocytes were present at the first pupal stage in all cysts of the testes. Heat stress caused a delay in spermatogenesis during development and a significant decrease in sperm stock at emergence. Females mated with these heat-stressed males showed a reduce sperm count stored in their spermatheca. Females did not appear to distinguish heat-stressed from control males and did not remate more frequently to compensate for the lack of sperm transferred. As a result, females mated with heat-stressed males produced a suboptimal lifetime offspring sex ratio compared to those mated with control males. This could further impact the population dynamics of this species. N. vitripennis appears to be an interesting biological model to study the mechanisms of subfertility and its consequence on female reproductive strategies and provides new research perspectives in both invertebrates and vertebrates.
Chirault, Marlène; Lucas, Christophe; Goubault, Marlène; Chevrier, Claude; Bressac, Christophe; Lécureuil, Charlotte
2015-01-01
In recent years, several studies have shown a decline in reproductive success in males in both humans and wildlife. Research on male fertility has largely focused on vertebrates, although invertebrates constitute the vast majority of terrestrial biodiversity. The reduction of their reproductive capacities due to environmental stresses can have strong negative ecological impacts, and also dramatic consequences on world food production if it affects the reproductive success of biological control agents, such as parasitic wasps used to control crop pests. Here Nasonia vitripennis, a parasitic wasp of various fly species, was studied to test the effects of 24h-heat stress applied during the first pupal stage on male fertility. Results showed that only primary spermatocytes were present at the first pupal stage in all cysts of the testes. Heat stress caused a delay in spermatogenesis during development and a significant decrease in sperm stock at emergence. Females mated with these heat-stressed males showed a reduce sperm count stored in their spermatheca. Females did not appear to distinguish heat-stressed from control males and did not remate more frequently to compensate for the lack of sperm transferred. As a result, females mated with heat-stressed males produced a suboptimal lifetime offspring sex ratio compared to those mated with control males. This could further impact the population dynamics of this species. N. vitripennis appears to be an interesting biological model to study the mechanisms of subfertility and its consequence on female reproductive strategies and provides new research perspectives in both invertebrates and vertebrates.
A role for sexual conflict in the evolution of reproductive traits in Nasonia wasps?
Geuverink, Elzemiek; Gerritsma, Sylvia; Pannebakker, Bart A.; Beukeboom, Leo W.
2009-01-01
Sexual conflict theory predicts that female and male reproductive traits coevolve resulting in disruption of reproductive behaviour upon mating of individuals from diverged populations. We used interfertile species of haplodiploid Nasonia wasps to compare re-mating frequency, longevity, oviposition
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
The parasitoid wasp Nasonia vitripennis reproduces by haplodiploidy; males are haploid and females are diploid. Sex determination in Nasonia is not governed by complementary alleles at one or more sex loci. As in most other insects, the sex-determining pathway consists of the basal switch doublesex that is ...
Zhang, Zhong; Ye, Gong-Yin; Cai, Jun; Hu, Cui
2005-09-01
Crude venoms from two parasitoid species, Pteromalus puparum and Nasonia vitripennis (Hymenoptera: Pteromalidae) were assayed for biological activities toward hemocytes from two species of their natural hosts and eight species of their non-natural hosts as well as two lines of cultured Lepidoptera cells, respectively. By inhibiting the spreading and viability of insect hemocytes, the venom from P. puparum displayed significantly higher activities toward plasmatocytes and granular cells from both larvae and pupae of two natural hosts, Pieris rapae and Papilio xuthus, and lower activity toward those from Spodoptera litura, Musca domestica and Sarcophaga peregrina. However, no effect was found towards any type of hemocytes from other five insects tested, namely, Ectropis oblique, Galleria mellonella, Sesamia inferens, Bombyx mori and Parnara guttata. In contrast, the venom from N. vitripennis showed a narrower range of targeted insects. It appeared to have highly adverse effects on the spreading and viability of plasmatocytes and granular cells only from the natural hosts, M. domestica and S. peregrina, little toxicity to cells from P. rapae and P. xuthus, and no effect on any of the other insects tested. Pteromalus puparum venom also apparently presented a high ability to block the spreading of Tn-5B1-4 cells derived from Trichoplusia ni, and high cytotoxicity to the cells and Ha cells derived from Helicoverpa armigera. Nasonia vitripennis venom, however, only had a marked lethal effect to Ha cells. In addition, the possibility that the host range of a defined parasitoid could be assessed using our method of treating hemocytes from candidate insects with venom in vitro, and the potential of our venoms tested in the development of bio-insecticides, insect-resistant transgenic plants, are discussed.
Yan, Zhichao; Fang, Qi; Wang, Lei; Liu, Jinding; Zhu, Yu; Wang, Fei; Li, Fei; Werren, John H; Ye, Gongyin
2016-01-25
Parasitoid wasps are abundant and diverse hymenopteran insects that lay their eggs into the internal body (endoparasitoid) or on the external surface (ectoparasitoid) of their hosts. To make a more conducive environment for the wasps' young, both ecto- and endoparasitoids inject venoms into the host to modulate host immunity, metabolism and development. Endoparasitoids have evolved from ectoparasitoids independently in different hymenopteran lineages. Pteromalus puparum, a pupal endoparasitoid of various butterflies, represents a relatively recent evolution of endoparasitism within pteromalids. Using a combination of transcriptomic and proteomic approaches, we have identified 70 putative venom proteins in P. puparum. Most of them show higher similarity to venom proteins from the related ectoparasitoid Nasonia vitripennis than from other more distantly related endoparasitoids. In addition, 13 venom proteins are similar to venoms of distantly related endoparasitoids but have no detectable venom matches in Nasonia. These venom proteins may have a role in adaptation to endoparasitism. Overall, these results lay the groundwork for more detailed studies of venom function and adaptation to the endoparasitic lifestyle.
Behavioral and spermatogenic hybrid male breakdown in Nasonia.
Clark, M E; O'Hara, F P; Chawla, A; Werren, J H
2010-03-01
Several reproductive barriers exist within the Nasonia species complex, including allopatry, premating behavioral isolation, postzygotic inviability and Wolbachia-induced cytoplasmic incompatibility. Here we show that hybrid males suffer two additional reproductive disadvantages, an inability to properly court females and decreased sperm production. Hybrid behavioral sterility, characterized by a reduced ability of hybrids to perform necessary courtship behaviors, occurs in hybrids between two species of Nasonia. Hybrid males produced in crosses between N. vitripennis and N. giraulti courted females at a reduced frequency (23-69%), compared with wild-type N. vitripennis and N. giraulti males (>93%). Reduced courtship frequency was not a simple function of inactivity among hybrids. A strong effect of cytoplasmic (mitochondrial) background was also found in N. vitripennis and N. giraulti crosses; F2 hybrids with giraulti cytoplasm showing reduced ability at most stages of courtship. Hybrids produced between a younger species pair, N. giraulti and N. longicornis, were behaviorally fertile. All males possessed motile sperm, but sperm production is greatly reduced in hybrids between the older species pair, N. vitripennis and N. giraulti. This effect on hybrid males, lowered sperm counts rather than nonfunctional sperm, is different from most described cases of hybrid male sterility, and may represent an earlier stage of hybrid sperm breakdown. The results add to previous studies of F2 hybrid inviability and behavioral sterility, and indicate that Wolbachia-induced hybrid incompatibility has arisen early in species divergence, relative to behavioral sterility and spermatogenic infertility.
Behavioural and spermatogenic hybrid male breakdown in Nasonia
Clark, Michael E.; O’Hara, F. Patrick; Chawla, Ankur; Werren, John H.
2010-01-01
Several reproductive barriers exists within the Nasonia species complex, including allopatry, premating behavioural isolation, postzygotic inviability and Wolbachia-induced cytoplasmic incompatibility. Here we show that hybrid males suffer two additional reproductive disadvantages, an inability to properly court females and decreased sperm production. Hybrid behavioural sterility, characterized by a reduced ability of hybrids to perform necessary courtship behaviours, occurs in hybrids between two species of Nasonia. Hybrid males produced in crosses between N. vitripennis and N. giraulti courted females at a reduced frequency (23-69%), compared to wild-type N. vitripennis and N. giraulti males (>93%). Reduced courtship frequency was not a simple function of inactivity among hybrids. A strong effect of cytoplasmic (mitochondrial) background was also found in N. vitripennis and N. giraulti crosses; F2 hybrids with giraulti cytoplasm showing reduced ability at most stages of courtship. Hybrids produced between a younger species pair, N. giraulti and N. longicornis, were behaviourally fertile. All males possessed motile sperm, but sperm production is greatly reduced in hybrids between the older species pair, N. vitripennis and N. giraulti. This effect on hybrid males, lowered sperm counts rather than non-functional sperm, is different from most described cases of hybrid male sterility and may represent an earlier stage of hybrid sperm breakdown. The results add to previous studies of F2 hybrid inviability and behavioural sterility, and indicated that Wolbachia induced hybrid incompatibility has arisen early in species divergence, relative to behavioural sterility and spermatogenic infertility. PMID:20087395
Directory of Open Access Journals (Sweden)
Eliane Maria Vieira Milward-de-Azevedo
2004-02-01
Full Text Available Avaliou-se o desempenho reprodutivo de Nasonia vitripennis Walker (Hymenoptera: Pteromalidae em pupas de Chrysomya megacephala Fabricius (Diptera: Calliphoridae previamente armazenadas a - 20ºC de temperatura, durante 77 dias, com e sem passagem prévia em nitrogênio líquido (NL por um, três e 15 minutos. O grupo controle foi caracterizado por pupas hospedeiras frescas. Os muscóides foram expostos aos parasitóides durante 72 horas. Utilizou-se a relação de uma pupa muscóide por fêmea parasitóide. A amostra de pupas frescas permitiu a emergência de 15 parasitóides/ pupa, em média, enquanto 10 parasitóides / pupa emergiram dos espécimens prévia e diretamente armazenados em freezer (-20ºC. Observou-se um acentuado decréscimo do desempenho reprodutivo dos microhimenópteros que exploraram os substratos previamente submetidos ao NL durante um, três e 15 minutos (: 6,1; 5,5 e 5,7, respectivamente. A dissecação das pupas hospedeiras revelou um expressivo número de pteromalídeos imaturos, nas amostras que foram expostas ao NL, e de adultos faratos, em todos os tratamentosThe reproductive performance of Nasonia vitripennis Walker (Hymenoptera: Pteromalidae was evaluated on pupae of Chrysomya megacephala Fabricius (Diptera: Calliphoridae kept at -20ºC, during 77 days, with and no previous passage for liquid nitrogen (NL by one, three and 15 minutes. Control groups were characterized for fresh pupae hosts. There was one pupa for each parasitoid. The sample of fresh pupae exhibited average of 15 emergent parasitoids / pupa while pupae stored directly at freezer (-20ºC presented an average of 10 emergent parasitoids / pupa. In the samples exposed at one, three and 15 minutes in NL, accentuated decrease was observed on emergent hymenopterans reproductive performance (: 6.1; 5.5 and 5.7 respectively. The dissection of pupae revealed a large number of immature pteromalid in the groups with liquid nitrogen passage and farate adults in
Superparasitism Drives Heritable Symbiont Epidemiology and Host Sex Ratio in a Wasp.
Directory of Open Access Journals (Sweden)
Steven R Parratt
2016-06-01
Full Text Available Heritable microbial symbionts have profound impacts upon the biology of their arthropod hosts. Whilst our current understanding of the dynamics of these symbionts is typically cast within a framework of vertical transmission only, horizontal transmission has been observed in a number of cases. For instance, several symbionts can transmit horizontally when their parasitoid hosts share oviposition patches with uninfected conspecifics, a phenomenon called superparasitism. Despite this, horizontal transmission, and the host contact structures that facilitates it, have not been considered in heritable symbiont epidemiology. Here, we tested for the importance of host contact, and resulting horizontal transmission, for the epidemiology of a male-killing heritable symbiont (Arsenophonus nasoniae in parasitoid wasp hosts. We observed that host contact through superparasitism is necessary for this symbiont's spread in populations of its primary host Nasonia vitripennis, such that when superparasitism rates are high, A. nasoniae almost reaches fixation, causes highly female biased population sex ratios and consequently causes local host extinction. We further tested if natural interspecific variation in superparasitism behaviours predicted symbiont dynamics among parasitoid species. We found that A. nasoniae was maintained in laboratory populations of a closely related set of Nasonia species, but declined in other, more distantly related pteromalid hosts. The natural proclivity of a species to superparasitise was the primary factor determining symbiont persistence. Our results thus indicate that host contact behaviour is a key factor for heritable microbe dynamics when horizontal transmission is possible, and that 'reproductive parasite' phenotypes, such as male-killing, may be of secondary importance in the dynamics of such symbiont infections.
Directory of Open Access Journals (Sweden)
Maria Lenschow
2018-01-01
Full Text Available The olfactory sense is of crucial importance for animals, but their response to chemical stimuli is plastic and depends on their physiological state and prior experience. In many insect species, mating status influences the response to sex pheromones, but the underlying neuromodulatory mechanisms are poorly understood. After mating, females of the parasitic wasp Nasonia vitripennis are no longer attracted to the male sex pheromone. Here we show that this post-mating behavioral switch is mediated by dopamine (DA. Females fed a DA-receptor antagonist prior to mating maintained their attraction to the male pheromone after mating while virgin females injected with DA became unresponsive. However, the switch is reversible as mated females regained their pheromone preference after appetitive learning. Feeding mated N. vitripennis females with antagonists of either octopamine- (OA or DA-receptors prevented relearning of the pheromone preference suggesting that both receptors are involved in appetitive learning. Moreover, DA injection into mated females was sufficient to mimic the oviposition reward during odor conditioning with the male pheromone. Our data indicate that DA plays a key role in the plastic pheromone response of N. vitripennis females and reveal some striking parallels between insects and mammals in the neuromodulatory mechanisms underlying olfactory plasticity.
Sex allocation theory reveals a hidden cost of neonicotinoid exposure in a parasitoid wasp.
Whitehorn, Penelope R; Cook, Nicola; Blackburn, Charlotte V; Gill, Sophie M; Green, Jade; Shuker, David M
2015-05-22
Sex allocation theory has proved to be one the most successful theories in evolutionary ecology. However, its role in more applied aspects of ecology has been limited. Here we show how sex allocation theory helps uncover an otherwise hidden cost of neonicotinoid exposure in the parasitoid wasp Nasonia vitripennis. Female N. vitripennis allocate the sex of their offspring in line with Local Mate Competition (LMC) theory. Neonicotinoids are an economically important class of insecticides, but their deployment remains controversial, with evidence linking them to the decline of beneficial species. We demonstrate for the first time to our knowledge, that neonicotinoids disrupt the crucial reproductive behaviour of facultative sex allocation at sub-lethal, field-relevant doses in N. vitripennis. The quantitative predictions we can make from LMC theory show that females exposed to neonicotinoids are less able to allocate sex optimally and that this failure imposes a significant fitness cost. Our work highlights that understanding the ecological consequences of neonicotinoid deployment requires not just measures of mortality or even fecundity reduction among non-target species, but also measures that capture broader fitness costs, in this case offspring sex allocation. Our work also highlights new avenues for exploring how females obtain information when allocating sex under LMC. © 2015 The Author(s) Published by the Royal Society. All rights reserved.
Quantitative Trait Locus Analysis of Mating Behavior and Male Sex Pheromones in Nasonia Wasps
Directory of Open Access Journals (Sweden)
Wenwen Diao
2016-06-01
Full Text Available A major focus in speciation genetics is to identify the chromosomal regions and genes that reduce hybridization and gene flow. We investigated the genetic architecture of mating behavior in the parasitoid wasp species pair Nasonia giraulti and Nasonia oneida that exhibit strong prezygotic isolation. Behavioral analysis showed that N. oneida females had consistently higher latency times, and broke off the mating sequence more often in the mounting stage when confronted with N. giraulti males compared with males of their own species. N. oneida males produce a lower quantity of the long-range male sex pheromone (4R,5S-5-hydroxy-4-decanolide (RS-HDL. Crosses between the two species yielded hybrid males with various pheromone quantities, and these males were used in mating trials with females of either species to measure female mate discrimination rates. A quantitative trait locus (QTL analysis involving 475 recombinant hybrid males (F2, 2148 reciprocally backcrossed females (F3, and a linkage map of 52 equally spaced neutral single nucleotide polymorphism (SNP markers plus SNPs in 40 candidate mating behavior genes revealed four QTL for male pheromone amount, depending on partner species. Our results demonstrate that the RS-HDL pheromone plays a role in the mating system of N. giraulti and N. oneida, but also that additional communication cues are involved in mate choice. No QTL were found for female mate discrimination, which points at a polygenic architecture of female choice with strong environmental influences.
Heavner, Mary E.; Gueguen, Gwenaelle; Rajwani, Roma; Pagan, Pedro E.; Small, Chiyedza; Govind, Shubha
2013-01-01
Analysis of natural host-parasite relationships reveals the evolutionary forces that shape the delicate and unique specificity characteristic of such interactions. The accessory long gland-reservoir complex of the wasp Leptopilina heterotoma (Figitidae) produces venom with virus-like particles. Upon delivery, venom components delay host larval development and completely block host immune responses. The host range of this Drosophila endoparasitoid notably includes the highly-studied model organism, Drosophila melanogaster. Categorization of 827 unigenes, using similarity as an indicator of putative homology, reveals that approximately 25% are novel or classified as hypothetical proteins. Most of the remaining unigenes are related to processes involved in signaling, cell cycle, and cell physiology including detoxification, protein biogenesis, and hormone production. Analysis of L. heterotoma’s predicted venom gland proteins demonstrates conservation among endo- and ectoparasitoids within the Apocrita (e.g., this wasp and the jewel wasp Nasonia vitripennis) and stinging aculeates (e.g., the honey bee and ants). Enzyme and KEGG pathway profiling predicts that kinases, esterases, and hydrolases may contribute to venom activity in this unique wasp. To our knowledge, this investigation marks the first functional genomic study for a natural parasitic wasp of Drosophila. Our findings will help explain how L. heterotoma shuts down its hosts’ immunity and shed light on the molecular basis of a natural arms race between these insects. PMID:23688557
Mello, Renata da Silva; Aguiar-Coelho, Valéria M
2009-01-01
Some microhymenopterans are parasitoids of flies of forensic importance. Their parasitic habit can alter the duration of post-embryonic development of these flies, altering the postmortem interval. In order to analyze possible alterations occurring during the immature development period of Nasonia vitripennis, this study tested different quantitative associations between female parasitoids and pupae of Chrysomya megacephala, which were defined by: (a) one pupa was exposed to different numbers of female parasitoids (1:1, 1:3, 1:5, 1:7, 1:9, 1:11) and (b) different numbers of pupae were exposed to one female parasitoid (1:1, 2:1, 3:1, 4:1, 5:1). Analysis of variance (5% significance level) and Tukey's honestly significant difference tests were used for statistical analysis. There was a tendency of prolongation of the duration of parasitoid development, both by increasing the number of female parasitoids and by increasing the number of hosts in the associations. By increasing the number of female parasitoids per host, there is a possibility of increasing the occurrence of superparasitism, leading to competition for food source, then prolonging the duration of the immature development period. Increasing the number of hosts in the associations, females may distribute their postures among the available pupae and can cause reduction of the number of eggs per host. Since these insects are gregarious, the reduction of the number of eggs may delay the offspring development.
Hybrid incompatibilities are affected by dominance and dosage in the haplodiploid wasp Nasonia
Beukeboom, Leo W.; Koevoets, Tosca; Morales, Hernán E.; Ferber, Steven; van de Zande, Louis
2015-01-01
Study of genome incompatibilities in species hybrids is important for understanding the genetic basis of reproductive isolation and speciation. According to Haldane's rule hybridization affects the heterogametic sex more than the homogametic sex. Several theories have been proposed that attribute asymmetry in hybridization effects to either phenotype (sex) or genotype (heterogamety). Here we investigate the genetic basis of hybrid genome incompatibility in the haplodiploid wasp Nasonia using the powerful features of haploid males and sex reversal. We separately investigate the effects of heterozygosity (ploidy level) and sex by generating sex reversed diploid hybrid males and comparing them to genotypically similar haploid hybrid males and diploid hybrid females. Hybrid effects of sterility were more pronounced than of inviability, and were particularly strong in haploid males, but weak to absent in diploid males and females, indicating a strong ploidy level but no sex specific effect. Molecular markers identified a number of genomic regions associated with hybrid inviability in haploid males that disappeared under diploidy in both hybrid males and females. Hybrid inviability was rescued by dominance effects at some genomic regions, but aggravated or alleviated by dosage effects at other regions, consistent with cytonuclear incompatibilities. Dosage effects underlying Bateson–Dobzhansky–Muller (BDM) incompatibilities need more consideration in explaining Haldane's rule in diploid systems. PMID:25926847
Brucker, Robert M; Bordenstein, Seth R
2012-02-01
The comparative structure of bacterial communities among closely related host species remains relatively unexplored. For instance, as speciation events progress from incipient to complete stages, does divergence in the composition of the species' microbial communities parallel the divergence of host nuclear genes? To address this question, we used the recently diverged species of the parasitoid wasp genus Nasonia to test whether the evolutionary relationships of their bacterial microbiotas recapitulate the Nasonia phylogenetic history. We also assessed microbial diversity in Nasonia at different stages of development to determine the role that host age plays in microbiota structure. The results indicate that all three species of Nasonia share simple larval microbiotas dominated by the γ-proteobacteria class; however, bacterial species diversity increases as Nasonia develop into pupae and adults. Finally, under identical environmental conditions, the relationships of the microbial communities reflect the phylogeny of the Nasonia host species at multiple developmental stages, which suggests that the structure of an animal's microbial community is closely allied with divergence of host genes. These findings highlight the importance of host evolutionary relationships on microbiota composition and have broad implications for future studies of microbial symbiosis and animal speciation. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.
Blaul, Birgit; Ruther, Joachim
2011-11-07
Sexual selection theory predicts that phenotypic traits used to choose a mate should reflect honestly the quality of the sender and thus, are often costly. Physiological costs arise if a signal depends on limited nutritional resources. Hence, the nutritional condition of an organism should determine both its quality as a potential mate and its ability to advertise this quality to the choosing sex. In insects, the quality of the offspring's nutrition is often determined by the ovipositing female. A causal connection, however, between the oviposition decisions of the mother and the mating chances of her offspring has never been shown. Here, we demonstrate that females of the parasitic wasp Nasonia vitripennis prefer those hosts for oviposition that have been experimentally enriched in linoleic acid (LA). We show by (13)C-labelling that LA from the host diet is a precursor of the male sex pheromone. Consequently, males from LA-rich hosts produce and release higher amounts of the pheromone and attract more virgin females than males from LA-poor hosts. Finally, males from LA-rich hosts possess three times as many spermatozoa as those from LA-poor hosts. Hence, females making the right oviposition decisions may increase both the fertility and the sexual attractiveness of their sons.
2012-01-01
2012.12.009 ARTICLE IN PRESSG ModelPEP 68873 1–6 R. Predel et al. / Peptides (2012) – 3 Fig. 1. (A) Anti- Pea -PVK-2 immunofluorescence staining...lowercase, exons in uppercase, the translated protein sequence in bold. The CAPA-PVK-1, CAPA-PVK-2 and predicted CAPA-PK sequences are highlighted in dark...341 Genomics and peptidomics of neuropeptides and protein hormones present in 342 the parasitic wasp Nasonia vitripennis. J Proteome Res 2010;9:5296–310
Laboratory evolution of polyandry in the parasitoid wasp Nasonia vitripennis
Burton-Chellew, Maxwell N.; Beukeboom, Leo W.; West, Stu A.; Shuker, David M.
2007-01-01
The evolution and maintenance of multiple mating in females (polyandry) is an adaptive puzzle since females typically obtain all the resources they need from males in only one or a few matings. Females should therefore limit superfluous copulations to avoid the well-documented costs of mating.
Buellesbach, Jan; Vetter, Sebastian G; Schmitt, Thomas
2018-01-01
Cuticular hydrocarbons (CHC) have been documented to play crucial roles as species- and sex-specific cues in the chemical communication systems of a wide variety of insects. However, whether they are sufficient by themselves as the sole cue triggering sexual behavior as well as preference of con- over heterospecific mating partners is rarely assessed. We conducted behavioral assays in three representative species of parasitoid wasps (Hymenoptera: Pteromalidae) to determine their reliance on CHC as species-specific sexual signaling cues. We found a surprising degree of either unspecific or insufficient sexual signaling when CHC are singled out as recognition cues. Most strikingly, the cosmopolitan species Nasonia vitripennis , expected to experience enhanced selection pressure to discriminate against other co-occurring parasitoids, did not discriminate against CHC of a partially sympatric species from another genus, Trichomalopsis sarcophagae . Focusing on the latter species, in turn, it became apparent that CHC are even insufficient as the sole cue triggering conspecific sexual behavior, hinting at the requirement of additional, synergistic sexual cues particularly important in this species. Finally, in the phylogenetically and chemically most divergent species Muscidifurax uniraptor, we intriguingly found both CHC-based sexual signaling as well as species discrimination behavior intact although this species is naturally parthenogenetic with sexual reproduction only occurring under laboratory conditions. Our findings implicate a discrepancy in the reliance on and specificity of CHC as sexual cues in our tested parasitioid wasps. CHC profiles were not sufficient for unambiguous discrimination and preference behavior, as demonstrated by clear cross-attraction between some of our tested wasp genera. Moreover, we could show that only in T. sarcophagae , additional behavioral cues need to be present for triggering natural mating behavior, hinting at an interesting
Dicty_cDB: Contig-U04800-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available asonia ... 48 0.45 1 ( GE365792 ) 292292280 Nasonia vitripennis Male Pupae Nasonia ... 48 0.45 1 ( FG297046 ) 1108793273723 New World... Screwworm Larvae 9387 EST... 48 0.45 1 ( FG283564 ) 1108770626148 New World...OGR... 36 6.2 9 ( FG288720 ) 1108793274846 New World Screwworm Egg 9261 ESTs C... 34 6.2 3 ( BX640537 ) Zebr
EST Table: FS748350 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available PREDICTED: similar to fetal alzheimer antigen, falz [Nasonia vitripennis] 10/09/08 37 %/193 aa FBpp0290563|E...811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] FS748350 caL- ...
EST Table: AV400820 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available a-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/28 52 %/152 aa FBpp0120238|DanaGF17046-PA 10... to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 br-- ...
EST Table: FS805970 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available milar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/09/09 47 %/178 aa FBpp0123641|DanaGF20449-...PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] FS727105 fmgV ...
EST Table: CK488990 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available %/161 aa ref|XP_001605087.1| PREDICTED: similar to fetal alzheimer antigen, falz [Nasonia vitripennis] 10/08...47 %/163 aa gi|189240808|ref|XP_001811424.1| PREDICTED: similar to fetal alzheimer antigen, falz [Tribolium castaneum] CK488990 swa ...
EST Table: AV403894 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ref|XP_001605691.1| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Nasonia vitripennis] 10/08/28 52...%/206 aa gi|189241712|ref|XP_968082.2| PREDICTED: similar to xaa-pro dipeptidase app(e.coli) [Tribolium castaneum] AV403894 pg-- ...
EST Table: FY739073 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FY739073 E_FL_famL_07K17_F_0 11/11/04 35 %/254 aa ref|XP_001600679.1| PREDICTED: si...milar to conserved hypothetical protein [Nasonia vitripennis] 11/11/04 30 %/250 aa FBpp0153473|DgriGH19567-P
Directory of Open Access Journals (Sweden)
Jin-Hua Xiao
Full Text Available Among the Chalcidoids, hymenopteran parasitic wasps that have diversified lifestyles, a partial mitochondrial genome has been reported only from Nasonia. This genome had many unusual features, especially a dramatic reorganization and a high rate of evolution. Comparisons based on more mitochondrial genomic data from the same superfamily were required to reveal weather these unusual features are peculiar to Nasonia or not. In the present study, we sequenced the nearly complete mitochondrial genomes from the species Philotrypesis. pilosa and Philotrypesis sp., both of which were associated with Ficus hispida. The acquired data included all of the protein-coding genes, rRNAs, and most of the tRNAs, and in P. pilosa the control region. High levels of nucleotide divergence separated the two species. A comparison of all available hymenopteran mitochondrial genomes (including a submitted partial genome from Ceratosolen solmsi revealed that the Chalcidoids had dramatic mitochondrial gene rearrangments, involved not only the tRNAs, but also several protein-coding genes. The AT-rich control region was translocated and inverted in Philotrypesis. The mitochondrial genomes also exhibited rapid rates of evolution involving elevated nonsynonymous mutations.
Directory of Open Access Journals (Sweden)
Raja Sekhar Nandety
Full Text Available BACKGROUND: The glassy-winged sharpshooter Homalodisca vitripennis (Hemiptera: Cicadellidae, is a xylem-feeding leafhopper and important vector of the bacterium Xylella fastidiosa; the causal agent of Pierce's disease of grapevines. The functional complexity of the transcriptome of H. vitripennis has not been elucidated thus far. It is a necessary blueprint for an understanding of the development of H. vitripennis and for designing efficient biorational control strategies including those based on RNA interference. RESULTS: Here we elucidate and explore the transcriptome of adult H. vitripennis using high-throughput paired end deep sequencing and de novo assembly. A total of 32,803,656 paired-end reads were obtained with an average transcript length of 624 nucleotides. We assembled 32.9 Mb of the transcriptome of H. vitripennis that spanned across 47,265 loci and 52,708 transcripts. Comparison of our non-redundant database showed that 45% of the deduced proteins of H. vitripennis exhibit identity (e-value ≤1(-5 with known proteins. We assigned Gene Ontology (GO terms, Kyoto Encyclopedia of Genes and Genomes (KEGG annotations, and potential Pfam domains to each transcript isoform. In order to gain insight into the molecular basis of key regulatory genes of H. vitripennis, we characterized predicted proteins involved in the metabolism of juvenile hormone, and biogenesis of small RNAs (Dicer and Piwi sequences from the transcriptomic sequences. Analysis of transposable element sequences of H. vitripennis indicated that the genome is less expanded in comparison to many other insects with approximately 1% of the transcriptome carrying transposable elements. CONCLUSIONS: Our data significantly enhance the molecular resources available for future study and control of this economically important hemipteran. This transcriptional information not only provides a more nuanced understanding of the underlying biological and physiological mechanisms that
Tirosh, Y; Morpurgo, N; Cohen, M; Linial, M; Bloch, G
2012-06-01
We identified a predicted compact cysteine-rich sequence in the honey bee genome that we called 'Raalin'. Raalin transcripts are enriched in the brain of adult honey bee workers and drones, with only minimum expression in other tissues or in pre-adult stages. Open-reading frame (ORF) homologues of Raalin were identified in the transcriptomes of fruit flies, mosquitoes and moths. The Raalin-like gene from Drosophila melanogaster encodes for a short secreted protein that is maximally expressed in the adult brain with negligible expression in other tissues or pre-imaginal stages. Raalin-like sequences have also been found in the recently sequenced genomes of six ant species, but not in the jewel wasp Nasonia vitripennis. As in the honey bee, the Raalin-like sequences of ants do not have an ORF. A comparison of the genome region containing Raalin in the genomes of bees, ants and the wasp provides evolutionary support for an extensive genome rearrangement in this sequence. Our analyses identify a new family of ancient cysteine-rich short sequences in insects in which insertions and genome rearrangements may have disrupted this locus in the branch leading to the Hymenoptera. The regulated expression of this transcript suggests that it has a brain-specific function. © 2012 The Authors. Insect Molecular Biology © 2012 The Royal Entomological Society.
EST Table: CK541907 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/31 55 %/184 aa FBpp0207489|DsecGM260...04775 10/09/10 n.h 10/09/10 48 %/183 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swh ...
EST Table: CN375311 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available r to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/01 49 %/164 aa FBpp0241989|DwilGK1284...4775 10/09/10 n.h 10/09/10 50 %/160 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 L12 ...
EST Table: CK560869 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/01 54 %/182 aa FBpp0241989|DwilGK128...04775 10/09/10 n.h 10/09/10 51 %/183 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swp ...
EST Table: CK528064 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/31 64 %/207 aa FBpp0269530|DyakGE245...04775 10/09/10 low homology 10/09/10 60 %/195 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swf ...
EST Table: AU000209 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/27 56 %/226 aa FBpp0241989|DwilGK12846-PA 10/0...9/10 low homology 10/09/10 53 %/228 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 e4 ...
EST Table: CK563240 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/01 58 %/106 aa FBpp0191285|DperGL271...04775 10/09/10 n.h 10/09/10 53 %/113 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swp ...
EST Table: BY914512 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available milar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/29 57 %/213 aa FBpp0241989|DwilGK...AP004775 10/09/10 low homology 10/09/10 53 %/215 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 an-- ...
EST Table: FS747376 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available milar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/08 58 %/234 aa FBpp0241989|DwilGK...AP004775 10/09/10 low homology 10/09/10 54 %/235 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 caL- ...
EST Table: CK501241 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/08/30 54 %/185 aa FBpp0241989|DwilGK128...04775 10/09/10 n.h 10/09/10 51 %/187 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 swb ...
EST Table: CN375310 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available r to xaa-pro dipeptidase pepd/pepq(e.coli) [Nasonia vitripennis] 10/09/01 48 %/158 aa FBpp0241989|DwilGK1284...4775 10/09/10 n.h 10/09/10 48 %/162 aa gi|189233738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] DC531937 L12 ...
Directory of Open Access Journals (Sweden)
Raja Sekhar Nandety
Full Text Available The glassy-winged sharpshooter (GWSS Homalodisca vitripennis (Hemiptera: Cicadellidae, is a xylem-feeding leafhopper and an important vector of the bacterium Xylella fastidiosa; the causal agent of Pierce's disease of grapevines. MicroRNAs are a class of small RNAs that play an important role in the functional development of various organisms including insects. In H. vitripennis, we identified microRNAs using high-throughput deep sequencing of adults followed by computational and manual annotation. A total of 14 novel microRNAs that are not found in the miRBase were identified from adult H. vitripennis. Conserved microRNAs were also found in our datasets. By comparison to our previously determined transcriptome sequence of H. vitripennis, we identified the potential targets of the microRNAs in the transcriptome. This microRNA profile information not only provides a more nuanced understanding of the biological and physiological mechanisms that govern gene expression in H. vitripennis, but may also lead to the identification of novel mechanisms for biorationally designed management strategies through the use of microRNAs.
High-precision photometry by telescope defocussing - VI. WASP-24, WASP-25 and WASP-26
DEFF Research Database (Denmark)
Southworth, John; Hinse, T. C.; Burgdorf, M.
2014-01-01
We present time series photometric observations of 13 transits in the planetary systems WASP-24, WASP-25 and WASP-26. All three systems have orbital obliquity measurements, WASP-24 and WASP-26 have been observed with Spitzer, and WASP-25 was previously comparatively neglected. Our light curves we...
VizieR Online Data Catalog: WASP-22, WASP-41, WASP-42, WASP-55 (Southworth+, 2016)
Southworth, J.; Tregloan-Reed, J.; Andersen, M. I.; Calchi Novati, S.; Ciceri, S.; Colque, J. P.; D'Ago, G.; Dominik, M.; Evans, D. F.; Gu, S.-H.; Herrera-Cordova, A.; Hinse, T. C.; Jorgensen, U. G.; Juncher, D.; Kuffmeier, M.; Mancini, L.; Peixinho, N.; Popovas, A.; Rabus, M.; Skottfelt, J.; Tronsgaard, R.; Unda-Sanzana, E.; Wang, X.-B.; Wertz, O.; Alsubai, K. A.; Andersen, J. M.; Bozza, V.; Bramich, D. M.; Burgdorf, M.; Damerdji, Y.; Diehl, C.; Elyiv, A.; Figuera Jaimes, R.; Haugbolle, T.; Hundertmark, M.; Kains, N.; Kerins, E.; Korhonen, H.; Liebig, C.; Mathiasen, M.; Penny, M. T.; Rahvar, S.; Scarpetta, G.; Schmidt, R. W.; Snodgrass, C.; Starkey, D.; Surdej, J.; Vilela, C.; von Essen, C.; Wang, Y.
2018-05-01
17 light curves of transits of the extrasolar planetary systems WASP-22, WASP-41, WASP-42 and WASP-55 are presented. 13 of the light curves were obtained using the Danish 1.54m telescope at ESO La Silla, Chile, in the Bessell R or Bessell I passbands. The other 4 light curves were obtained using the 84cm telescope at Observatorio Cerro Armazones, Chile, using either an R filter or no filter. The errorbars for each transit have been scaled so the best-fitting model (obtained using the JKTEBOP code) has a reduced chi-squared value of 1.0. (4 data files).
Groothuis, Jitte; Smid, Hans M.
2017-01-01
Haller's rule states that brains scale allometrically with body size in all animals, meaning that relative brain size increases with decreasing body size. This rule applies both on inter- and intraspecific comparisons. Only 1 species, the extremely small parasitic wasp Trichogramma evanescens, is
Directory of Open Access Journals (Sweden)
Yu Zhu
2015-11-01
Full Text Available Chitin-binding proteins (CBPs are present in many species and they act in a variety of biological processes. We analyzed a Pteromalus puparum venom apparatus proteome and transcriptome and identified a partial gene encoding a possible CBP. Here, we report cloning a full-length cDNA of a sequence encoding a chitin-binding-like protein (PpCBP from P. puparum, a pupal endoparasitoid of Pieris rapae. The cDNA encoded a 96-amino-acid protein, including a secretory signal peptide and a chitin-binding peritrophin-A domain. Phylogenetic analysis of chitin binding domains (CBDs of cuticle proteins and peritrophic matrix proteins in selected insects revealed that the CBD of PpCBP clustered with the CBD of Nasonia vitripennis. The PpCBP is specifically expressed in the venom apparatus of P. puparum, mostly in the venom gland. PpCBP expression was highest at day one after adult eclosion and much lower for the following five days. We produced a recombinant PpCBP and binding assays showed the recombinant protein selectively binds chitin but not cellulose in vitro. We infer that PpCBP serves a structural role in the venom reservoir, or may be injected into the host to help wound healing of the host exoskeleton.
Geuverink, Elzemiek; Rensink, Anna H.; Rondeel, Inge; Beukeboom, Leo W.; van de Zande, Louis; Verhulst, Eveline C.
2017-01-01
In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with
Geuverink, Elzemiek; Rensink, Anna H.; Rondeel, Inge; Beukeboom, Leo W.; Zande, van de Louis; Verhulst, Eveline C.
2017-01-01
In insect sex determination a primary signal starts the genetic sex determination cascade that, in most insect orders, is subsequently transduced down the cascade by a transformer (tra) ortholog. Only a female-specifically spliced tra mRNA yields a functional TRA-protein that forms a complex with
SPIN–ORBIT ALIGNMENT FOR THREE TRANSITING HOT JUPITERS: WASP-103b, WASP-87b, and WASP-66b
Energy Technology Data Exchange (ETDEWEB)
Addison, B. C.; Tinney, C. G.; Wright, D. J. [Exoplanetary Science Group, School of Physics, University of New South Wales, Sydney, NSW 2052 (Australia); Bayliss, D., E-mail: baddison2005@gmail.com [Research School of Astronomy and Astrophysics, Australian National University, Canberra, ACT 2611 (Australia)
2016-05-20
We have measured the sky-projected spin–orbit alignments for three transiting hot Jupiters, WASP-103b, WASP-87b, and WASP-66b, using spectroscopic measurements of the Rossiter–McLaughlin effect, with the CYCLOPS2 optical fiber bundle system feeding the UCLES spectrograph on the Anglo-Australian Telescope. The resulting sky-projected spin–orbit angles of λ = 3° ± 33°, λ = −8° ± 11°, and λ = −4° ± 22° for WASP-103b, WASP-87b, and WASP-66b, respectively, suggest that these three planets are likely on nearly aligned orbits with respect to their host star’s spin axis. WASP-103 is a particularly interesting system as its orbital distance is only 20% larger than its host star’s Roche radius and the planet likely experiences strong tidal effects. WASP-87 and WASP-66 are hot ( T {sub eff} = 6450 ± 120 K and T {sub eff} = 6600 ± 150 K, respectively) mid-F stars, making them similar to the majority of stars hosting planets on high-obliquity orbits. Moderate spin–orbit misalignments for WASP-103b and WASP-66b are consistent with our data, but polar and retrograde orbits are not favored for these systems.
SPIN–ORBIT ALIGNMENT FOR THREE TRANSITING HOT JUPITERS: WASP-103b, WASP-87b, and WASP-66b
International Nuclear Information System (INIS)
Addison, B. C.; Tinney, C. G.; Wright, D. J.; Bayliss, D.
2016-01-01
We have measured the sky-projected spin–orbit alignments for three transiting hot Jupiters, WASP-103b, WASP-87b, and WASP-66b, using spectroscopic measurements of the Rossiter–McLaughlin effect, with the CYCLOPS2 optical fiber bundle system feeding the UCLES spectrograph on the Anglo-Australian Telescope. The resulting sky-projected spin–orbit angles of λ = 3° ± 33°, λ = −8° ± 11°, and λ = −4° ± 22° for WASP-103b, WASP-87b, and WASP-66b, respectively, suggest that these three planets are likely on nearly aligned orbits with respect to their host star’s spin axis. WASP-103 is a particularly interesting system as its orbital distance is only 20% larger than its host star’s Roche radius and the planet likely experiences strong tidal effects. WASP-87 and WASP-66 are hot ( T eff = 6450 ± 120 K and T eff = 6600 ± 150 K, respectively) mid-F stars, making them similar to the majority of stars hosting planets on high-obliquity orbits. Moderate spin–orbit misalignments for WASP-103b and WASP-66b are consistent with our data, but polar and retrograde orbits are not favored for these systems.
Propagation of Homalodisca Coagulata Virus-01 via Homalodisca Vitripennis cell culture
The glassy-winged sharpshooter (Homalodisca vitripennis) is a highly vagile and polyphagous insect found throughout the southwestern United States. These insects are the predominant vectors of Xylella fastidiosa, a xylem-limited bacterium that is the causal agent of Pierce's disease (PD) of grapevin...
Geuverink, E; Verhulst, E C; van Leussen, M; van de Zande, L; Beukeboom, L W
2018-02-01
In many insect species maternal provision of sex-specifically spliced messenger RNA (mRNA) of sex determination genes is an essential component of the sex determination mechanism. In haplodiploid Hymenoptera, maternal provision in combination with genomic imprinting has been shown for the parasitoid Nasonia vitripennis, known as maternal effect genomic imprinting sex determination (MEGISD). Here, we characterize the sex determination cascade of Asobara tabida, another hymenopteran parasitoid. We show the presence of the conserved sex determination genes doublesex (dsx), transformer (tra) and transformer-2 (tra2) orthologues in As. tabida. Of these, At-dsx and At-tra are sex-specifically spliced, indicating a conserved function in sex determination. At-tra and At-tra2 mRNA is maternally provided to embryos but, in contrast to most studied insects, As. tabida females transmit a non-sex-specific splice form of At-tra mRNA to the eggs. In this respect, As. tabida sex determination differs from the MEGISD mechanism. How the paternal genome can induce female development in the absence of maternal provision of sex-specifically spliced mRNA remains an open question. Our study reports a hitherto unknown variant of maternal effect sex determination and accentuates the diversity of insect sex determination mechanisms. © 2017 The Authors. Insect Molecular Biology published by John Wiley & Sons Ltd on behalf of Royal Entomological Society.
The glassy-winged sharpshooter, Homalodisca vitripennis, is a xylem fluid-ingesting leafhopper that transmits Xylella fastidiosa, the causal agent of several plant diseases in the Americas. While the role of plant water stress on the population density and dispersal of H. vitripennis has been studie...
ANALYSIS OF SPIN-ORBIT ALIGNMENT IN THE WASP-32, WASP-38, AND HAT-P-27/WASP-40 SYSTEMS
Energy Technology Data Exchange (ETDEWEB)
Brown, D. J. A.; Collier Cameron, A.; Enoch, B.; Miller, G. R. M. [SUPA, School of Physics and Astronomy, University of St Andrews, North Haugh, St Andrews, Fife KY16 9SS (United Kingdom); Diaz, R. F. [LAM (Laboratoire d' Astrophysique de Marseille), Aix Marseille Universite, CNRS, UMR 7326, F-13388 Marseille (France); Doyle, A. P.; Smalley, B.; Anderson, D. R.; Hellier, C.; Maxted, P. F. L. [Astrophysics Group, School of Physical and Geographical Sciences, Lennard-Jones Building, Keele University, Staffordshire ST5 5BG (United Kingdom); Gillon, M. [Institut d' Astrophysique et de Geophysique, Universite de Liege, Allee du 6 Aout, 17 (Bat. B5C) Sart Tilman, B-4000 Liege (Belgium); Lendl, M.; Triaud, A. H. M. J.; Queloz, D. [Observatoire Astronomique de l' Universite de Geneve, 51 Chemin des Maillettes, CH-1290 Sauverny (Switzerland); Pollacco, D. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University, University Road, Belfast BT7 1NN (United Kingdom); Boisse, I. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Hebrard, G., E-mail: djab@st-andrews.ac.uk [Institut dAstrophysique de Paris, UMR7095 CNRS, Universite Pierre and Marie Curie, 98bis boulevard Arago, F-75014 Paris (France)
2012-12-01
We present measurements of the spin-orbit alignment angle, {lambda}, for the hot Jupiter systems WASP-32, WASP-38, and HAT-P-27/WASP-40, based on data obtained using the HARPS spectrograph. We analyze the Rossiter-McLaughlin effect for all three systems and also carry out Doppler tomography for WASP-32 and WASP-38. We find that WASP-32 (T {sub eff} = 6140{sup +90} {sub -100} K) is aligned, with an alignment angle of {lambda} = 10.{sup 0}5{sup +6.4} {sub -6.5} obtained through tomography, and that WASP-38 (T {sub eff} = 6180{sup +40} {sub -60} K) is also aligned, with tomographic analysis yielding {lambda} = 7.{sup 0}5{sup +4.7} {sub -6.1}. The latter result provides an order-of-magnitude improvement in the uncertainty in {lambda} compared to the previous analysis of Simpson et al. We are only able to loosely constrain the angle for HAT-P-27/WASP-40 (T{sub eff} = 5190{sup +160} {sub -170} K) to {lambda} = 24.{sup 0}2{sup +76.0}{sub -44.5}, owing to the poor signal-to-noise ratio of our data. We consider this result a non-detection under a slightly updated version of the alignment test of Brown et al. We place our results in the context of the full sample of spin-orbit alignment measurements, finding that they provide further support for previously established trends.
Dicty_cDB: Contig-U15678-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available nating seedlings, TAMU Sola... 52 6e-10 3 ( DY336852 ) OB_SEa04P11.r OB_SEa Ocimum basil...efly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end simi...qyiyiffiyiffffpklyif*kiilhpstqkkkkkkkkniisqhtv fcisi*ssp*nyffykkkik*ivfvfvliivifffpllnk*kkksffffliiyivi...qmyqphfkciliqaqtlte*lveqvmiqitf*lilq *rvklsiveplkfsinslinvlilvstlqvnkmqiplvevlkmf*dpskvvhnnhhhkyq nhnhnnhhnh... ... 60 5e-14 4 ( GE464933 ) 294762759 Nasonia vitripennis Adult Female Nasoni... 70 5e-14 2 ( BU819448 ) UA43BPG03 Populus trem
Beukeboom, L.W.; Assem, J. van den
Previously, we investigated courtship behaviour of bidirectional, interspecific hybrid males of two species of Nasonia (Beukeboom & van den Assem, 2001). Characteristics of the displays were intermediate between those of the parental species, but at the same time were biased towards the paternal
Jeong, G.S.; Stouthamer, R.
2006-01-01
The paternal sex ratio (PSR) chromosome is a supernumerary chromosome that causes the destruction of the paternal chromosome set in the first mitosis in a fertilized egg. It is known from parasitoid wasps in the genera Nasonia and Trichogramma (Hymenoptera). In these haplodiploids, the egg
Homalodisca vitripennis (Germar) is native to southeastern U.S. and northeastern Mexico. It was detected in southern California in the late 1980s and in the San Joaquin Valley in 1999, where it transmits the bacterium Xylella fastidiosa Wells et al. to grapevines and other crops. The reproductive ...
Discovery of defense- and neuropeptides in social ants by genome-mining.
Directory of Open Access Journals (Sweden)
Christian W Gruber
Full Text Available Natural peptides of great number and diversity occur in all organisms, but analyzing their peptidome is often difficult. With natural product drug discovery in mind, we devised a genome-mining approach to identify defense- and neuropeptides in the genomes of social ants from Atta cephalotes (leaf-cutter ant, Camponotus floridanus (carpenter ant and Harpegnathos saltator (basal genus. Numerous peptide-encoding genes of defense peptides, in particular defensins, and neuropeptides or regulatory peptide hormones, such as allatostatins and tachykinins, were identified and analyzed. Most interestingly we annotated genes that encode oxytocin/vasopressin-related peptides (inotocins and their putative receptors. This is the first piece of evidence for the existence of this nonapeptide hormone system in ants (Formicidae and supports recent findings in Tribolium castaneum (red flour beetle and Nasonia vitripennis (parasitoid wasp, and therefore its confinement to some basal holometabolous insects. By contrast, the absence of the inotocin hormone system in Apis mellifera (honeybee, another closely-related member of the eusocial Hymenoptera clade, establishes the basis for future studies on the molecular evolution and physiological function of oxytocin/vasopressin-related peptides (vasotocin nonapeptide family and their receptors in social insects. Particularly the identification of ant inotocin and defensin peptide sequences will provide a basis for future pharmacological characterization in the quest for potent and selective lead compounds of therapeutic value.
Hackett, Erla
This guide is designed to provide elementary school teachers with safe learning activities concerning bees and wasps. The following topics are included: (1) the importance of a positive teacher attitude towards bees and wasps; (2) special problems posed by paper wasps; (3) what to do when a child is bothered by a wasp; (4) what to do if a wasp…
Hymenopteran viruses may provide insights into colony collapse disorder in honey bees and other insect species. Three novel small RNA viruses were discovered during the genomics effort for the beneficial parasitoid of flies in the genus Nasonia (Hymenoptera). Genomics provides a great deal of inform...
Krugner, Rodrigo; Backus, Elaine A
2014-02-01
ABSTRACT The glassy-winged sharpshooter, Homalodisca vitripennis (Germar) (Hemiptera: Cicadellidae), is a xylem fluid-ingesting leafhopper that transmits Xylella fastidiosa Wells et al., a plant-infecting bacterium that causes several plant diseases in the Americas. Although the role of plant water stress on the population density and dispersal ofH. vitripennis has been studied, nothing is known about the effects of plant water stress on the transmission of X. fastidiosa by H. vitripennis. A laboratory study was conducted to determine the influence of plant water stress on the sharpshooter stylet probing behaviors associated with the acquisition and inoculation of X. fastidiosa. Electrical penetration graph was used to monitor H. vitripennis feeding behaviors for 20-h periods on citrus [Citrus sinensis (L.) Osbeck] and almond [Prunus dulcis (Miller) D.A. Webb] plants subjected to levels of water stress. Adult H. vitripennis successfully located xylem vessels, then performed behaviors related to the evaluation of the xylem cell and fluid, and finally ingested xylem fluid from citrus and almond plants under the tested fluid tensions ranging from -5.5 to -33.0 bars and -6.0 to -24.5 bars, respectively. In general, long and frequent feeding events associated with the acquisition and inoculation of X. fastidiosa were observed only in fully irrigated plants (i.e., >-10 bars), which suggests that even low levels of plant water stress may reduce the spread of X. fastidiosa. Results provided insights to disease epidemiology and support the hypothesis that application of regulated deficit irrigation has the potential to reduce the incidence of diseases caused by X.fastidiosa by reducing the number of vectors and by decreasing pathogen transmission efficiency.
Loehlin, David W.; Oliveira, Deodoro C. S. G.; Edwards, Rachel; Giebel, Jonathan D.; Clark, Michael E.; Cattani, M. Victoria; van de Zande, Louis; Verhulst, Eveline C.; Beukeboom, Leo W.; Munoz-Torres, Monica; Werren, John H.
The genetic basis of morphological differences among species is still poorly understood. We investigated the genetic basis of sex-specific differences in wing size between two closely related species of Nasonia by positional cloning a major male-specific locus, wing-size1 (ws1). Male wing size
BACKGROUND: Glassy-winged sharpshooter (GWSS), Homalodisca vitripennis (Germar) (Hemiptera: Cicadellidae), is an important vector of the bacterium Xylella fastidiosa, the causal agent of Pierce’s disease of grapevine. Area-wide applications of neonicotinoid insecticides have suppressed GWSS populati...
Verhulst, Eveline C; Lynch, Jeremy A; Bopp, Daniel; Beukeboom, Leo W; van de Zande, Louis
2013-01-01
Although sex determination is a universal process in sexually reproducing organisms, sex determination pathways are among the most highly variable genetic systems found in nature. Nevertheless, general principles can be identified among the diversity, like the central role of transformer (tra) in insects. When a functional TRA protein is produced in early embryogenesis, the female sex determining route is activated, while prevention of TRA production leads to male development. In dipterans, male development is achieved by prevention of female-specific splicing of tra mRNA, either mediated by X-chromosome dose or masculinizing factors. In Hymenoptera, which have haplodiploid sex determination, complementary sex determination and maternal imprinting have been identified to regulate timely TRA production. In the parasitoid Nasonia, zygotic transformer (Nvtra) expression and splicing is regulated by a combination of maternal provision of Nvtra mRNA and silencing of Nvtra expression in unfertilized eggs. It is unclear, however, if this silencing is directly on the tra locus or whether it is mediated through maternal silencing of a trans-acting factor. Here we show that in Nasonia, female sex determination is dependent on zygotic activation of Nvtra expression by an as yet unknown factor. This factor, which we propose to term womanizer (wom), is maternally silenced during oogenesis to ensure male development in unfertilized eggs. This finding implicates the upstream recruitment of a novel gene in the Nasonia sex determining cascade and supports the notion that sex determining cascades can rapidly change by adding new components on top of existing regulators.
Bopp, Daniel; Beukeboom, Leo W.; van de Zande, Louis
2013-01-01
Although sex determination is a universal process in sexually reproducing organisms, sex determination pathways are among the most highly variable genetic systems found in nature. Nevertheless, general principles can be identified among the diversity, like the central role of transformer (tra) in insects. When a functional TRA protein is produced in early embryogenesis, the female sex determining route is activated, while prevention of TRA production leads to male development. In dipterans, male development is achieved by prevention of female-specific splicing of tra mRNA, either mediated by X-chromosome dose or masculinizing factors. In Hymenoptera, which have haplodiploid sex determination, complementary sex determination and maternal imprinting have been identified to regulate timely TRA production. In the parasitoid Nasonia, zygotic transformer (Nvtra) expression and splicing is regulated by a combination of maternal provision of Nvtra mRNA and silencing of Nvtra expression in unfertilized eggs. It is unclear, however, if this silencing is directly on the tra locus or whether it is mediated through maternal silencing of a trans-acting factor. Here we show that in Nasonia, female sex determination is dependent on zygotic activation of Nvtra expression by an as yet unknown factor. This factor, which we propose to term womanizer (wom), is maternally silenced during oogenesis to ensure male development in unfertilized eggs. This finding implicates the upstream recruitment of a novel gene in the Nasonia sex determining cascade and supports the notion that sex determining cascades can rapidly change by adding new components on top of existing regulators. PMID:23717455
The glassy-winged sharpshooter (GWSS), Homalodisca vitripennis, is an important pest of grapevines due to its ability to transmit Xylella fastidiosa, the causal agent of Pierce’s disease. GWSS mating communication is based on vibrational signals; therefore, vibrational mating disruption could be an ...
Directory of Open Access Journals (Sweden)
Rui-Wu Wang
2009-11-01
Full Text Available Fig trees are pollinated by fig wasps, which also oviposit in female flowers. The wasp larvae gall and eat developing seeds. Although fig trees benefit from allowing wasps to oviposit, because the wasp offspring disperse pollen, figs must prevent wasps from ovipositing in all flowers, or seed production would cease, and the mutualism would go extinct. In Ficus racemosa, we find that syconia ('figs' that have few foundresses (ovipositing wasps are underexploited in the summer (few seeds, few galls, many empty ovules and are overexploited in the winter (few seeds, many galls, few empty ovules. Conversely, syconia with many foundresses produce intermediate numbers of galls and seeds, regardless of season. We use experiments to explain these patterns, and thus, to explain how this mutualism is maintained. In the hot summer, wasps suffer short lifespans and therefore fail to oviposit in many flowers. In contrast, cooler temperatures in the winter permit longer wasp lifespans, which in turn allows most flowers to be exploited by the wasps. However, even in winter, only in syconia that happen to have few foundresses are most flowers turned into galls. In syconia with higher numbers of foundresses, interference competition reduces foundress lifespans, which reduces the proportion of flowers that are galled. We further show that syconia encourage the entry of multiple foundresses by delaying ostiole closure. Taken together, these factors allow fig trees to reduce galling in the wasp-benign winter and boost galling (and pollination in the wasp-stressing summer. Interference competition has been shown to reduce virulence in pathogenic bacteria. Our results show that interference also maintains cooperation in a classic, cooperative symbiosis, thus linking theories of virulence and mutualism. More generally, our results reveal how frequency-dependent population regulation can occur in the fig-wasp mutualism, and how a host species can 'set the rules of the
DEFF Research Database (Denmark)
Mann, Jakob; Astrup, Poul; Kristensen, Leif
2000-01-01
This report summarizes the findings of the EFP project WAsP Engineering Version 1.0 DK - Vindforhold for vindmølledesign. WAsP Engineering is a series of experimental and theoretical activities concerning properties of the winds in moderately complexterrain with relevance for loads on wind turbines...... and other large structures. These properties include extreme winds, wind shear and turbulence. Most of the models have been integrated in a windows program prototype, also called WAsP Engineering. Thebasic mean flow model LINCOM has been changed in several respects to accommodate the demands from load...
DEFF Research Database (Denmark)
Mann, J.; Ott, Søren; Jørgensen, B.H.
2002-01-01
This report summarizes the findings of the EFP project WAsP Engineering Version 2000. The main product of this project is the computer program WAsP Engineering which is used for the estimation of extreme wind speeds, wind shears, profiles, and turbulencein complex terrain. At the web page http......://www.waspengineering.dk more information of the program can be obtained and a copy of the manual can be downloaded. The reports contains a complete description of the turbulence modelling in moderately complexterrain, implemented in WAsP Engineering. Also experimental validation of the model together with comparison...... with spectra from engineering codes is done. Some shortcomings of the linear flow model LINCOM, which is at the core of WAsP Engineering, ispointed out and modifications to eliminate the problem are presented. The global database of meteorological "reanalysis" data from NCAP/NCEP are used to estimate...
Dicty_cDB: Contig-U15589-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available DV288387 ) NAAHZ89TF Aedes aegypti - Fat Bodies Normalized (... 111 7e-31 3 ( DW611127 ) CLJ261-B09.y1d-s S...251 Rhizopus oryzae Company Rhizopus oryz... 84 2e-29 3 ( DV279302 ) NAAF564TF Aedes aegypti - Fat Bodies No...2 ( DV281619 ) NAAGT04TF Aedes aegypti - Fat Bodies Normalized (... 74 2e-27 4 ( ...404141 ) 293792124 Nasonia vitripennis Female Pupae Nasoni... 105 3e-27 2 ( DV288878 ) NAAHH95TF Aedes aegypti - Fat Bodie...-25 7 ( DV279303 ) NAAF564TR Aedes aegypti - Fat Bodies Normalized (... 119 5e-25 2 ( GE353884 ) 289177336 N
A two-year study was conducted in a citrus orchard [Citrus sinensis (L.) Osbeck cv. ‘Valencia’] to determine influence of plant water stress on population dynamics of glassy-winged sharpshooter (GWSS), Homalodisca vitripennis (Germar). Experimental treatments included irrigation at 100% of the crop...
Directory of Open Access Journals (Sweden)
Alessandra Ribeiro de Carvalho
2005-03-01
Full Text Available Este estudo foi realizado no período de agosto de 1999 a julho de 2000 com o objetivo de conhecer os parasitóides de Chrysomya megacephala (Fabricius, 1794 (Diptera, Calliphoridae e avaliar sua dinâmica populacional no Instituto Oswaldo Cruz (IOC/ FIOCRUZ e Jardim Zoológico, na cidade do Rio de Janeiro, RJ. As coletas foram realizadas semanalmente através da exposição de larvas de terceiro instar da mosca e seu substrato de criação, carne bovina moída em putrefação. Foram identificadas três espécies de himenópteros parasitóides: Tachinaephagus zealandicus Ashmead, 1904 (Encyrtidae, Pachycrepoideus vindemiae (Rondani, 1875 (Pteromalidae and Nasonia vitripennis (Walker, 1836 (Pteromalidae. Nos dois locais, T. zealandicus foi a espécie com maior taxa de parasitismo de C. megacephala, seguida por P. vindemiae e N. vitripennis. A população de parasitóides diminuiu drasticamente no verão (temperatura média = 28°C; precipitação = 6,5 mm.O pico populacional desses insetos foi verificado no final do outono e durante todo o inverno. No Jardim Zoológico, o lixo acumulado no local de coleta exerceu forte influência na dinâmica populacional dos himenópteros parasitóides identificados nesse estudo e o pico populacional de parasitismo foi verificado em junho e julho de 2000.This study was carried out from August 1999 to July 2000 to evaluate the population dynamics and to know the parasitoids of Chrysomya megacephala (Fabricius, 1794 at the Instituto Oswaldo Cruz (IOC/ FIOCRUZ and Jardim Zoológico, in Rio de Janeiro City. Samplings were conducted weekly with third instar larvae of the fly and putrefying ground beef. It was identified three species of hymenopterans parasitoids: Tachinaephagus zealandicus Ashmead, 1904 (Encyrtidae, Pachycrepoideus vindemiae (Rondani, 1875 (Pteromalidae and Nasonia vitripennis (Walker, 1836 (Pteromalidae. In both sampling areas, T. zealandicus was the species with the highest parasitism rate of C
New exoplanets from the SuperWASP-North survey
Directory of Open Access Journals (Sweden)
Keenan F.
2011-02-01
Full Text Available We present the current status of the WASP search for transiting exoplanets, focusing on recent planet discoveries from SuperWASP-North and the joint equatorial region (-20≤Dec≤+20 observed by both WASP telescopes. We report the results of monitoring of WASP planets, and discuss how these contribute to our understanding of planet properties and their diversity.
Directory of Open Access Journals (Sweden)
Holdsworth Daniel L.
2017-01-01
Full Text Available SuperWASP is one of the largest ground-based surveys for transiting exoplanets. To date, it has observed over 31 million stars. Such an extensive database of time resolved photometry holds the potential for extensive searches of stellar variability, and provide solid candidates for the upcoming TESS mission. Previous work by e.g. [15], [5], [12] has shown that the WASP archive provides a wealth of pulsationally variable stars. In this talk I will provide an overview of the SuperWASP project, present some of the published results from the survey, and some of the on-going work to identify key targets for the TESS mission.
Energy Technology Data Exchange (ETDEWEB)
Mann, J.; Ott, S.; Hoffmann Joergensen, B.; Frank, H.P.
2002-08-01
This report summarizes the findings of the EFP project WAsP Engineering Version 2000. The main product of this project is the computer program WAsP Engineering which is used for the estimation of extreme wind speeds, wind shears, profiles, and turbulence in complex terrain. At the web page http://www.waspengineering.dk more information of the program can be obtained and a copy of the manual can be downloaded. The reports contains a complete description of the turbulence modelling in moderately complex terrain, implemented in WAsP Engineering. Also experimental validation of the model together with comparison with spectra from engineering codes is done. Some shortcomings of the linear flow model LINCOM, which is at the core of WAsP Engineering, is pointed out and modifications to eliminate the problem are presented. The global database of meteorological 'reanalysis' data from NCAP/NCEP are used to estimate the extreme wind climate around Denmark. Among various alternative physical parameters in the database, such as surface winds, wind at various pressure levels or geostrophic winds at various heights, the surface geostrophic wind seems to give the most realistic results. Because of spatial filtering and intermittent temporal sampling the 50 year winds are underestimated by approximately 12%. Whether the method applies to larger areas of the world remains to be seen. The 50 year winds in Denmark is estimated from data using the flow model inWAsP Engineering and the values are approximately 1 m/s larger than previous analysis (Kristensen et al. 2000). A tool is developed to estimate crudely an extreme wind climate from a WAsP lib file. (au)
Directory of Open Access Journals (Sweden)
Amrita Salvi
2017-03-01
Full Text Available Cancer cell migration and invasion involves temporal and spatial regulation of actin cytoskeleton reorganization, which is regulated by the WASP family of proteins such as N-WASP (Neural- Wiskott Aldrich Syndrome Protein. We have previously shown that expression of N-WASP was increased under hypoxic conditions. In order to characterize the regulation of N-WASP expression, we constructed an N-WASP promoter driven GFP reporter construct, N-WASPpro-GFP. Transfection of N-WASPpro-GFP construct and plasmid expressing HiF1α (Hypoxia Inducible factor 1α enhanced the expression of GFP suggesting that increased expression of N-WASP under hypoxic conditions is mediated by HiF1α. Sequence analysis of the N-WASP promoter revealed the presence of two hypoxia response elements (HREs characterized by the consensus sequence 5′-GCGTG-3′ at -132 bp(HRE1 and at -662 bp(HRE2 relative to transcription start site (TSS. Site-directed mutagenesis of HRE1(-132 but not HRE2(-662 abolished the HiF1α induced activation of N-WASP promoter. Similarly ChIP assay demonstrated that HiF1α bound to HRE1(-132 but not HRE2(-662 under hypoxic condition. MDA-MB-231 cells but not MDA-MB-231KD cells treated with hypoxia mimicking agent, DMOG showed enhanced gelatin degradation. Similarly MDA-MB-231KD(N-WASPpro-N-WASPR cells expressing N-WASPR under the transcriptional regulation of WT N-WASPpro but not MDA-MB-231KD(N-WASPproHRE1-N-WASPR cells expressing N-WASPR under the transcriptional regulation of N-WASPproHRE1 showed enhanced gelatin degradation when treated with DMOG. Thus indicating the importance of N-WASP in hypoxia induced invadopodia formation. Thus, our data demonstrates that hypoxia-induced activation of N-WASP expression is mediated by interaction of HiF1α with the HRE1(-132 and explains the role of N-WASP in hypoxia induced invadopodia formation.
Wasp venom proteins: phospholipase A1 and B.
King, T P; Kochoumian, L; Joslyn, A
1984-04-01
Three major venom proteins from different species of wasps have been isolated and characterized. They are hyaluronidase, phospholipase, and antigen 5 of as yet unknown biochemical function. These three proteins are allergens in wasp venom-sensitive persons. The species of wasps studied, of the genus Polistes, were annularis, carolina, exclamans, fuscatus, and instabilis. Antigen 5 and phospholipase from wasp venoms were shown to be antigenically distinct from homologous proteins of yellowjacket venoms. The venom phospholipase from wasp, as well as that from yellowjacket (Vespula germanica), appears to have dual enzymatic specificities of the A1 and B types. That is, hydrolysis takes place at the 1-acyl residue of phosphatidylcholine and at the 1- or 2-acyl residue of lysophosphatidylcholine.
Nadel, H; Seligmann, R; Johnson, M W; Hagler, J R; Stenger, D C; Groves, R L
2008-06-01
Host plant water status is thought to influence dispersal of the xylophagous leafhopper Homalodisca vitripennis Germar, especially where plants are grown under high evaporative demand. Preference by adult H. vitripennis for plants grown under different water deficit and nitrogen form fertilization regimens was studied under laboratory conditions. Leafhopper abundance and ovipositional preference were studied on potted 'Washington navel' orange and 'Haas' avocado in cage choice tests, and feeding rate was estimated using excreta produced by insects confined on plants. A similar study compared responses to citrus treated with 1:1 and 26:1 ratios of fertigated nitrate-N to ammonium-N. The insects were more abundant, oviposited, and fed significantly more on surplus-irrigated plants than on plants under moderate continuous deficit irrigation except avocado feeding, which was nearly significant. Plants exposed to drought became less preferred after 3 and 7 d in avocado and citrus, respectively. Citrus xylem fluid tension at this point was estimated at 0.93 MPa. A corresponding pattern of decline in feeding rate was observed on citrus, but on avocado, feeding rate was low overall and not statistically different between treatments. No statistical differences in abundance, oviposition, or feeding were detected on citrus fertigated with 26:1 or 1:1 ratios of nitrate-N to ammonium-N. Feeding occurred diurnally on both plant species. Discussion is provided on the potential deployment of regulated deficit irrigation to manage H. vitripennis movement as part of a multitactic effort to minimize the risk of disease outbreaks from Xylella fastidiosa Wells et al. in southern California agriculture.
Cornille, A.; Underhill, J. G.; Cruaud, A.; Hossaert-McKey, M.; Johnson, S. D.; Tolley, K. A.; Kjellberg, F.; van Noort, S.; Proffit, M.
2012-01-01
Combining biogeographic, ecological, morphological, molecular and chemical data, we document departure from strict specialization in the fig-pollinating wasp mutualism. We show that the pollinating wasps Elisabethiella stuckenbergi and Elisabethiella socotrensis form a species complex of five lineages in East and Southern Africa. Up to two morphologically distinct lineages were found to co-occur locally in the southern African region. Wasps belonging to a single lineage were frequently the main regional pollinators of several Ficus species. In South Africa, two sister lineages, E. stuckenbergi and E. socotrensis, pollinate Ficus natalensis but only E. stuckenbergi also regularly pollinates Ficus burkei. The two wasp species co-occur in individual trees of F. natalensis throughout KwaZulu-Natal. Floral volatile blends emitted by F. natalensis in KwaZulu-Natal were similar to those emitted by F. burkei and different from those produced by other African Ficus species. The fig odour similarity suggests evolutionary convergence to attract particular wasp species. The observed pattern may result from selection for pollinator sharing among Ficus species. Such a process, with one wasp species regionally pollinating several hosts, but several wasp species pollinating a given Ficus species across its geographical range could play an important role in the evolutionary dynamics of the Ficus-pollinating wasp association. PMID:22130605
Palp-faction: an African milkweed dismembers its wasp pollinators.
Shuttleworth, Adam; Johnson, Steven D
2009-06-01
Interactions between pollinators and nectar-producing flowers are usually assumed to be mutualistic, but the exploitative basis of these relationships can lead to antagonistic interactions. Flowers of the African milkweed, Pachycarpus appendiculatus E. Mey, produce concentrated nectar that is consumed primarily by the large spider-hunting wasp Hemipepsis dedjas Guerin (Hymenoptera: Pompilidae). Pollinaria of this milkweed become attached to the palps of these wasps during nectar feeding. Broken wasp palps were found between guide rails, attached to corpuscula that were trapped behind the guide rails, and attached to pollinia that were inserted into the stigmatic chambers of the flowers. Approximately 85% of wasps captured on flowers of P. appendiculatus were missing one or more palps, whereas only 9% of wasps captured on flowers of another asclepiad species were missing any palps. It thus seems that wasps face a high risk of losing their palps when foraging on these flowers. The interaction may thus be antagonistic for the wasps if the cost of losing their sensory palps (not yet established) is greater than the benefits of the nectar reward. The plants, however, gain clear benefit from the interaction, as verified by the removal and insertion of pollinia in flowers exposed solely to visits by pompilid wasps.
International Nuclear Information System (INIS)
1995-01-01
With several Member States, the IAEA has completed a new version of the WASP program, which has been called WASP-Ill Plus since it follows quite closely the methodology of the WASP-Ill model. The major enhancements in WASP-Ill Plus with respect to the WASP-Ill version are: increase in the number of thermal fuel types (from 5 to 10); verification of which configurations generated by CONGEN have already been simulated in previous iterations with MERSIM; direct calculation of combined Loading Order of FIXSYS and VARSYS plants; simulation of system operation includes consideration of physical constraints imposed on some fuel types (i.e., fuel availability for electricity generation); extended output of the resimulation of the optimal solution; generation of a file that can be used for graphical representation of the results of the resimulation of the optimal solution and cash flows of the investment costs; calculation of cash flows allows to include the capital costs of plants firmly committed or in construction (FIXSYS plants); user control of the distribution of capital cost expenditures during the construction period (if required to be different from the general 'S' curve distribution used as default). This second volume of the document to support use of the WASP-Ill Plus computer code consists of 5 appendices giving some additional information about the WASP-Ill Plus program. Appendix A is mainly addressed to the WASP-Ill Plus system analyst and supplies some information which could help in the implementation of the program on the user computer facilities. This appendix also includes some aspects about WASP-Ill Plus that could not be treated in detail in Chapters 1 to 11. Appendix B identifies all error and warning messages that may appear in the WASP printouts and advises the user how to overcome the problem. Appendix C presents the flow charts of the programs along with a brief description of the objectives and structure of each module. Appendix D describes the
Absorbing Gas around the WASP-12 Planetary System
Fossati, L.; Ayres, T. R.; Haswell, C. A.; Bohlender, D.; Kochukhov, O.; Flöer, L.
2013-04-01
Near-UV observations of the planet host star WASP-12 uncovered the apparent absence of the normally conspicuous core emission of the Mg II h and k resonance lines. This anomaly could be due either to (1) a lack of stellar activity, which would be unprecedented for a solar-like star of the imputed age of WASP-12 or (2) extrinsic absorption, from the intervening interstellar medium (ISM) or from material within the WASP-12 system itself, presumably ablated from the extreme hot Jupiter WASP-12 b. HIRES archival spectra of the Ca II H and K lines of WASP-12 show broad depressions in the line cores, deeper than those of other inactive and similarly distant stars and similar to WASP-12's Mg II h and k line profiles. We took high-resolution ESPaDOnS and FIES spectra of three early-type stars within 20' of WASP-12 and at similar distances, which show the ISM column is insufficient to produce the broad Ca II depression observed in WASP-12. The EBHIS H I column density map supports and strengthens this conclusion. Extrinsic absorption by material local to the WASP-12 system is therefore the most likely cause of the line core anomalies. Gas escaping from the heavily irradiated planet could form a stable and thick circumstellar disk/cloud. The anomalously low stellar activity index (log R^{{\\prime }}_{HK}) of WASP-12 is evidently a direct consequence of the extra core absorption, so similar HK index deficiencies might signal the presence of translucent circumstellar gas around other stars hosting evaporating planets. Based on observations obtained at the Canada-France-Hawaii Telescope (CFHT), which is operated by the National Research Council of Canada, the Institut National des Sciences de l'Univers of the Centre National de la Rechereche Scientifique of France, and the University of Hawaii. Based on observations made with the Nordic Optical Telescope, operated on the island of La Palma jointly by Denmark, Finland, Iceland, Norway, and Sweden, in the Spanish Observatorio del
Directory of Open Access Journals (Sweden)
Anna A Rathé
Full Text Available In any insect invasion the presence or absence of suitable food and oviposition hosts in the invaded range is a key factor determining establishment success. The glassy-winged sharpshooter, Homalodisca vitripennis, is an important insect vector of the xylem-limited bacterial plant pathogen, Xylella fastidiosa, which causes disease in numerous host plants including food and feedstock crops, ornamentals and weeds. Both the pathogen and the vector are native to the Americas and are considered to be highly invasive. Neither has been detected in Australia. Twelve Australian native plant species present in the USA were observed over two years for suitability as H. vitripennis feeding, oviposition and nymph development hosts. Hosts providing evidence of adult or nymph presence were Leptospermum laevigatum, Acacia cowleana, Eremophila divaricata, Eucalyptus wandoo, Hakea laurina, Melaleuca laterita and Swainsona galegifolia. An oviposition-suitability field study was conducted with citrus, a favoured oviposition host, as a positive control. Citrus and L. laevigatum, A. cowleana, B. ericifolia×B. spinulosa, C. pulchella, E. divaricata, E. wandoo, H. laurina, and S. galegifolia were found to be oviposition hosts. Egg parasitism by the mymarid parasitoid Gonatocerus ashmeadi was observed on all Australian plants. A number of Australian plants that may facilitate H. vitripennis invasion have been identified and categorised as 'high risk' due to their ability to support all three life stages (egg, nymph and adult of the insect in the field (L. laevigatum, A. cowleana, E. divaricata, H. laurina, and S. galegifolia. The implications of these host status and natural enemy research findings are discussed and placed in an Australian invasion context.
Pollinator attraction of the wasp-flower Scrophularia umbrosa (Scrophulariaceae).
Brodmann, J; Emer, D; Ayasse, M
2012-05-01
Certain species of Scrophularia (Scrophulariaceae), such as S. nodosa and S. umbrosa, are mainly pollinated by social wasps and are consequently described as wasp-flowers. Because plants attract their pollinators with the help of various floral cues, such as floral odour and/or optical cues, we have investigated the role of olfactory and visual floral signals responsible for wasp attraction in S. umbrosa. Using a combination of chemical (GC, GC-MS) and electrophysiological analyses (GC-EAD), we identified ten compounds in the complex floral odour bouquet that are detectable by the wasps' antennae. As in the wasp-flower Epipactis helleborine, we found so-called 'green leaf volatiles' (GLVs) in the floral odour; these GLVs are highly attractive to the wasps. GLVs, mostly six-carbon aldehydes, alcohols and acetates, and other volatile organic compounds (VOCs), are emitted by many plants infested with herbivores, e.g. caterpillars. In contrast to other investigated wasp-flowers, behavioural experiments have demonstrated that, in addition to the floral odour of S. umbrosa, visual cues are involved in pollinator attraction. © 2011 German Botanical Society and The Royal Botanical Society of the Netherlands.
Exoplanet Transit Spectroscopy Using WFC3: WASP-12 b, WASP-17 b, and WASP-19 b
Mandell, Avram Max; Haynes, Korey N.; Sinukoff, Evan; Madhusudhan, Nikku; Burrows, Adam; Deming, Drake
2013-01-01
We report an analysis of transit spectroscopy of the extrasolar planets WASP-12 b, WASP-17 b, and WASP-19 b using the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope (HST). We analyze the data for a single transit for each planet using a strategy similar, in certain aspects, to the techniques used by Berta et al., but we extend their methodology to allow us to correct for channel- or wavelength-dependent instrumental effects by utilizing the band-integrated time series and measurements of the drift of the spectrum on the detector over time. We achieve almost photon-limited results for individual spectral bins, but the uncertainties in the transit depth for the band-integrated data are exacerbated by the uneven sampling of the light curve imposed by the orbital phasing of HST's observations. Our final transit spectra for all three objects are consistent with the presence of a broad absorption feature at 1.4 nano meter most likely due to water. However, the amplitude of the absorption is less than that expected based on previous observations with Spitzer, possibly due to hazes absorbing in the NIR or non-solar compositions. The degeneracy of models with different compositions and temperature structures combined with the low amplitude of any features in the data preclude our ability to place unambiguous constraints on the atmospheric composition without additional observations with WFC3 to improve the signal-to-noise ratio and/or a comprehensive multi-wavelength analysis.
International Nuclear Information System (INIS)
2001-01-01
As a continuation of its efforts to provide methodologies and tools to Member States to carry out comparative assessment and analyse priority environmental issues related to the development of the electric power sector, the IAEA has completed a new version of the Wien Automatic System Planning (WASP) Package WASP-IV for carrying out power generation expansion planning taking into consideration fuel availability and environmental constraints. This manual constitutes a part of this work and aims to provide users with a guide to use effectively the new version of the model WASP-IV. WASP was originally developed in 1972 by the Tennessee Valley Authority and the Oak Ridge National Laboratory in the USA to meet the IAEA needs to analyse the economic competitiveness of nuclear power in comparison to other generation expansion alternatives for supplying the future electricity requirements of a country or region. Previous versions of the model were used by Member States in many national and regional studies to analyse the electric power system expansion planning and the role of nuclear energy in particular. Experience gained from its application allowed development of WASP into a very comprehensive planning tool for electric power system expansion analysis. New, improved versions were developed, which took into consideration the needs expressed by the users of the programme in order to address important emerging issues being faced by the electric system planners. In 1979, WASP-IV was released and soon after became an indispensable tool in many Member States for generation expansion planning. The WASP-IV version was continually upgraded and the development of version WASP-III Plus commenced in 1992. By 1995, WASP-III Plus was completed, which followed closely the methodology of the WASP-III but incorporated new features. In order to meet the needs of electricity planners and following the recommendations of the Helsinki symposium, development of a new version of WASP was
Precise Masses in the WASP-47 System
Vanderburg, Andrew; Becker, Juliette C.; Buchhave, Lars A.; Mortier, Annelies; Lopez, Eric; Malavolta, Luca; Haywood, Raphaëlle D.; Latham, David W.; Charbonneau, David; López-Morales, Mercedes; Adams, Fred C.; Bonomo, Aldo Stefano; Bouchy, François; Collier Cameron, Andrew; Cosentino, Rosario; Di Fabrizio, Luca; Dumusque, Xavier; Fiorenzano, Aldo; Harutyunyan, Avet; Johnson, John Asher; Lorenzi, Vania; Lovis, Christophe; Mayor, Michel; Micela, Giusi; Molinari, Emilio; Pedani, Marco; Pepe, Francesco; Piotto, Giampaolo; Phillips, David; Rice, Ken; Sasselov, Dimitar; Ségransan, Damien; Sozzetti, Alessandro; Udry, Stéphane; Watson, Chris
2017-12-01
We present precise radial velocity observations of WASP-47, a star known to host a hot Jupiter, a distant Jovian companion, and, uniquely, two additional transiting planets in short-period orbits: a super-Earth in a ≈19 hr orbit, and a Neptune in a ≈9 day orbit. We analyze our observations from the HARPS-N spectrograph along with previously published data to measure the most precise planet masses yet for this system. When combined with new stellar parameters and reanalyzed transit photometry, our mass measurements place strong constraints on the compositions of the two small planets. We find that, unlike most other ultra-short-period planets, the inner planet, WASP-47 e, has a mass (6.83 ± 0.66 {M}\\oplus ) and a radius (1.810 ± 0.027 {R}\\oplus ) that are inconsistent with an Earth-like composition. Instead, WASP-47 e likely has a volatile-rich envelope surrounding an Earth-like core and mantle. We also perform a dynamical analysis to constrain the orbital inclination of WASP-47 c, the outer Jovian planet. This planet likely orbits close to the plane of the inner three planets, suggesting a quiet dynamical history for the system. Our dynamical constraints also imply that WASP-47 c is much more likely to transit than a geometric calculation would suggest. We calculate a transit probability for WASP-47 c of about 10%, more than an order of magnitude larger than the geometric transit probability of 0.6%.
Cognitive plasticity in foraging Vespula germanica wasps.
D'Adamo, Paola; Lozada, Mariana
2011-01-01
Vespula germanica (F.) (Hymenoptera: Vespidae) is a highly invasive social wasp that exhibits a rich behavioral repertoire in which learning and memory play a fundamental role in foraging. The learning abilities of these wasps were analyzed while relocating a food source and whether V. germanica foragers are capable of discriminating between different orientation patterns and generalizing their choice to a new pattern. Foraging wasps were trained to associate two different stripe orientation patterns with their respective food locations. Their response to a novel configuration that maintained the orientation of one of the learned patterns but differed in other aspects (e.g. width of stripes) was then evaluated. The results support the hypothesis that V. germanica wasps are able to associate a particular oriented pattern with the location of a feeder and to generalize their choice to a new pattern, which differed in quality, but presented the same orientation.
Wind Atlas Analysis and Application Program: WAsP 11 Help Facility
DEFF Research Database (Denmark)
2014-01-01
of specific wind turbines and wind farms. The WAsP Help Facility includes a Quick Start Tutorial, a User's Guide and a Technical Reference. It further includes descriptions of the Observed Wind Climate Wizard, the WAsP Climate Analyst, the WAsP Map Editor tool, the WAsP Turbine Editor tool, the Air Density...
Exoplanet transit spectroscopy using WFC3: WASP-12 b, WASP-17 b, and WASP-19 b
Energy Technology Data Exchange (ETDEWEB)
Mandell, Avi M.; Haynes, Korey [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Sinukoff, Evan [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States); Madhusudhan, Nikku [Yale Center for Astronomy and Astrophysics, Yale University, New Haven, CT 06511 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Deming, Drake, E-mail: Avi.Mandell@nasa.gov [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States)
2013-12-20
We report an analysis of transit spectroscopy of the extrasolar planets WASP-12 b, WASP-17 b, and WASP-19 b using the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope (HST). We analyze the data for a single transit for each planet using a strategy similar, in certain aspects, to the techniques used by Berta et al., but we extend their methodology to allow us to correct for channel- or wavelength-dependent instrumental effects by utilizing the band-integrated time series and measurements of the drift of the spectrum on the detector over time. We achieve almost photon-limited results for individual spectral bins, but the uncertainties in the transit depth for the band-integrated data are exacerbated by the uneven sampling of the light curve imposed by the orbital phasing of HST's observations. Our final transit spectra for all three objects are consistent with the presence of a broad absorption feature at 1.4 μm most likely due to water. However, the amplitude of the absorption is less than that expected based on previous observations with Spitzer, possibly due to hazes absorbing in the NIR or non-solar compositions. The degeneracy of models with different compositions and temperature structures combined with the low amplitude of any features in the data preclude our ability to place unambiguous constraints on the atmospheric composition without additional observations with WFC3 to improve the signal-to-noise ratio and/or a comprehensive multi-wavelength analysis.
Comparison of three liquid lures for trapping social wasps (Hymenoptera: Vespidae).
Wegner, Gerald S; Jordan, Kyle K
2005-06-01
Two citrus-based sodas and a known wasp attractant were compared in a field trial to assess their attractiveness to local nuisance wasp species. The wasps captured included Vespula germanica (F.), Vespula maculifrons (Buysson), Vespula vulgaris (L.), Vespula flavopilosa Jacobson, Vespula squamosa (Drury), Dolichovespula maculata (L.), Polistes fuscatus (L.), Polistes metricus Say, and Polistes dominulus (Christ). Wasps in the genus Vespula were present in significantly higher numbers in traps than Dolichovespula and Polistes. Both citrus soda products were superior to the isobutanol-acetic acid mixture as attractants for almost all of the wasp species.
Kilpatrick, Brian M.; Lewis, Nikole K.; Kataria, Tiffany; Deming, Drake; Ingalls, James G.; Krick, Jessica E.; Tucker, Gregory S.
2017-01-01
We measure the 4.5 μm thermal emission of five transiting hot Jupiters, WASP-13b, WASP-15b, WASP-16b, WASP-62b, and HAT-P-22b using channel 2 of the Infrared Array Camera (IRAC) on the Spitzer Space Telescope. Significant intrapixel sensitivity variations in Spitzer IRAC data require careful correction in order to achieve precision on the order of several hundred parts per million (ppm) for the measurement of exoplanet secondary eclipses. We determine eclipse depths by first correcting the raw data using three independent data reduction methods. The Pixel Gain Map (PMAP), Nearest Neighbors (NNBR), and Pixel Level Decorrelation (PLD) each correct for the intrapixel sensitivity effect in Spitzer photometric time-series observations. The results from each methodology are compared against each other to establish if they reach a statistically equivalent result in every case and to evaluate their ability to minimize uncertainty in the measurement. We find that all three methods produce reliable results. For every planet examined here NNBR and PLD produce results that are in statistical agreement. However, the PMAP method appears to produce results in slight disagreement in cases where the stellar centroid is not kept consistently on the most well characterized area of the detector. We evaluate the ability of each method to reduce the scatter in the residuals as well as in the correlated noise in the corrected data. The NNBR and PLD methods consistently minimize both white and red noise levels and should be considered reliable and consistent. The planets in this study span equilibrium temperatures from 1100 to 2000 K and have brightness temperatures that require either high albedo or efficient recirculation. However, it is possible that other processes such as clouds or disequilibrium chemistry may also be responsible for producing these brightness temperatures.
Energy Technology Data Exchange (ETDEWEB)
Kilpatrick, Brian M.; Tucker, Gregory S. [Department of Physics, Box 1843, Brown University, Providence, RI 02904 (United States); Lewis, Nikole K. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Kataria, Tiffany [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Ingalls, James G.; Krick, Jessica E., E-mail: brian_kilpatrick@brown.edu, E-mail: nlewis@stsci.org, E-mail: tiffany.kataria@jpl.nasa.gov, E-mail: ddeming@astro.umd.edu, E-mail: krick@ipac.caltech.edu [Spitzer Science Center, Infrared Processing and Analysis Center, California Institute of Technology, Mail Code 220-6, Pasadena, CA 91125 (United States)
2017-01-01
We measure the 4.5 μ m thermal emission of five transiting hot Jupiters, WASP-13b, WASP-15b, WASP-16b, WASP-62b, and HAT-P-22b using channel 2 of the Infrared Array Camera (IRAC) on the Spitzer Space Telescope . Significant intrapixel sensitivity variations in Spitzer IRAC data require careful correction in order to achieve precision on the order of several hundred parts per million (ppm) for the measurement of exoplanet secondary eclipses. We determine eclipse depths by first correcting the raw data using three independent data reduction methods. The Pixel Gain Map (PMAP), Nearest Neighbors (NNBR), and Pixel Level Decorrelation (PLD) each correct for the intrapixel sensitivity effect in Spitzer photometric time-series observations. The results from each methodology are compared against each other to establish if they reach a statistically equivalent result in every case and to evaluate their ability to minimize uncertainty in the measurement. We find that all three methods produce reliable results. For every planet examined here NNBR and PLD produce results that are in statistical agreement. However, the PMAP method appears to produce results in slight disagreement in cases where the stellar centroid is not kept consistently on the most well characterized area of the detector. We evaluate the ability of each method to reduce the scatter in the residuals as well as in the correlated noise in the corrected data. The NNBR and PLD methods consistently minimize both white and red noise levels and should be considered reliable and consistent. The planets in this study span equilibrium temperatures from 1100 to 2000 K and have brightness temperatures that require either high albedo or efficient recirculation. However, it is possible that other processes such as clouds or disequilibrium chemistry may also be responsible for producing these brightness temperatures.
Queen signaling in social wasps
DEFF Research Database (Denmark)
van Zweden, Jelle Stijn; Bonckaert, Wim; Wenseleers, Tom
2014-01-01
Social Hymenoptera are characterized by a reproductive division of labor, whereby queens perform most of the reproduction and workers help to raise her offspring. A long-lasting debate is whether queens maintain this reproductive dominance by manipulating their daughter workers into remaining...... sterile (queen control), or if instead queens honestly signal their fertility and workers reproduce according to their own evolutionary incentives (queen signaling). Here, we test these competing hypotheses using data from Vespine wasps. We show that in natural colonies of the Saxon wasp, Dolichovespula...
REVISED STREAM CODE AND WASP5 BENCHMARK
International Nuclear Information System (INIS)
Chen, K
2005-01-01
STREAM is an emergency response code that predicts downstream pollutant concentrations for releases from the SRS area to the Savannah River. The STREAM code uses an algebraic equation to approximate the solution of the one dimensional advective transport differential equation. This approach generates spurious oscillations in the concentration profile when modeling long duration releases. To improve the capability of the STREAM code to model long-term releases, its calculation module was replaced by the WASP5 code. WASP5 is a US EPA water quality analysis program that simulates one-dimensional pollutant transport through surface water. Test cases were performed to compare the revised version of STREAM with the existing version. For continuous releases, results predicted by the revised STREAM code agree with physical expectations. The WASP5 code was benchmarked with the US EPA 1990 and 1991 dye tracer studies, in which the transport of the dye was measured from its release at the New Savannah Bluff Lock and Dam downstream to Savannah. The peak concentrations predicted by the WASP5 agreed with the measurements within ±20.0%. The transport times of the dye concentration peak predicted by the WASP5 agreed with the measurements within ±3.6%. These benchmarking results demonstrate that STREAM should be capable of accurately modeling releases from SRS outfalls
Volatile emissions from an epiphytic fungus are semiochemicals for eusocial wasps.
Davis, Thomas Seth; Boundy-Mills, Kyria; Landolt, Peter J
2012-11-01
Microbes are ubiquitous on plant surfaces. However, interactions between epiphytic microbes and arthropods are rarely considered as a factor that affects arthropod behaviors. Here, volatile emissions from an epiphytic fungus were investigated as semiochemical attractants for two eusocial wasps. The fungus Aureobasidium pullulans was isolated from apples, and the volatile compounds emitted by fungal colonies were quantified. The attractiveness of fungal colonies and fungal volatiles to social wasps (Vespula spp.) were experimentally tested in the field. Three important findings emerged: (1) traps baited with A. pullulans caught 2750 % more wasps on average than unbaited control traps; (2) the major headspace volatiles emitted by A. pullulans were 2-methyl-1-butanol, 3-methyl-1-butanol, and 2-phenylethyl alcohol; and (3) a synthetic blend of fungal volatiles attracted 4,933 % more wasps on average than unbaited controls. Wasps were most attracted to 2-methyl-1-butanol. The primary wasp species attracted to fungal volatiles were the western yellowjacket (Vespula pensylvanica) and the German yellowjacket (V. germanica), and both species externally vectored A. pullulans. This is the first study to link microbial volatile emissions with eusocial wasp behaviors, and these experiments indicate that volatile compounds emitted by an epiphytic fungus can be responsible for wasp attraction. This work implicates epiphytic microbes as important components in the community ecology of some eusocial hymenopterans, and fungal emissions may signal suitable nutrient sources to foraging wasps. Our experiments are suggestive of a potential symbiosis, but additional studies are needed to determine if eusocial wasp-fungal associations are widespread, and whether these associations are incidental, facultative, or obligate.
Phylogeny, evolution and classification of gall wasps: the plot thickens.
Directory of Open Access Journals (Sweden)
Fredrik Ronquist
Full Text Available Gall wasps (Cynipidae represent the most spectacular radiation of gall-inducing insects. In addition to true gall formers, gall wasps also include phytophagous inquilines, which live inside the galls induced by gall wasps or other insects. Here we present the first comprehensive molecular and total-evidence analyses of higher-level gall wasp relationships. We studied more than 100 taxa representing a rich selection of outgroups and the majority of described cynipid genera outside the diverse oak gall wasps (Cynipini, which were more sparsely sampled. About 5 kb of nucleotide data from one mitochondrial (COI and four nuclear (28S, LWRh, EF1alpha F1, and EF1alpha F2 markers were analyzed separately and in combination with morphological and life-history data. According to previous morphology-based studies, gall wasps evolved in the Northern Hemisphere and were initially herb gallers. Inquilines originated once from gall inducers that lost the ability to initiate galls. Our results, albeit not conclusive, suggest a different scenario. The first gall wasps were more likely associated with woody host plants, and there must have been multiple origins of gall inducers, inquilines or both. One possibility is that gall inducers arose independently from inquilines in several lineages. Except for these surprising results, our analyses are largely consistent with previous studies. They confirm that gall wasps are conservative in their host-plant preferences, and that herb-galling lineages have radiated repeatedly onto the same set of unrelated host plants. We propose a revised classification of the family into twelve tribes, which are strongly supported as monophyletic across independent datasets. Four are new: Aulacideini, Phanacidini, Diastrophini and Ceroptresini. We present a key to the tribes and discuss their morphological and biological diversity. Until the relationships among the tribes are resolved, the origin and early evolution of gall wasps will
SPITZER SECONDARY ECLIPSES OF WASP-18b
International Nuclear Information System (INIS)
Nymeyer, Sarah; Harrington, Joseph; Hardy, Ryan A.; Stevenson, Kevin B.; Campo, Christopher J.; Blecic, Jasmina; Bowman, William C.; Britt, Christopher B. T.; Cubillos, Patricio; Madhusudhan, Nikku; Collier-Cameron, Andrew; Maxted, Pierre F. L.; Loredo, Thomas J.; Hellier, Coel; Anderson, David R.; Gillon, Michael; Hebb, Leslie; Wheatley, Peter J.; Pollacco, Don
2011-01-01
The transiting exoplanet WASP-18b was discovered in 2008 by the Wide Angle Search for Planets project. The Spitzer Exoplanet Target of Opportunity Program observed secondary eclipses of WASP-18b using Spitzer's Infrared Array Camera in the 3.6 μm and 5.8 μm bands on 2008 December 20, and in the 4.5 μm and 8.0 μm bands on 2008 December 24. We report eclipse depths of 0.30% ± 0.02%, 0.39% ± 0.02%, 0.37% ± 0.03%, 0.41% ± 0.02%, and brightness temperatures of 3100 ± 90, 3310 ± 130, 3080 ± 140, and 3120 ± 110 K in order of increasing wavelength. WASP-18b is one of the hottest planets yet discovered—as hot as an M-class star. The planet's pressure-temperature profile most likely features a thermal inversion. The observations also require WASP-18b to have near-zero albedo and almost no redistribution of energy from the day side to the night side of the planet.
TRANSIT OBSERVATIONS OF THE WASP-10 SYSTEM
International Nuclear Information System (INIS)
Dittmann, J. A.; Close, L. M.; Scuderi, L. J.; Morris, M. D.
2010-01-01
We present here observations of the transit of WASP-10b on 2009 October 14 UT taken from the University of Arizona's 1.55 m Kuiper telescope on Mount Bigelow. Conditions were photometric and accuracies of 2.0 mmag rms were obtained throughout the transit. We have found that the ratio of the planet to host star radii is in agreement with the measurements of Christian et al. instead of the refinements of Johnson et al., suggesting that WASP-10b is indeed inflated beyond what is expected from theoretical modeling. We find no evidence for large (>20 s) transit timing variations in WASP-10b's orbit from the ephemeris of Christian et al. and Johnson et al.
Differential Properties of Venom Peptides and Proteins in Solitary vs. Social Hunting Wasps
Lee, Si Hyeock; Baek, Ji Hyeong; Yoon, Kyungjae Andrew
2016-01-01
The primary functions of venoms from solitary and social wasps are different. Whereas most solitary wasps sting their prey to paralyze and preserve it, without killing, as the provisions for their progeny, social wasps usually sting to defend their colonies from vertebrate predators. Such distinctive venom properties of solitary and social wasps suggest that the main venom components are likely to be different depending on the wasps’ sociality. The present paper reviews venom components and properties of the Aculeata hunting wasps, with a particular emphasis on the comparative aspects of venom compositions and properties between solitary and social wasps. Common components in both solitary and social wasp venoms include hyaluronidase, phospholipase A2, metalloendopeptidase, etc. Although it has been expected that more diverse bioactive components with the functions of prey inactivation and physiology manipulation are present in solitary wasps, available studies on venom compositions of solitary wasps are simply too scarce to generalize this notion. Nevertheless, some neurotoxic peptides (e.g., pompilidotoxin and dendrotoxin-like peptide) and proteins (e.g., insulin-like peptide binding protein) appear to be specific to solitary wasp venom. In contrast, several proteins, such as venom allergen 5 protein, venom acid phosphatase, and various phospholipases, appear to be relatively more specific to social wasp venom. Finally, putative functions of main venom components and their application are also discussed. PMID:26805885
DEFF Research Database (Denmark)
Skovgård, H; Jespersen, J B
1999-01-01
(Linnaeus). In total, seven pteromalid species were recovered: Spalangia cameroni Perkins, S. nigripes Curtis, S. subpunctata Förster, Muscidifurax raptorGirault & Sanders, Pachycrepoideus vindemiae (Rondani), Urolepis rufipes(Ashmead) and Nasonia vitripennis (Walker), an ichneumonid Phygadeuon fumator......Gravenhorst, a diapriid Trichopria sp., and a staphylinid Aleocharasp. This is the first time that U. rufipes has been recorded in Europe. Spalangia cameroni and M. raptor were the most frequently recorded species in all regions of the country, and accounted for the main parasitism of Musca domesticaand Stomoxys...... calcitrans puparia. The overall rate of parasitism per farm was low: 12.9% of the total number of fly puparia collected. Direct ordination, used to assess the habitat distribution of the parasitoids, showed that Muscidifurax raptor mainly seeks fly puparia in outdoor manure heaps and especially in manure...
International Nuclear Information System (INIS)
1995-01-01
As a continuation of its effort to provide comprehensive and impartial guidance to Member States facing the need for introducing nuclear power, the IAEA has completed a new version of the Wien Automatic System Planning (WASP) Package for carrying out power generation expansion planning studies. WASP was originally developed in 1972 in the USA to meet the IAEA's needs to analyze the economic competitiveness of nuclear power in comparison to other generation expansion alternatives for supplying the future electricity requirements of a country or region. The model was first used by the IAEA to conduct global studies (Market Survey for Nuclear Power Plants in Developing Countries, 1972-1973) and to carry out Nuclear Power Planning Studies for several Member States. The WASP system developed into a very comprehensive planning tool for electric power system expansion analysis. Following these developments, the so-called WASP-Ill version was produced in 1979. This version introduced important improvements to the system, namely in the treatment of hydroelectric power plants. The WASP-III version has been continually updated and maintained in order to incorporate needed enhancements. In 1981, the Model for Analysis of Energy Demand (MAED) was developed in order to allow the determination of electricity demand, consistent with the overall requirements for final energy, and thus, to provide a more adequate forecast of electricity needs to be considered in the WASP study. MAED and WASP have been used by the Agency for the conduct of Energy and Nuclear Power Planning Studies for interested Member States. More recently, the VALORAGUA model was completed in 1992 as a means for helping in the preparation of the hydro plant characteristics to be input in the WASP study and to verify that the WASP overall optimized expansion plan takes also into account an optimization of the use of water for electricity generation. The combined application of VALORAGUA and WASP permits the
Wasp sting: An unusual fatal outcome
International Nuclear Information System (INIS)
George, P.; Mathew, P.; Pawar, B.; Calton, N.
2008-01-01
Wasp stings are not uncommon especially in populations living in theproximity of forested area-s all over the world. Local manifestationsfollowing stings are common and unusually life threatening anaphylaxis mayoccur, requiring prompt treatment. Multi organ failure and acute renalfailure following wasp stings are rare and histological evaluation suggestacute tubular necrosis secondary to hemolysis, rhabdomyolysis and directvenom toxicity. A rare complication of a patient following multiple waspstings with disseminated intravascular coagulation, acute renal failure andthrombotic microangiopathy is presented. (author)
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-09-01
As a continuation of its effort to provide comprehensive and impartial guidance to Member States facing the need for introducing nuclear power, the IAEA has completed a new version of the Wien Automatic System Planning (WASP) Package for carrying out power generation expansion planning studies. WASP was originally developed in 1972 in the USA to meet the IAEA's needs to analyze the economic competitiveness of nuclear power in comparison to other generation expansion alternatives for supplying the future electricity requirements of a country or region. The model was first used by the IAEA to conduct global studies (Market Survey for Nuclear Power Plants in Developing Countries, 1972-1973) and to carry out Nuclear Power Planning Studies for several Member States. The WASP system developed into a very comprehensive planning tool for electric power system expansion analysis. Following these developments, the so-called WASP-Ill version was produced in 1979. This version introduced important improvements to the system, namely in the treatment of hydroelectric power plants. The WASP-III version has been continually updated and maintained in order to incorporate needed enhancements. In 1981, the Model for Analysis of Energy Demand (MAED) was developed in order to allow the determination of electricity demand, consistent with the overall requirements for final energy, and thus, to provide a more adequate forecast of electricity needs to be considered in the WASP study. MAED and WASP have been used by the Agency for the conduct of Energy and Nuclear Power Planning Studies for interested Member States. More recently, the VALORAGUA model was completed in 1992 as a means for helping in the preparation of the hydro plant characteristics to be input in the WASP study and to verify that the WASP overall optimized expansion plan takes also into account an optimization of the use of water for electricity generation. The combined application of VALORAGUA and WASP permits the
Ramírez-Benavides, William; Monge-Nájera, Julián; Chavarría, Juan B
2009-09-01
The fig pollinating wasps (Hymenoptera: Agaonidae) have obligate arrhenotoky and a breeding structure that fits local mate competition (LMC). It has been traditionally assumed that LMC organisms adjust the sex ratio by laying a greater proportion of male eggs when there is superparasitism (several foundresses in a host). We tested the assumption with two wasp species, Pegoscapus silvestrii, pollinator of Ficus pertusa and Pegoscapus tonduzi, pollinator of Ficus eximia (= F citrifolia), in the Central Valley of Costa Rica. Total number of wasps and seeds were recorded in individual isolated naturally colonized syconia. There was a constant additive effect between the number of foundresses and the number of males produced in the brood of a syconium, while the number of females decreased. Both wasp species seem to have precise sex ratios and probably lay the male eggs first in the sequence, independently of superparasitism and clutch size: consequently, they have a non-random sex allocation. Each syconium of Ficus pertusa and of F. eximia colonized by one foundress had similar mean numbers of females, males, and seeds. The two species of wasps studied do not seem to adjust the sex ratio when there is superparasitism. Pollinating fig wasp behavior is better explained by those models not assuming that females do mathematical calculations according to other females' sex ratios, size, number of foundresses, genetic constitution, clutch size or environmental conditions inside the syconium. Our results are in agreement with the constant male number hypothesis, not with sex ratio games.
Shukla, Shantanu; Pareek, Vidhi; Gadagkar, Raghavendra
2014-07-01
In many primitively eusocial wasp species new nests are founded either by a single female or by a small group of females. In the single foundress nests, the lone female develops her ovaries, lays eggs as well as tends her brood. In multiple foundress nests social interactions, especially dominance-subordinate interactions, result in only one 'dominant' female developing her ovaries and laying eggs. Ovaries of the remaining 'subordinate' cofoundresses remain suppressed and these individuals function as workers and tend the dominant's brood. Using the tropical, primitively eusocial polistine wasp Ropalidia marginata and by comparing wasps held in isolation and those kept as pairs in the laboratory, we demonstrate that social interactions affect ovarian development of dominant and subordinate wasps among the pairs in opposite directions, suppressing the ovaries of the subordinate member of the pair below that of solitary wasps and boosting the ovaries of dominant member of the pair above that of solitary females. In addition to being of physiological interest, such mirror image effects of aggression on the ovaries of the aggressors and their victims, suggest yet another mechanism by which subordinates can enhance their indirect fitness and facilitate the evolution of worker behavior by kin selection. Copyright © 2014 Elsevier B.V. All rights reserved.
Orchids mimic green-leaf volatiles to attract prey-hunting wasps for pollination.
Brodmann, Jennifer; Twele, Robert; Francke, Wittko; Hölzler, Gerald; Zhang, Qing-He; Ayasse, Manfred
2008-05-20
An outstanding feature of orchids is the diversity of their pollination systems [1]. Most remarkable are those species that employ chemical deceit for the attraction of pollinators [2]. The orchid Epipactis helleborine is a typical wasp flower, exhibiting physiological and morphological adaptations for the attraction of pollinating social wasps [3]. As noted by Darwin [1], this species is almost entirely overlooked by other potential pollinators, despite a large nectar reward. Therefore, the mechanism for the attraction of pollinating social wasps was something of a mystery. By using a combination of behavioral experiments, electrophysiological investigations, and chemical analyses, we demonstrate for the first time that the flowers of E. helleborine and E. purpurata emit green-leaf volatiles (GLVs), which are attractive to foragers of the social wasps Vespula germanica and V. vulgaris. GLVs, emitted by damaged plant tissues, are known to guide parasitic wasps to their hosts [4]. Several E. helleborine GLVs that induced response in the antennae of wasps were also emitted by cabbage leaves infested with caterpillars (Pieris brassicae), which are common prey items for wasps [5]. This is the first example in which GLVs have been implicated in chemical mimicry for the attraction of pollinating insects.
Chemical Strategies of the Beetle Metoecus Paradoxus, Social Parasite of the Wasp Vespula Vulgaris.
Van Oystaeyen, Annette; van Zweden, Jelle S; Huyghe, Hilde; Drijfhout, Falko; Bonckaert, Wim; Wenseleers, Tom
2015-12-01
The parasitoid beetle Metoecus paradoxus frequently parasitizes colonies of the common wasp, Vespula vulgaris. It penetrates a host colony as a larva that attaches itself onto a foraging wasp's body and, once inside the nest, it feeds on a wasp larva inside a brood cell and then pupates. Avoiding detection by the wasp host is crucial when the beetle emerges. Here, we tested whether adult M. paradoxus beetles avoid detection by mimicking the cuticular hydrocarbon profile of their host. The beetles appear to be chemically adapted to their main host species, the common wasp, because they share more hydrocarbon compounds with it than they do with the related German wasp, V. germanica. In addition, aggression tests showed that adult beetles were attacked less by common wasp workers than by German wasp workers. Our results further indicated that the host-specific compounds were, at least partially, produced through recycling of the prey's hydrocarbons, and were not acquired through contact with the adult host. Moreover, the chemical profile of the beetles shows overproduction of the wasp queen pheromone, nonacosane (n-C29), suggesting that beetles might mimic the queen's pheromonal bouquet.
Directory of Open Access Journals (Sweden)
William Ramírez-Benavides
2009-09-01
Full Text Available The fig pollinating wasps (Hymenoptera: Agaonidae have obligate arrhenotoky and a breeding structure that fits local mate competition (LMC. It has been traditionally assumed that LMC organisms adjust the sex ratio by laying a greater proportion of male eggs when there is superparasitism (several foundresses in a host. We tested the assumption with two wasp species, Pegoscapus silvestrii, pollinator of Ficus pertusa and Pegoscapus tonduzi, pollinator of Ficus eximia (= F. citrifolia, in the Central Valley of Costa Rica. Total number of wasps and seeds were recorded in individual isolated naturally colonized syconia. There was a constant additive effect between the number of foundresses and the number of males produced in the brood of a syconium, while the number of females decreased. Both wasp species seem to have precise sex ratios and probably lay the male eggs first in the sequence, independently of superparasitism and clutch size: consequently, they have a non-random sex allocation. Each syconium of Ficus pertusa and of F. eximia colonized by one foundress had similar mean numbers of females, males, and seeds. The two species of wasps studied do not seem to adjust the sex ratio when there is superparasitism. Pollinating fig wasp behavior is better explained by those models not assuming that females do mathematical calculations according to other females’ sex ratios, size, number of foundresses, genetic constitution, clutch size or environmental conditions inside the syconium. Our results are in agreement with the constant male number hypothesis, not with sex ratio games. Rev. Biol. Trop. 57 (3: 605-621. Epub 2009 September 30.
N-wasp is essential for the negative regulation of B cell receptor signaling.
Directory of Open Access Journals (Sweden)
Chaohong Liu
2013-11-01
Full Text Available Negative regulation of receptor signaling is essential for controlling cell activation and differentiation. In B-lymphocytes, the down-regulation of B-cell antigen receptor (BCR signaling is critical for suppressing the activation of self-reactive B cells; however, the mechanism underlying the negative regulation of signaling remains elusive. Using genetically manipulated mouse models and total internal reflection fluorescence microscopy, we demonstrate that neuronal Wiskott-Aldrich syndrome protein (N-WASP, which is coexpressed with WASP in all immune cells, is a critical negative regulator of B-cell signaling. B-cell-specific N-WASP gene deletion causes enhanced and prolonged BCR signaling and elevated levels of autoantibodies in the mouse serum. The increased signaling in N-WASP knockout B cells is concurrent with increased accumulation of F-actin at the B-cell surface, enhanced B-cell spreading on the antigen-presenting membrane, delayed B-cell contraction, inhibition in the merger of signaling active BCR microclusters into signaling inactive central clusters, and a blockage of BCR internalization. Upon BCR activation, WASP is activated first, followed by N-WASP in mouse and human primary B cells. The activation of N-WASP is suppressed by Bruton's tyrosine kinase-induced WASP activation, and is restored by the activation of SH2 domain-containing inositol 5-phosphatase that inhibits WASP activation. Our results reveal a new mechanism for the negative regulation of BCR signaling and broadly suggest an actin-mediated mechanism for signaling down-regulation.
WASP-12b and Its Possible Fiery Demise
Kohler, Susanna
2017-07-01
Jupiter-like planets on orbits close to their hosts are predicted to spiral ever closer to their hosts until they meet their eventual demise and yet weve never observed orbital decay. Could WASP-12b provide the first evidence?Undetected PredictionsSince the discovery of the first hot Jupiter more than 20 years ago, weve studied a number of these peculiar exoplanets. Despite our many observations, two phenomena predicted of hot Jupiters have not yet been detected, due to the long timescales needed to identify them:Tidal orbital decayTidal forces should cause a hot Jupiters orbit to shrink over time, causing the planet to eventually spiral into its host star. This phenomenon would explain a number of statistical properties of observed star-planet systems (for instance, the scarcity of gas giants with periods less than a day).An illustration of apsidal precession. [Mpfiz]Apsidal precessionThe orbits of hot Jupiters should be apsidally precessing on timescales of decades, as long as they are at least slightly eccentric. Since the precession rate depends on the planets tidally deformed mass distribution, measuring this would allow us to probe the interior of the planet.A team of scientists led by Kishore Patra (Massachusetts Institute of Technology) think that the hot Jupiter WASP-12b may be our first chance to study one of these two phenomena. The question is, which one?WASP-12bWASP-12b has orbital period of 1.09 days one of the shortest periods observed for a giant planet and weve monitored it for a decade, making it a great target to test for both of these long-term effects.Timing residuals for WASP-12b. Squares show the new data points, circles show previous data from the past decade. The data are better fit by the decay model than the precession model, but both are still consistent. [Patra et al. 2017]Patra and collaborators made transit observations with the 1.2-m telescope at the Fred Lawrence Whipple Observatory in Arizona and occultation observations with the
Social Learning in Vespula Germanica Wasps: Do They Use Collective Foraging Strategies?
Lozada, Mariana; D' Adamo, Paola; Buteler, Micaela; Kuperman, Marcelo N
2016-01-01
Vespula germanica is a social wasp that has become established outside its native range in many regions of the world, becoming a major pest in the invaded areas. In the present work we analyze social communication processes used by V. germanica when exploiting un-depleted food sources. For this purpose, we investigated the arrival pattern of wasps at a protein bait and evaluated whether a forager recruited conspecifics in three different situations: foragers were able to return to the nest (full communication), foragers were removed on arrival (communication impeded), or only one forager was allowed to return to the nest (local enhancement restricted). Results demonstrated the existence of recruitment in V. germanica, given that very different patterns of wasp arrivals and a higher frequency of wasp visits to the resource were observed when communication flow between experienced and naive foragers was allowed. Our findings showed that recruitment takes place at a distance from the food source, in addition to local enhancement. When both local enhancement and distant recruitment were occurring simultaneously, the pattern of wasp arrival was exponential. When recruitment occurred only distant from the feeder, the arrival pattern was linear, but the number of wasps arriving was twice as many as when neither communication nor local enhancement was allowed. Moreover, when return to the nest was impeded, wasp arrival at the bait was regular and constant, indicating that naive wasps forage individually and are not spatially aggregated. In conclusion, this is the first study to demonstrate recruitment in V. germanica at a distance from the food source by modelling wasps' arrival to a protein-based resource. In addition, the existence of correlations when communication was allowed and reflected in tandem arrivals indicates that we were not in the presence of random processes.
Social Learning in Vespula Germanica Wasps: Do They Use Collective Foraging Strategies?
Directory of Open Access Journals (Sweden)
Mariana Lozada
Full Text Available Vespula germanica is a social wasp that has become established outside its native range in many regions of the world, becoming a major pest in the invaded areas. In the present work we analyze social communication processes used by V. germanica when exploiting un-depleted food sources. For this purpose, we investigated the arrival pattern of wasps at a protein bait and evaluated whether a forager recruited conspecifics in three different situations: foragers were able to return to the nest (full communication, foragers were removed on arrival (communication impeded, or only one forager was allowed to return to the nest (local enhancement restricted. Results demonstrated the existence of recruitment in V. germanica, given that very different patterns of wasp arrivals and a higher frequency of wasp visits to the resource were observed when communication flow between experienced and naive foragers was allowed. Our findings showed that recruitment takes place at a distance from the food source, in addition to local enhancement. When both local enhancement and distant recruitment were occurring simultaneously, the pattern of wasp arrival was exponential. When recruitment occurred only distant from the feeder, the arrival pattern was linear, but the number of wasps arriving was twice as many as when neither communication nor local enhancement was allowed. Moreover, when return to the nest was impeded, wasp arrival at the bait was regular and constant, indicating that naive wasps forage individually and are not spatially aggregated. In conclusion, this is the first study to demonstrate recruitment in V. germanica at a distance from the food source by modelling wasps' arrival to a protein-based resource. In addition, the existence of correlations when communication was allowed and reflected in tandem arrivals indicates that we were not in the presence of random processes.
The Community of Hymenoptera Parasitizing Necrophagous Diptera in an Urban Biotope
Frederickx, Christine; Dekeirsschieter, Jessica; Verheggen, François J.; Haubruge, Eric
2013-01-01
Most reports published in the field of forensic entomology are focused on Diptera and neglect the Hymenoptera community. However, Hymenoptera are part of the entomofaunal colonization of a dead body. The use of Hymenoptera parasitoids in forensic entomology can be relevant to evaluate the time of death. Hymenoptera parasitoids of the larvae and pupae of flies may play an important role in the estimation of the post-mortem period because their time of attack is often restricted to a small, well-defined window of time in the development of the host insect. However, these parasitoids can interfere with the developmental times of colonizing Diptera, and therefore a better understanding of their ecology is needed. The work reported here monitored the presence of adult Hymenoptera parasitoids on decaying pig carcasses in an urban biotope during the summer season (from May to September). Six families and six species of parasitoids were recorded in the field: Aspilota fuscicornis Haliday (Braconidae), Alysia manducator Panzer, Nasonia vitripennis Walker (Pteromalidae), Tachinaephagus zealandicus Ashmead (Encyrtidae), Trichopria sp. (Diapriidae), and Figites sp. (Figitidae). In the laboratory, five species emerged from pupae collected in the field: Trichopria sp., Figites sp., A. manducator, N. vitripennis, and T. zealandicus. These five species colonize a broad spectrum of Diptera hosts, including those species associated with decomposing carcasses, namely those from the families Calliphoridae, Muscidae, Fanniidae, and Sarcophagidae. PMID:23895458
Pre-hospital treatment of bee and wasp induced anaphylactic reactions
DEFF Research Database (Denmark)
Ruiz Oropeza, Athamaica; Mikkelsen, Søren; Bindslev-Jensen, Carsten
2017-01-01
BACKGROUND: Bee and wasp stings are among the most common triggers of anaphylaxis in adults representing around 20% of fatal anaphylaxis from any cause. Data of pre-hospital treatment of bee and wasp induced anaphylactic reactions are sparse. This study aimed to estimate the incidence of bee...... only for Odense and 2009-2014 for the whole region). Discharge summaries with diagnosis related to anaphylaxis according to the International Classification of Diseases 10 (ICD-10) were reviewed to identify bee and wasp induced anaphylactic reactions. The severity of the anaphylactic reaction...... was assessed according to Sampson's severity score and Mueller's severity score. Treatment was evaluated in relation to administration of adrenaline, glucocorticoids and antihistamine. RESULTS: We identified 273 cases (Odense 2008 n = 14 and Region of Southern Denmark 2009-2014 n = 259) of bee and wasp induced...
McCann, Sean; Moeri, Onour; Jones, Tanya; Scott, Catherine; Khaskin, Grigori; Gries, Regine; O'Donnell, Sean; Gries, Gerhard
2013-01-01
Red-throated Caracaras Ibycter americanus (Falconidae) are specialist predators of social wasps in the Neotropics. It had been proposed that these caracaras possess chemical repellents that allow them to take the brood of wasp nests without being attacked by worker wasps. To determine how caracaras exploit nests of social wasps and whether chemical repellents facilitate predation, we: (1) video recorded the birds attacking wasp nests; (2) analyzed surface extracts of the birds' faces, feet, and feathers for potential chemical repellents; and (3) inflicted mechanical damage on wasp nests to determine the defensive behavior of wasps in response to varying levels of disturbance. During caracara predation events, two species of large-bodied wasps mounted stinging attacks on caracaras, whereas three smaller-bodied wasp species did not. The "hit-and-run" predation tactic of caracaras when they attacked nests of large and aggressive wasps reduced the risk of getting stung. Our data reveal that the predation strategy of caracaras is based on mechanical disturbance of, and damage to, target wasp nests. Caracara attacks and severe experimental disturbance of nests invariably caused wasps to abscond (abandon their nests). Two compounds in caracara foot extracts [sulcatone and iridodial] elicited electrophysiological responses from wasp antennae, and were also present in defensive secretions of sympatric arboreal-nesting Azteca ants. These compounds appear not to be wasp repellents but to be acquired coincidentally by caracaras when they perch on trees inhabited with Azteca ants. We conclude that caracara predation success does not depend on wasp repellents but relies on the absconding response that is typical of swarm-founding polistine wasps. Our study highlights the potential importance of vertebrate predators in the ecology and evolution of social wasps.
Genetics of sex determination in the haplodiploid wasp Nasonia ...
Indian Academy of Sciences (India)
2010-09-06
Sep 6, 2010 ... How gender is determined under haplodiploidy in the ab- sence of heteromorphic sex ... determination (see below). Sex-determination mutants ... not others (Nöthiger and Steinmann-Zwicky 1985; Wilkins. 1995; Saccone et al.
WASP in Nuclear Power Planning
International Nuclear Information System (INIS)
Cao Chi; Vuong Minh Quang; Nguyen Tri Ho
1993-03-01
The main modules of WASP are presented in details in the introduction paragraph. The authors have emphasized on the probabilistic simulation used in WASP for evaluating different costs of the objective function and the Bellman principle for finding the optimal trajectory in dynamic programming. In the second paragraph the principal results obtained by the Nuclear Power Dept. of VINATOM are enumerated: a/the most cost-effective solution for Vietnam is to introduce a nuclear power capacity of 800-1200 MW by around the year 2010; b/ different types of reactors for the first NPP are ranked according to their economic criteria; c/ the sensitivity analysis is also carried out with respect to discount rates, LOLP (loss of load probability), ENS (energy non served), construction cost. (author). 4 figs, 7 tabs
Unusual fatal multiple-organ dysfunction and pancreatitis induced by a single wasp sting
Directory of Open Access Journals (Sweden)
C Azad
2011-01-01
Full Text Available Acute onset of multiple organ dysfunction syndrome (MODS is a well-known complication following multiple wasp stings. However, MODS after a single wasp sting has been rarely reported in children and acute pancreatitis have probably never been observed before. Herein we describe the case of a 12-year-old boy who had urticaria and abdominal pain after a single wasp sting. The child gradually developed MODS while his abdominal complaints were worsening. Despite aggressive supportive management, the child did not survive. Afterward, the cause of the acute abdomen was finally diagnosed as acute pancreatitis. Both MODS and pancreatitis following a single wasp sting are very unusual. Thus, although pancreatitis is rarely manifested, it should be suspected after a wasp sting if there are predominant abdominal symptoms.
Czech Academy of Sciences Publication Activity Database
Rivers, D. B.; Žďárek, Jan; Denlinger, D. L.
2004-01-01
Roč. 57, - (2004), s. 78-91 ISSN 0739-4462 R&D Projects: GA ČR GA522/01/0501 Grant - others:USDA-NRI(US) 98-35302-6659; USDA-NRICGP(US) 2001-1005 Institutional research plan: CEZ:AV0Z4055905 Keywords : ectoparasitoid * ecdysone * fly development Subject RIV: CC - Organic Chemistry Impact factor: 1.173, year: 2004
Water Quality Analysis Simulation Program (WASP)
The Water Quality Analysis Simulation Program (WASP) model helps users interpret and predict water quality responses to natural phenomena and manmade pollution for various pollution management decisions.
International Nuclear Information System (INIS)
Solov'ev, A.G.
2001-01-01
WASP package is a C++ program aimed to analyze angular distributions of secondary particles generated in nuclear interactions. (WASP is designed for data analysis of the STAR and ALICE experiments). It uses a wavelet analysis for this purpose and the vanishing momentum or gaussian wavelets are chosen for transformations. WASP provides an user-friendly Graphical User Interface (GUI) which makes it quite simple to use. WASP design, a brief description of the used wavelet transformation algorithm and GUI are presented in this user's guide
Uma, Divya B; Weiss, Martha R
2012-12-01
An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.
Bee-hawking by the wasp, Vespa velutina, on the honeybees Apis cerana and A. mellifera.
Tan, K; Radloff, S E; Li, J J; Hepburn, H R; Yang, M X; Zhang, L J; Neumann, P
2007-06-01
The vespine wasps, Vespa velutina, specialise in hawking honeybee foragers returning to their nests. We studied their behaviour in China using native Apis cerana and introduced A. mellifera colonies. When the wasps are hawking, A. cerana recruits threefold more guard bees to stave off predation than A. mellifera. The former also utilises wing shimmering as a visual pattern disruption mechanism, which is not shown by A. mellifera. A. cerana foragers halve the time of normal flight needed to dart into the nest entrance, while A. mellifera actually slows down in sashaying flight manoeuvres. V. velutina preferentially hawks A. mellifera foragers when both A. mellifera and A. cerana occur in the same apiary. The pace of wasp-hawking was highest in mid-summer but the frequency of hawking wasps was three times higher at A. mellifera colonies than at the A. cerana colonies. The wasps were taking A. mellifera foragers at a frequency eightfold greater than A. cerana foragers. The final hawking success rates of the wasps were about three times higher for A. mellifera foragers than for A. cerana. The relative success of native A. cerana over European A. mellifera in thwarting predation by the wasp V. velutina is interpreted as the result of co-evolution between the Asian wasp and honeybee, respectively.
Evolutionary conservation and changes in insect TRP channels.
Matsuura, Hironori; Sokabe, Takaaki; Kohno, Keigo; Tominaga, Makoto; Kadowaki, Tatsuhiko
2009-09-10
TRP (Transient Receptor Potential) channels respond to diverse stimuli and thus function as the primary integrators of varied sensory information. They are also activated by various compounds and secondary messengers to mediate cell-cell interactions as well as to detect changes in the local environment. Their physiological roles have been primarily characterized only in mice and fruit flies, and evolutionary studies are limited. To understand the evolution of insect TRP channels and the mechanisms of integrating sensory inputs in insects, we have identified and compared TRP channel genes in Drosophila melanogaster, Bombyx mori, Tribolium castaneum, Apis mellifera, Nasonia vitripennis, and Pediculus humanus genomes as part of genome sequencing efforts. All the insects examined have 2 TRPV, 1 TRPN, 1 TRPM, 3 TRPC, and 1 TRPML subfamily members, demonstrating that these channels have the ancient origins in insects. The common pattern also suggests that the mechanisms for detecting mechanical and visual stimuli and maintaining lysosomal functions may be evolutionarily well conserved in insects. However, a TRPP channel, the most ancient TRP channel, is missing in B. mori, A. mellifera, and N. vitripennis. Although P. humanus and D. melanogaster contain 4 TRPA subfamily members, the other insects have 5 TRPA subfamily members. T. castaneum, A. mellifera, and N. vitripennis contain TRPA5 channels, which have been specifically retained or gained in Coleoptera and Hymenoptera. Furthermore, TRPA1, which functions for thermotaxis in Drosophila, is missing in A. mellifera and N. vitripennis; however, they have other Hymenoptera-specific TRPA channels (AmHsTRPA and NvHsTRPA). NvHsTRPA expressed in HEK293 cells is activated by temperature increase, demonstrating that HsTRPAs function as novel thermal sensors in Hymenoptera. The total number of insect TRP family members is 13-14, approximately half that of mammalian TRP family members. As shown for mammalian TRP channels, this
Evolutionary conservation and changes in insect TRP channels
Directory of Open Access Journals (Sweden)
Tominaga Makoto
2009-09-01
Full Text Available Abstract Background TRP (Transient Receptor Potential channels respond to diverse stimuli and thus function as the primary integrators of varied sensory information. They are also activated by various compounds and secondary messengers to mediate cell-cell interactions as well as to detect changes in the local environment. Their physiological roles have been primarily characterized only in mice and fruit flies, and evolutionary studies are limited. To understand the evolution of insect TRP channels and the mechanisms of integrating sensory inputs in insects, we have identified and compared TRP channel genes in Drosophila melanogaster, Bombyx mori, Tribolium castaneum, Apis mellifera, Nasonia vitripennis, and Pediculus humanus genomes as part of genome sequencing efforts. Results All the insects examined have 2 TRPV, 1 TRPN, 1 TRPM, 3 TRPC, and 1 TRPML subfamily members, demonstrating that these channels have the ancient origins in insects. The common pattern also suggests that the mechanisms for detecting mechanical and visual stimuli and maintaining lysosomal functions may be evolutionarily well conserved in insects. However, a TRPP channel, the most ancient TRP channel, is missing in B. mori, A. mellifera, and N. vitripennis. Although P. humanus and D. melanogaster contain 4 TRPA subfamily members, the other insects have 5 TRPA subfamily members. T. castaneum, A. mellifera, and N. vitripennis contain TRPA5 channels, which have been specifically retained or gained in Coleoptera and Hymenoptera. Furthermore, TRPA1, which functions for thermotaxis in Drosophila, is missing in A. mellifera and N. vitripennis; however, they have other Hymenoptera-specific TRPA channels (AmHsTRPA and NvHsTRPA. NvHsTRPA expressed in HEK293 cells is activated by temperature increase, demonstrating that HsTRPAs function as novel thermal sensors in Hymenoptera. Conclusion The total number of insect TRP family members is 13-14, approximately half that of mammalian TRP
PLN's experience with the WASP-III model in generation expansion planning for the Java system
International Nuclear Information System (INIS)
Sudja, N.; Afiff, A.; Simarmata, B.
1988-01-01
The State Electric Power Corporation of Indonesia (PLN) was one of the first recipients of the WASP computer model, and since 1976 has been using the model (first the version WASP-II, and later the WASP-III version) for carrying out generation expansion planning studies for the country, and particularly, for the Java power system. This paper discusses PLN's experience with WASP-III and comments on some problems and constraints encountered, particularly: the time-fixed forced outage rate (FOR) assumed for generating units, simulation of the hydro system and computation time. The paper concludes with some suggestions about future enhancements to WASP-III. (author). 3 figs, 11 tabs
DEFF Research Database (Denmark)
Poulsen, Michael; Oh, Dong-Chan; Clardy, Jon
2011-01-01
and solitary Hymenoptera. Here we test this possibility by examining two species of solitary mud dauber wasps, Sceliphron caementarium and Chalybion californicum. We performed enrichment isolations from 33 wasps and obtained more than 200 isolates of Streptomyces Actinobacteria. Chemical analyses of 15...... and antibacterial activity. The prevalence and anti-microbial properties of Actinobacteria associated with these two solitary wasp species suggest the potential role of these Streptomyces as antibiotic-producing symbionts, potentially helping defend their wasp hosts from pathogenic microbes. Finding...... phylogenetically diverse and chemically prolific Actinobacteria from solitary wasps suggests that insect-associated Actinobacteria can provide a valuable source of novel natural products of pharmaceutical interest....
Efficacy of fipronil for control of yellowjacket wasps in Hawaii Volcanoes National Park
Foote, David; Hanna, Cause; King, Cynthia; Spurr, Eric
2011-01-01
The western yellowjacket wasp (Vespula pensylvanica) invaded Hawai`i’s national parks and refuges following its spread throughout the islands in the late 1970s. The endemic arthropod fauna of Hawai`i is thought to be especially vulnerable to these predacious social Hymenoptera, and methods of wasp control have been a priority for conservation biology in Hawai`i. The efficacy of the insecticide fipronil mixed with minced canned chicken meat for suppression of yellowjacket populations was evaluated in five experimental field trials in Hawai`i Volcanoes National Park between 1999 and 2005. Populations of Vespula were monitored in replicate twoto four- hectare study areas in mesic montane and seasonal submontane forests, before and after application of chicken bait, with and without 0.1% fipronil, and in treatment and nontreatment areas. The bait was applied in hanging bait stations for two to three days. The response of yellowjacket wasp populations was measured using at least three different metrics of abundance including instantaneous counts of wasps at bait stations, wasp traffic rates at Vespula nests, as well as heptyl butyrate trap and/or malaise trap catches in the study areas. All indices of wasp abundance exhibited significant reductions in sites treated with fipronil compared with non-treatment sites with the exception of malaise trapping, where only a limited number of traps were available to be deployed. Wasp traffic ceased at all Vespula nests in sites treated with fipronil within a month after baiting in four of the five trials. The only trial where fipronil failed to terminate yellowjacket nest activity occurred late in the fall when wasps switch from feeding on protein to carbohydrate foods. Based on these data, 0.1% fipronil in chicken bait appears to be an effective tool for suppressing local Vespula yellowjacket populations in the park and other natural areas during the period of peak wasp activity in the summer and early fall months.
Homalodisca vitripennis, one of the main vectors of Xylella fastidiosa, is associated with citrus plantings in California, USA. Infested citrus orchards act as a source of vectors to adjacent vineyards where X. fastidiosa causes Pierce’s disease (PD). An analysis of the pattern and rate of movement ...
Five new associations of parasitoids in potter wasps (Vespidae, Eumeninae
Directory of Open Access Journals (Sweden)
Tiago H. Auko
2014-12-01
Full Text Available Five new associations of parasitoids in potter wasps (Vespidae, Eumeninae. New associations of host and parasitoids involving potter wasps: Toxophora leucon and Pleurochrysis sp. were found parasitizing Cyphomenes anisitsii, Chrysis sp. (gr. intricans was found parasitizing Minixi suffusum, Plega beardi was found parasitizing Montezumia pelagica sepulchralis and Macrosiagon sp. was found parasitizing Pachodynerus nasidens.
Worker policing in the German wasp Vespula germanica
Wim Bonckaert; Kristel Vuerinckx; Johan Billen; Rob L. Hammond; Laurent Keller; Tom Wenseleers
2008-01-01
In some ants, bees, and wasps, workers kill or "police" male eggs laid by other workers in order to maintain the reproductive primacy of the queen. Kin selection theory predicts that multiple mating by the queen is one factor that can selectively favor worker policing. This is because when the queen is mated to multiple males, workers are more closely related to the queen's sons than to the sons of other workers. Earlier work has suggested that reproductive patterns in the German wasp Vespula...
Non-detection of a Helium Exosphere for the Hot Jupiter WASP-12b
Kreidberg, Laura; Oklopčić, Antonija
2018-06-01
An exosphere was recently detected around the exoplanet WASP-107b, a low-density, warm Neptune, based on an absorption feature from metastable helium (which has a vacuum wavelength of 10833 \\AA). Inspired by the WASP-107b detection, we reanalyzed archival HST observations of another evaporating exoplanet, WASP-12b, to search for signs of helium in its exosphere. We find no significant increase in transit depth at 10833 \\AA. We compare this result to theoretical predictions from a 1D model, and find that the expected helium feature amplitude is small, in agreement with the observed non-detection. We discuss possible explanations for why the helium feature is weaker for WASP-12b than WASP-107b, and conclude that the amplitude of the signal is highly sensitive to the stellar spectrum and the geometry of the evaporating gas cloud. These considerations should be taken into account in the design of future searches for helium exospheres.
International Nuclear Information System (INIS)
Sakuma, Chisato; Sato, Mitsuru; Oshima, Takuma; Takenouchi, Takato; Chiba, Joe; Kitani, Hiroshi
2015-01-01
Wiskott-Aldrich syndrome protein (WASP) is an adaptor molecule in immune cells. Recently, we showed that the WASP N-terminal domain interacted with the SH3 domain of Bruton's tyrosine kinase (Btk), and that the complex formed by WASP and Btk was important for TLR2 and TLR4 signaling in macrophages. Several other studies have shown that Btk played important roles in modulating innate immune responses through TLRs in immune cells. Here, we evaluated the significance of the interaction between WASP and Btk in TLR3, TLR7, and TLR9 signaling. We established bone marrow–derived macrophage cell lines from transgenic (Tg) mice that expressed intracellular antibodies (intrabodies) that specifically targeted the WASP N-terminal domain. One intrabody comprised the single-chain variable fragment and the other comprised the light-chain variable region single domain of an anti-WASP N-terminal monoclonal antibody. Both intrabodies inhibited the specific interaction between WASP and Btk, which impaired the expression of TNF-α, IL-6, and IL-1β in response to TLR3, TLR7, or TLR9 stimulation. Furthermore, the intrabodies inhibited the phosphorylation of both nuclear factor (NF)-κB and WASP in response to TLR3, TLR7, or TLR9 stimulation, in the Tg bone marrow-derived macrophages. These results suggested that WASP plays important roles in TLR3, TLR7, and TLR9 signaling by associating with Btk in macrophages. - Highlights: • The interaction between WASP and Btk is critical for TLR3, TLR7, and TLR9 signaling. • Anti-WASP intrabodies inhibited several TLR pathways that led to cytokine expression. • Phosphorylation of NF-κB via TLR signaling was inhibited by anti-WASP intrabodies. • WASP phosphorylation via several TLR ligands was inhibited by anti-WASP intrabodies
Energy Technology Data Exchange (ETDEWEB)
Sakuma, Chisato [Animal Immune and Cell Biology Research Unit, National Institute of Agrobiological Sciences, 1-2 Ohwashi, Tsukuba, Ibaraki, 305-8634 (Japan); Sato, Mitsuru, E-mail: mitsuru.sato@affrc.go.jp [Animal Immune and Cell Biology Research Unit, National Institute of Agrobiological Sciences, 1-2 Ohwashi, Tsukuba, Ibaraki, 305-8634 (Japan); Oshima, Takuma [Department of Biological Science and Technology, Graduate School of Faculty of Industrial Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba, 278-8510 (Japan); Takenouchi, Takato [Animal Immune and Cell Biology Research Unit, National Institute of Agrobiological Sciences, 1-2 Ohwashi, Tsukuba, Ibaraki, 305-8634 (Japan); Chiba, Joe [Department of Biological Science and Technology, Graduate School of Faculty of Industrial Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba, 278-8510 (Japan); Kitani, Hiroshi [Animal Immune and Cell Biology Research Unit, National Institute of Agrobiological Sciences, 1-2 Ohwashi, Tsukuba, Ibaraki, 305-8634 (Japan)
2015-02-27
Wiskott-Aldrich syndrome protein (WASP) is an adaptor molecule in immune cells. Recently, we showed that the WASP N-terminal domain interacted with the SH3 domain of Bruton's tyrosine kinase (Btk), and that the complex formed by WASP and Btk was important for TLR2 and TLR4 signaling in macrophages. Several other studies have shown that Btk played important roles in modulating innate immune responses through TLRs in immune cells. Here, we evaluated the significance of the interaction between WASP and Btk in TLR3, TLR7, and TLR9 signaling. We established bone marrow–derived macrophage cell lines from transgenic (Tg) mice that expressed intracellular antibodies (intrabodies) that specifically targeted the WASP N-terminal domain. One intrabody comprised the single-chain variable fragment and the other comprised the light-chain variable region single domain of an anti-WASP N-terminal monoclonal antibody. Both intrabodies inhibited the specific interaction between WASP and Btk, which impaired the expression of TNF-α, IL-6, and IL-1β in response to TLR3, TLR7, or TLR9 stimulation. Furthermore, the intrabodies inhibited the phosphorylation of both nuclear factor (NF)-κB and WASP in response to TLR3, TLR7, or TLR9 stimulation, in the Tg bone marrow-derived macrophages. These results suggested that WASP plays important roles in TLR3, TLR7, and TLR9 signaling by associating with Btk in macrophages. - Highlights: • The interaction between WASP and Btk is critical for TLR3, TLR7, and TLR9 signaling. • Anti-WASP intrabodies inhibited several TLR pathways that led to cytokine expression. • Phosphorylation of NF-κB via TLR signaling was inhibited by anti-WASP intrabodies. • WASP phosphorylation via several TLR ligands was inhibited by anti-WASP intrabodies.
Small-scale area effect on species richness and nesting occupancy of cavity-nesting bees and wasps
Directory of Open Access Journals (Sweden)
Rafael D. Loyola
2011-03-01
Full Text Available Small-scale area effect on species richness and nesting occupancy of cavity-nesting bees and wasps. The research was conducted in an urban forest remnant in southeast Brazil. We tested the predictions of the following hypotheses: (1 larger areas present higher species richness of bees and wasps, (2 solitary bees and wasps occupy more nests in larger areas, (3 rare species occupy more nests in smaller areas. We sampled Aculeate bees and wasps using trap nests from February to November 2004. We placed trap nests in sampling units (SU with different size (25, 100 and 400 m² located in 6 ha of secondary mesophytic forest. One hundred and thirty-seven trap nests were occupied by seven species of bees and four species of wasps. We found an increase in wasp, but not bee species richness following increase in SU size. Hymenoptera richness (i.e. bees plus wasps was also greater in larger SU. Both the number and density of occupied nests increased with SU size. The wasp Trypoxylon lactitarse responded significantly to area size, larger SU having more occupied nests. The same pattern was exhibited by the wasp Auplopus militaris, the Megachile bee species, and the bee Anthodioctes megachiloides. Only Trypoxylon sp. was not affected by SU size. Our results show that cavity-nesting bee and wasps respond differently to the area effects. Such findings must be complemented by information on the frequency and dynamics of area colonization and nest occupancy by species of solitary Hymenoptera.
Directory of Open Access Journals (Sweden)
Juan C. Paredes
2016-07-01
Full Text Available Insects commonly harbor facultative bacterial endosymbionts, such as Wolbachia and Spiroplasma species, that are vertically transmitted from mothers to their offspring. These endosymbiontic bacteria increase their propagation by manipulating host reproduction or by protecting their hosts against natural enemies. While an increasing number of studies have reported endosymbiont-mediated protection, little is known about the mechanisms underlying this protection. Here, we analyze the mechanisms underlying protection from parasitoid wasps in Drosophila melanogaster mediated by its facultative endosymbiont Spiroplasma poulsonii. Our results indicate that S. poulsonii exerts protection against two distantly related wasp species, Leptopilina boulardi and Asobara tabida. S. poulsonii-mediated protection against parasitoid wasps takes place at the pupal stage and is not associated with an increased cellular immune response. In this work, we provide three important observations that support the notion that S. poulsonii bacteria and wasp larvae compete for host lipids and that this competition underlies symbiont-mediated protection. First, lipid quantification shows that both S. poulsonii and parasitoid wasps deplete D. melanogaster hemolymph lipids. Second, the depletion of hemolymphatic lipids using the Lpp RNA interference (Lpp RNAi construct reduces wasp success in larvae that are not infected with S. poulsonii and blocks S. poulsonii growth. Third, we show that the growth of S. poulsonii bacteria is not affected by the presence of the wasps, indicating that when S. poulsonii is present, larval wasps will develop in a lipid-depleted environment. We propose that competition for host lipids may be relevant to endosymbiont-mediated protection in other systems and could explain the broad spectrum of protection provided.
HST PanCET Program: A Cloudy Atmosphere for the Promising JWST Target WASP-101b
Energy Technology Data Exchange (ETDEWEB)
Wakeford, H. R.; Mandell, A. [Planetary Systems Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Stevenson, K. B.; Lewis, N. K. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Sing, D. K.; Evans, T. [Astrophysics Group, Physics Building, University of Exeter, Stocker Road, Exeter EX4 4QL (United Kingdom); López-Morales, M. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Marley, M. [NASA Ames Research Center, MS 245-5, Moffett Field, CA 94035 (United States); Kataria, T. [NASA Jet Propulsion Laboratory, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Ballester, G. E. [Department of Planetary Sciences and Lunar and Planetary Laboratory, University of Arizona, 1541 E Univ. Boulevard, Tucson, AZ 85721 (United States); Barstow, J. [Physics and Astronomy, University College London, London (United Kingdom); Ben-Jaffel, L. [Institut d’Astrophysique de Paris, CNRS, UMR 7095 and Sorbonne Universités, UPMC Paris 6, 98 bis bd Arago, F-75014 Paris (France); Bourrier, V.; Ehrenreich, D. [Observatoire de l’Université de Genève, 51 chemin des Maillettes, CH-1290 Sauverny (Switzerland); Buchhave, L. A. [Centre for Star and Planet Formation, Niels Bohr Institute and Natural History Museum, University of Copenhagen, Øster Voldgade 5-7, DK-1350 Copenhagen K (Denmark); García Muñoz, A., E-mail: hannah.wakeford@nasa.gov [Zentrum für Astronomie und Astrophysik, Technische Universität Berlin, D-10623 Berlin (Germany); and others
2017-01-20
We present results from the first observations of the Hubble Space Telescope (HST) Panchromatic Comparative Exoplanet Treasury program for WASP-101b, a highly inflated hot Jupiter and one of the community targets proposed for the James Webb Space Telescope ( JWST ) Early Release Science (ERS) program. From a single HST Wide Field Camera 3 observation, we find that the near-infrared transmission spectrum of WASP-101b contains no significant H{sub 2}O absorption features and we rule out a clear atmosphere at 13 σ . Therefore, WASP-101b is not an optimum target for a JWST ERS program aimed at observing strong molecular transmission features. We compare WASP-101b to the well-studied and nearly identical hot Jupiter WASP-31b. These twin planets show similar temperature–pressure profiles and atmospheric features in the near-infrared. We suggest exoplanets in the same parameter space as WASP-101b and WASP-31b will also exhibit cloudy transmission spectral features. For future HST exoplanet studies, our analysis also suggests that a lower count limit needs to be exceeded per pixel on the detector in order to avoid unwanted instrumental systematics.
Trap-nest occupation by solitary wasps and bees (Hymenoptera: Aculeata) in a forest urban remanent
Loyola, Rafael D.; Martins, Rogério P.
2006-01-01
Temporal variation of solitary wasps and bees, nesting frequency, mortality, and parasitism were recorded from a remanent forest in Belo Horizonte, MG, Brazil. Wasps and bees were collected in trap-nests placed in areas with 25, 100, and 400 m², from February to November 2004. The 137 trap-nests collected contained 11 species of wasps and bees. Wasps occupied most nests (75%). Occupation peaks occurred in March (25%) and September (26%); in June, the lowest occupation (2%) was observed. Excep...
Giant honeybees ( Apis dorsata) mob wasps away from the nest by directed visual patterns
Kastberger, Gerald; Weihmann, Frank; Zierler, Martina; Hötzl, Thomas
2014-11-01
The open nesting behaviour of giant honeybees ( Apis dorsata) accounts for the evolution of a series of defence strategies to protect the colonies from predation. In particular, the concerted action of shimmering behaviour is known to effectively confuse and repel predators. In shimmering, bees on the nest surface flip their abdomens in a highly coordinated manner to generate Mexican wave-like patterns. The paper documents a further-going capacity of this kind of collective defence: the visual patterns of shimmering waves align regarding their directional characteristics with the projected flight manoeuvres of the wasps when preying in front of the bees' nest. The honeybees take here advantage of a threefold asymmetry intrinsic to the prey-predator interaction: (a) the visual patterns of shimmering turn faster than the wasps on their flight path, (b) they "follow" the wasps more persistently (up to 100 ms) than the wasps "follow" the shimmering patterns (up to 40 ms) and (c) the shimmering patterns align with the wasps' flight in all directions at the same strength, whereas the wasps have some preference for horizontal correspondence. The findings give evidence that shimmering honeybees utilize directional alignment to enforce their repelling power against preying wasps. This phenomenon can be identified as predator driving which is generally associated with mobbing behaviour (particularly known in selfish herds of vertebrate species), which is, until now, not reported in insects.
Flower-Visiting Social Wasps and Plants Interaction: Network Pattern and Environmental Complexity
Directory of Open Access Journals (Sweden)
Mateus Aparecido Clemente
2012-01-01
Full Text Available Network analysis as a tool for ecological interactions studies has been widely used since last decade. However, there are few studies on the factors that shape network patterns in communities. In this sense, we compared the topological properties of the interaction network between flower-visiting social wasps and plants in two distinct phytophysiognomies in a Brazilian savanna (Riparian Forest and Rocky Grassland. Results showed that the landscapes differed in species richness and composition, and also the interaction networks between wasps and plants had different patterns. The network was more complex in the Riparian Forest, with a larger number of species and individuals and a greater amount of connections between them. The network specialization degree was more generalist in the Riparian Forest than in the Rocky Grassland. This result was corroborated by means of the nestedness index. In both networks was found asymmetry, with a large number of wasps per plant species. In general aspects, most wasps had low niche amplitude, visiting from one to three plant species. Our results suggest that differences in structural complexity of the environment directly influence the structure of the interaction network between flower-visiting social wasps and plants.
Rodnick-Smith, Max; Luan, Qing; Liu, Su-Ling; Nolen, Brad J
2016-07-05
The Arp2/3 (Actin-related proteins 2/3) complex is activated by WASP (Wiskott-Aldrich syndrome protein) family proteins to nucleate branched actin filaments that are important for cellular motility. WASP recruits actin monomers to the complex and stimulates movement of Arp2 and Arp3 into a "short-pitch" conformation that mimics the arrangement of actin subunits within filaments. The relative contribution of these functions in Arp2/3 complex activation and the mechanism by which WASP stimulates the conformational change have been unknown. We purified budding yeast Arp2/3 complex held in or near the short-pitch conformation by an engineered covalent cross-link to determine if the WASP-induced conformational change is sufficient for activity. Remarkably, cross-linked Arp2/3 complex bypasses the need for WASP in activation and is more active than WASP-activated Arp2/3 complex. These data indicate that stimulation of the short-pitch conformation is the critical activating function of WASP and that monomer delivery is not a fundamental requirement for nucleation but is a specific requirement for WASP-mediated activation. During activation, WASP limits nucleation rates by releasing slowly from nascent branches. The cross-linked complex is inhibited by WASP's CA region, even though CA potently stimulates cross-linking, suggesting that slow WASP detachment masks the activating potential of the short-pitch conformational switch. We use structure-based mutations and WASP-Arp fusion chimeras to determine how WASP stimulates movement toward the short-pitch conformation. Our data indicate that WASP displaces the autoinhibitory Arp3 C-terminal tail from a hydrophobic groove at Arp3's barbed end to destabilize the inactive state, providing a mechanism by which WASP stimulates the short-pitch conformation and activates Arp2/3 complex.
Directory of Open Access Journals (Sweden)
Sean E Schneider
Full Text Available We show here that 105 regions in two Lepidoptera genomes appear to derive from horizontally transferred wasp DNA. We experimentally verified the presence of two of these sequences in a diverse set of silkworm (Bombyx mori genomes. We hypothesize that these horizontal transfers are made possible by the unusual strategy many parasitoid wasps employ of injecting hosts with endosymbiotic polydnaviruses to minimize the host's defense response. Because these virus-like particles deliver wasp DNA to the cells of the host, there has been much interest in whether genetic information can be permanently transferred from the wasp to the host. Two transferred sequences code for a BEN domain, known to be associated with polydnaviruses and transcriptional regulation. These findings represent the first documented cases of horizontal transfer of genes between two organisms by a polydnavirus. This presents an interesting evolutionary paradigm in which host species can acquire new sequences from parasitoid wasps that attack them. Hymenoptera and Lepidoptera diverged ∼300 MYA, making this type of event a source of novel sequences for recipient species. Unlike many other cases of horizontal transfer between two eukaryote species, these sequence transfers can be explained without the need to invoke the sequences 'hitchhiking' on a third organism (e.g. retrovirus capable of independent reproduction. The cellular machinery necessary for the transfer is contained entirely in the wasp genome. The work presented here is the first such discovery of what is likely to be a broader phenomenon among species affected by these wasps.
Trap-nest occupation by solitary wasps and bees (Hymenoptera: Aculeata) in a forest urban remanent.
Loyola, Rafael D; Martins, Rogério P
2006-01-01
Temporal variation of solitary wasps and bees, nesting frequency, mortality, and parasitism were recorded from a remanent forest in Belo Horizonte, MG, Brazil. Wasps and bees were collected in trap-nests placed in areas with 25, 100, and 400 m2, from February to November 2004. The 137 trap-nests collected contained 11 species of wasps and bees. Wasps occupied most nests (75%). Occupation peaks occurred in March (25%) and September (26%); in June, the lowest occupation (2%) was observed. Except for Trypoxylon (Trypargilum) lactitarse Saussure, no significant correlation was found between number of occupied nests, and temperature and rainfall means. In the nests, 48% of the immature specimens died; 13% of the nests were parasitized. Total death and parasitism rates of wasps and bees differed significantly.
WAsP E-learning - Developing and running an interactive online course
DEFF Research Database (Denmark)
Badger, Merete; Prag, Sidsel-Marie Winther; Jowitt, William Richard
This report describes the development and testing of an E-learning course in WAsP – the Wind Atlas Analysis and Application Program. WAsP is the industry standard tool for wind energy resource assessment. The software is developed and distributed by the Department of Wind Energy at the Technical...
DEFF Research Database (Denmark)
Dellwik, Ebba; Landberg, Lars; Jensen, Niels Otto
2005-01-01
This article compares mean wind estimates from a WAsP analysis for three forest sites and one site near a forest with measurements taken at the sites. By standard WAsP settings for forest, the mean wind speed at the sites was overestimated. Agreement between the estimates and the measurements...... improved significantly if displacement height and roughness length as calculated from the forest mast data were used or if a simple model estimate of roughness length and displacement height based on stand density (frontal area index) was used. The two estimates of displacement height and roughness length...... (mast data and simple model) did not agree well with each other. One reason for this may be that all evaluated sites are windy and that both d and z0 depend on the wind speed. All analysed forest sites are dense, in which case the influence from the roughness sublayer is limited and the effect on mean...
Fernández-Marín, Hermógenes; Zimmerman, Jess K.; Wcislo, William T.
2006-01-01
New World diapriine wasps are abundant and diverse, but the biology of most species is unknown. We provide the first description of the biology of diapriine wasps, Acanthopria spp. and Mimopriella sp., which attack the larvae of Cyphomyrmex fungus-growing ants. In Puerto Rico, the koinobiont parasitoids Acanthopria attack Cyphomyrmex minutus, while in Panama at least four morphospecies of Acanthopria and one of Mimopriella attack Cyphomyrmex rimosus. Of the total larvae per colony, 0 100% were parasitized, and 27 70% of the colonies per population were parasitized. Parasitism rate and colony size were negatively correlated for C. rimosus but not for C. minutus. Worker ants grasped at, bit, and in some cases, killed adult wasps that emerged in artificial nests or tried to enter natural nests. Parasitoid secondary sex ratios were female-biased for eclosing wasps, while field collections showed a male-biased sex ratio. Based on their abundance and success in attacking host ants, these minute wasps present excellent opportunities to explore how natural enemies impact ant colony demography and population biology.
A unique nest-protection strategy in a new species of spider wasp.
Directory of Open Access Journals (Sweden)
Michael Staab
Full Text Available Hymenoptera show a great variation in reproductive potential and nesting behavior, from thousands of eggs in sawflies to just a dozen in nest-provisioning wasps. Reduction in reproductive potential in evolutionary derived Hymenoptera is often facilitated by advanced behavioral mechanisms and nesting strategies. Here we describe a surprising nesting behavior that was previously unknown in the entire animal kingdom: the use of a vestibular cell filled with dead ants in a new spider wasp (Hymenoptera: Pompilidae species collected with trap nests in South-East China. We scientifically describe the 'Bone-house Wasp' as Deuteragenia ossarium sp. nov., named after graveyard bone-houses or ossuaries. We show that D. ossarium nests are less vulnerable to natural enemies than nests of other sympatric trap-nesting wasps, suggesting an effective nest protection strategy, most likely by utilizing chemical cues emanating from the dead ants.
Azuma, Hiroshi; Harrison, Rhett D; Nakamura, Keiko; Su, Zhi-Hui
2010-01-01
The interaction between figs (Ficus, Moraceae) and fig-pollinating wasps (Chalcidoidea, Agaonidae) is one of the most specific mutualisms, and thus is a model system for studying coevolution and cospeciation. In this study we focused on figs and their associated fig-wasps found in the Ryukyu and Bonin (Ogasawara) Islands, Japan, because it has been suggested that breakdown in the specificity may occur in islands or at edge of a species' distribution. We collected 136 samples of 15 native fig species and 95 samples of 13 associated fig-wasps from all major islands in the Ryukyu Islands, including two fig species and one fig-wasp species endemic to the Bonin Islands. We performed molecular phylogenetic analyses using plastid DNA and nuclear ITS sequences for the figs and nuclear 28S rRNA and mitochondrial COI genes for the fig-wasps to investigate the interspecific phylogenies and intraspecific variation within the mutualism. Our phylogenetic analyses using multiple samples per species show the single clade of each fig (except the Bonin endemic species) and fig-pollinating wasp species. Fig species belonging to the same subgenera formed well-supported clades in both plastid and ITS trees, except for the subgenus Urostigma. Likewise, fig wasps emerging from host fig species belonging to the same subgenera formed mostly well supported clades in both 28S and COI trees. Host specificity between the figs and fig-wasps functions strictly in these islands. There was very little sequence variation within species, and that no major geographic structure was found. The two Bonin endemic species (F. boninsimae and F. nishimurae) or their common ancestor and the associated fig-wasps (Blastophaga sp.) are apparently derived from F. erecta and its associated fig-wasps (B. nipponica), respectively, and probably migrated from the Ryukyu Islands.
Wiebes, J.T.
1974-01-01
In 1964, by awarding to me that year's proceeds of the "Pieter Langerhuizen Fonds", the Hollandsche Maatschappij der Wetenschappen enabled me to study figs and fig wasps in the Philippines. While several Philippine fig wasps are already known from the papers by Ashmead (1904, 1905), Brown (1906),
Generation of a Circumstellar Gas Disk by Hot Jupiter WASP-12b
Debrecht, Alex; Carroll-Nellenback, Jonathan; Frank, Adam; Fossati, Luca; Blackman, Eric G.; Dobbs-Dixon, Ian
2018-05-01
Observations of transiting extra-solar planets provide rich sources of data for probing the in-system environment. In the WASP-12 system, a broad depression in the usually-bright MgII h&k lines has been observed, in addition to atmospheric escape from the extremely hot Jupiter WASP-12b. It has been hypothesized that a translucent circumstellar cloud is formed by the outflow from the planet, causing the observed signatures. We perform 3D hydrodynamic simulations of the full system environment of WASP-12, injecting a planetary wind and stellar wind from their respective surfaces. We find that a torus of density high enough to account for the lack of MgII h&k line core emission in WASP-12 can be formed in approximately 13 years. We also perform synthetic observations of the Lyman-alpha spectrum at different points in the planet's orbit, which demonstrate that significant absorption occurs at all points in the orbit, not just during transits, as suggested by the observations.
WICH, a member of WASP-interacting protein family, cross-links actin filaments
International Nuclear Information System (INIS)
Kato, Masayoshi; Takenawa, Tadaomi
2005-01-01
In yeast, Verprolin plays an important role in rearrangement of the actin cytoskeleton. There are three mammalian homologues of Verprolin, WIP, CR16, and WICH, and all of them bind actin and Wiskott-Aldrich syndrome protein (WASP) and/or neural-WASP. Here, we describe a novel function of WICH. In vitro co-sedimentation analysis revealed that WICH not only binds to actin filaments but also cross-links them. Fluorescence and electron microscopy detected that this cross-linking results in straight bundled actin filaments. Overexpression of WICH alone in cultured fibroblast caused the formation of thick actin fibers. This ability of WICH depended on its own actin cross-linking activity. Importantly, the actin cross-linking activity of WICH was modified through a direct association with N-WASP. Taken together, these data suggest that WICH induces a bundled form of actin filament with actin cross-linking activity and the association with N-WASP suppresses that activity. WICH thus appears to be a novel actin bundling protein
Expression of enzymatically inactive wasp venom phospholipase A1 in Pichia pastoris.
Directory of Open Access Journals (Sweden)
Irina Borodina
Full Text Available Wasp venom allergy is the most common insect venom allergy in Europe. It is manifested by large local reaction or anaphylactic shock occurring after a wasp sting. The allergy can be treated by specific immunotherapy with whole venom extracts. Wasp venom is difficult and costly to obtain and is a subject to composition variation, therefore it can be advantageous to substitute it with a cocktail of recombinant allergens. One of the major venom allergens is phospholipase A1, which so far has been expressed in Escherichia coli and in insect cells. Our aim was to produce the protein in secreted form in yeast Pichia pastoris, which can give high yields of correctly folded protein on defined minimal medium and secretes relatively few native proteins simplifying purification.Residual amounts of enzymatically active phospholipase A1 could be expressed, but the venom protein had a deleterious effect on growth of the yeast cells. To overcome the problem we introduced three different point mutations at the critical points of the active site, where serine137, aspartate165 or histidine229 were replaced by alanine (S137A, D165A and H229A. All the three mutated forms could be expressed in P. pastoris. The H229A mutant did not have any detectable phospholipase A1 activity and was secreted at the level of several mg/L in shake flask culture. The protein was purified by nickel-affinity chromatography and its identity was confirmed by MALDI-TOF mass spectrometry. The protein could bind IgE antibodies from wasp venom allergic patients and could inhibit the binding of wasp venom to IgE antibodies specific for phospholipase A1 as shown by Enzyme Allergo-Sorbent Test (EAST. Moreover, the recombinant protein was allergenic in a biological assay as demonstrated by its capability to induce histamine release of wasp venom-sensitive basophils.The recombinant phospholipase A1 presents a good candidate for wasp venom immunotherapy.
A ground-based optical transmission spectrum of WASP-6b
International Nuclear Information System (INIS)
Jordán, Andrés; Espinoza, Néstor; Rabus, Markus; Eyheramendy, Susana; Sing, David K.; Désert, Jean-Michel; Bakos, Gáspár Á.; Fortney, Jonathan J.; López-Morales, Mercedes; Szentgyorgyi, Andrew; Maxted, Pierre F. L.; Triaud, Amaury H. M. J.
2013-01-01
We present a ground-based optical transmission spectrum of the inflated sub-Jupiter-mass planet WASP-6b. The spectrum was measured in 20 spectral channels from 480 nm to 860 nm using a series of 91 spectra over a complete transit event. The observations were carried out using multi-object differential spectrophotometry with the Inamori-Magellan Areal Camera and Spectrograph on the Baade Telescope at Las Campanas Observatory. We model systematic effects on the observed light curves using principal component analysis on the comparison stars and allow for the presence of short and long memory correlation structure in our Monte Carlo Markov Chain analysis of the transit light curves for WASP-6. The measured transmission spectrum presents a general trend of decreasing apparent planetary size with wavelength and lacks evidence for broad spectral features of Na and K predicted by clear atmosphere models. The spectrum is consistent with that expected for scattering that is more efficient in the blue, as could be caused by hazes or condensates in the atmosphere of WASP-6b. WASP-6b therefore appears to be yet another massive exoplanet with evidence for a mostly featureless transmission spectrum, underscoring the importance that hazes and condensates can have in determining the transmission spectra of exoplanets.
Performance of Copan WASP for Routine Urine Microbiology
Quiblier, Chantal; Jetter, Marion; Rominski, Mark; Mouttet, Forouhar; Böttger, Erik C.; Keller, Peter M.
2015-01-01
This study compared a manual workup of urine clinical samples with fully automated WASPLab processing. As a first step, two different inocula (1 and 10 μl) and different streaking patterns were compared using WASP and InoqulA BT instrumentation. Significantly more single colonies were produced with the10-μl inoculum than with the 1-μl inoculum, and automated streaking yielded significantly more single colonies than manual streaking on whole plates (P < 0.001). In a second step, 379 clinical urine samples were evaluated using WASP and the manual workup. Average numbers of detected morphologies, recovered species, and CFUs per milliliter of all 379 urine samples showed excellent agreement between WASPLab and the manual workup. The percentage of urine samples clinically categorized as positive or negative did not differ between the automated and manual workflow, but within the positive samples, automated processing by WASPLab resulted in the detection of more potential pathogens. In summary, the present study demonstrates that (i) the streaking pattern, i.e., primarily the number of zigzags/length of streaking lines, is critical for optimizing the number of single colonies yielded from primary cultures of urine samples; (ii) automated streaking by the WASP instrument is superior to manual streaking regarding the number of single colonies yielded (for 32.2% of the samples); and (iii) automated streaking leads to higher numbers of detected morphologies (for 47.5% of the samples), species (for 17.4% of the samples), and pathogens (for 3.4% of the samples). The results of this study point to an improved quality of microbiological analyses and laboratory reports when using automated sample processing by WASP and WASPLab. PMID:26677255
Detection of sodium in the atmosphere of WASP-69b
Casasayas-Barris, N.; Palle, E.; Nowak, G.; Yan, F.; Nortmann, L.; Murgas, F.
2017-12-01
Context. Transit spectroscopy is one of the most commonly used methods to characterize exoplanets' atmospheres. From the ground, these observations are very challenging due to the terrestrial atmosphere and its intrinsic variations, but high-spectral-resolution observations overcome this difficulty by resolving the spectral lines and taking advantage of the different Doppler velocities of the Earth, the host star, and the exoplanet. Aims: We analyze the transmission spectrum around the Na I doublet at 589 nm of the extrasolar planet WASP-69b, a hot Jupiter orbiting a K-type star with a period of 3.868 days, and compare the analysis to that of the well-known hot Jupiter HD 189733b. We also present the analysis of the Rossiter-McLaughlin (RM) effect for WASP-69b. Methods: We observed two transits of WASP-69b with the High Accuracy Radial velocity Planet Searcher (HARPS-North) spectrograph (R = 115 000) at the Telescopio Nazionale Galileo (TNG). We perform a telluric contamination subtraction based on the comparison between the observed spectra and a telluric water model. Then, the common steps of the differential spectroscopy are followed to extract the transmission spectrum. The method is tested with archival transit data of the extensively studied exoplanet HD 189733b, obtained with the HARPS-South spectrograph at ESO 3.6 m telescope, and then applied to WASP-69b data. Results: For HD 189733b, we spectrally resolve the Na I doublet and measure line contrasts of 0.72 ± 0.05% (D2) and 0.51 ± 0.05% (D1), and full width half maximum (FWHM) values of 0.64 ± 0.04 Å (D2) and 0.60 ± 0.06 Å (D1), in agreement with previously published results. For WASP-69b only the contrast of the D2 line can be measured (5.8 ± 0.3%). This corresponds to a detection at the 5σ-level of excess absorption of 0.5 ± 0.1% in a passband of 1.5 Å. A net blueshift of 0.04 Å is measured for HD 189733b and no shift is obtained for WASP-69b. By measuring the RM effect, we get an angular
Moreyra, Sabrina; D'Adamo, Paola; Lozada, Mariana
2017-10-01
Social insects exhibit complex learning and memory mechanisms while foraging. Vespula germanica (Fab.) (Hymenoptera: Vespidae) is an invasive social wasp that frequently forages on undepleted food sources, making several flights between the resource and the nest. Previous studies have shown that during this relocating behavior, wasps learn to associate food with a certain site, and can recall this association 1 h later. In this work, we evaluated whether this wasp species is capable of retrieving an established association after 24 h. For this purpose, we trained free flying individuals to collect proteinaceous food from an experimental plate (feeder) located in an experimental array. A total of 150 individuals were allowed 2, 4, or 8 visits. After the training phase, the array was removed and set up again 24 h later, but this time a second baited plate was placed opposite to the first. After 24 h we recorded the rate of wasps that returned to the experimental area and those which collected food from the previously learned feeding station or the nonlearned one. During the testing phase, we observed that a low rate of wasps trained with 2 collecting visits returned to the experimental area (22%), whereas the rate of returning wasps trained with 4 or 8 collecting visits was higher (51% and 41%, respectively). Moreover, wasps trained with 8 feeding visits collected food from the previously learned feeding station at a higher rate than those that did from the nonlearned one. In contrast, wasps trained 2 or 4 times chose both feeding stations at a similar rate. Thus, significantly more wasps returned to the previously learned feeding station after 8 repeated foraging flights but not after only 2 or 4 visits. This is the first report that demonstrates the existence of long-term spatial memory in V. germanica wasps. © 2016 Institute of Zoology, Chinese Academy of Sciences.
Parasitic wasp responses to symbiont-based defense in aphids
Directory of Open Access Journals (Sweden)
Oliver Kerry M
2012-02-01
Full Text Available Abstract Background Recent findings indicate that several insect lineages receive protection against particular natural enemies through infection with heritable symbionts, but little is yet known about whether enemies are able to discriminate and respond to symbiont-based defense. The pea aphid, Acyrthosiphon pisum, receives protection against the parasitic wasp, Aphidius ervi, when infected with the bacterial symbiont Hamiltonella defensa and its associated bacteriophage APSE (Acyrthosiphon pisum secondary endosymbiont. Internally developing parasitoid wasps, such as A. ervi, use maternal and embryonic factors to create an environment suitable for developing wasps. If more than one parasitoid egg is deposited into a single aphid host (superparasitism, then additional complements of these factors may contribute to the successful development of the single parasitoid that emerges. Results We performed experiments to determine if superparasitism is a tactic allowing wasps to overcome symbiont-mediated defense. We found that the deposition of two eggs into symbiont-protected aphids significantly increased rates of successful parasitism relative to singly parasitized aphids. We then conducted behavioral assays to determine whether A. ervi selectively superparasitizes H. defensa-infected aphids. In choice tests, we found that A. ervi tends to deposit a single egg in uninfected aphids, but two or more eggs in H. defensa-infected aphids, indicating that oviposition choices may be largely determined by infection status. Finally, we identified differences in the quantity of the trans-β-farnesene, the major component of aphid alarm pheromone, between H. defensa-infected and uninfected aphids, which may form the basis for discrimination. Conclusions Here we show that the parasitic wasp A. ervi discriminates among symbiont-infected and uninfected aphids, and changes its oviposition behavior in a way that increases the likelihood of overcoming symbiont
Ocellar optics in nocturnal and diurnal bees and wasps.
Warrant, Eric J; Kelber, Almut; Wallén, Rita; Wcislo, William T
2006-12-01
Nocturnal bees, wasps and ants have considerably larger ocelli than their diurnal relatives, suggesting an active role in vision at night. In a first step to understanding what this role might be, the morphology and physiological optics of ocelli were investigated in three tropical rainforest species - the nocturnal sweat bee Megalopta genalis, the nocturnal paper wasp Apoica pallens and the diurnal paper wasp Polistes occidentalis - using hanging-drop techniques and standard histological methods. Ocellar image quality, in addition to lens focal length and back focal distance, was determined in all three species. During flight, the ocellar receptive fields of both nocturnal species are centred very dorsally, possibly in order to maximise sensitivity to the narrow dorsal field of light that enters through gaps in the rainforest canopy. Since all ocelli investigated had a slightly oval shape, images were found to be astigmatic: images formed by the major axis of the ocellus were located further from the proximal surface of the lens than images formed by the minor axis. Despite being astigmatic, images formed at either focal plane were reasonably sharp in all ocelli investigated. When compared to the position of the retina below the lens, measurements of back focal distance reveal that the ocelli of Megalopta are highly underfocused and unable to resolve spatial detail. This together with their very large and tightly packed rhabdoms suggests a role in making sensitive measurements of ambient light intensity. In contrast, the ocelli of the two wasps form images near the proximal boundary of the retina, suggesting the potential for modest resolving power. In light of these results, possible roles for ocelli in nocturnal bees and wasps are discussed, including the hypothesis that they might be involved in nocturnal homing and navigation, using two main cues: the spatial pattern of bright patches of daylight visible through the rainforest canopy, and compass information
Directory of Open Access Journals (Sweden)
McLeish Michael J
2012-01-01
Full Text Available Abstract Background The interaction between insects and plants takes myriad forms in the generation of spectacular diversity. In this association a species host range is fundamental and often measured using an estimate of phylogenetic concordance between species. Pollinating fig wasps display extreme host species specificity, but the intraspecific variation in empirical accounts of host affiliation has previously been underestimated. In this investigation, lineage delimitation and codiversification tests are used to generate and discuss hypotheses elucidating on pollinating fig wasp associations with Ficus. Results Statistical parsimony and AMOVA revealed deep divergences at the COI locus within several pollinating fig wasp species that persist on the same host Ficus species. Changes in branching patterns estimated using the generalized mixed Yule coalescent test indicated lineage duplication on the same Ficus species. Conversely, Elisabethiella and Alfonsiella fig wasp species are able to reproduce on multiple, but closely related host fig species. Tree reconciliation tests indicate significant codiversification as well as significant incongruence between fig wasp and Ficus phylogenies. Conclusions The findings demonstrate more relaxed pollinating fig wasp host specificity than previously appreciated. Evolutionarily conservative host associations have been tempered by horizontal transfer and lineage duplication among closely related Ficus species. Independent and asynchronistic diversification of pollinating fig wasps is best explained by a combination of both sympatric and allopatric models of speciation. Pollinator host preference constraints permit reproduction on closely related Ficus species, but uncertainty of the frequency and duration of these associations requires better resolution.
Barros, Emerson C; Bacci, Leandro; Picanco, Marcelo C; Martins, Júlio C; Rosado, Jander F; Silva, Gerson A
2015-01-01
In this study, we carried out three bioassays with nine used insecticides in tomato crops to identify their efficiency against tomato leaf miner Tuta absoluta, the physiological selectivity and the activity reduction of insecticides by three rain regimes to predatory wasps Protonectarina sylveirae and Polybia scutellaris. We assessed the mortality caused by the recommended doses of abamectin, beta-cyfluthrin, cartap, chlorfenapyr, etofenprox, methamidophos, permethrin, phenthoate and spinosad to T. absoluta and wasps at the moment of application. In addition, we evaluated the wasp mortality due to the insecticides for 30 days on plants that did not receive rain and on plants that received 4 or 125 mm of rain. Spinosad, cartap, chlorfenapyr, phenthoate, abamectin and methamidophos caused mortality higher than 90% to T. absoluta, whereas the pyrethroids beta-cyfluthrin, etofenprox and permethrin caused mortality between 8.5% and 46.25%. At the moment of application, all the insecticides were highly toxic to the wasps, causing mortality higher than 80%. In the absence of rain, all the insecticides continued to cause high mortality to the wasps for 30 days after the application. The toxicity of spinosad and methamidophos on both wasp species; beta-cyfluthrin on P. sylveirae and chlorfenapyr and abamectin on P. scutellaris, decreased when the plants received 4 mm of rain. In contrast, the other insecticides only showed reduced toxicity on the wasps when the plants received 125 mm of rain.
Adaptive selection on bracovirus genomes drives the specialization of Cotesia parasitoid wasps.
Directory of Open Access Journals (Sweden)
Séverine Jancek
Full Text Available The geographic mosaic of coevolution predicts parasite virulence should be locally adapted to the host community. Cotesia parasitoid wasps adapt to local lepidopteran species possibly through their symbiotic bracovirus. The virus, essential for the parasitism success, is at the heart of the complex coevolutionary relationship linking the wasps and their hosts. The large segmented genome contained in the virus particles encodes virulence genes involved in host immune and developmental suppression. Coevolutionary arms race should result in the positive selection of particular beneficial alleles. To understand the global role of bracoviruses in the local adaptation or specialization of parasitoid wasps to their hosts, we studied the molecular evolution of four bracoviruses associated with wasps of the genus Cotesia, including C congregata, C vestalis and new data and annotation on two ecologically differentiated populations of C sesamie, Kitale and Mombasa. Paired orthologs analyses revealed more genes under positive selection when comparing the two C sesamiae bracoviruses belonging to the same species, and more genes under strong evolutionary constraint between species. Furthermore branch-site evolutionary models showed that 17 genes, out of the 54 currently available shared by the four bracoviruses, harboured sites under positive selection including: the histone H4-like, a C-type lectin, two ep1-like, ep2, a viral ankyrin, CrV1, a ben-domain, a Serine-rich, and eight unknown genes. Lastly the phylogenetic analyses of the histone, ep2 and CrV1 genes in different African C sesamiae populations showed that each gene described differently the individual relationships. In particular we found recombination had happened between the ep2 and CrV1 genes, which are localized 37.5 kb apart on the wasp chromosomes. Involved in multidirectional coevolutionary interactions, C sesamiae wasps rely on different bracovirus mediated molecular pathways to overcome
Recombinant allergen-based IgE testing to distinguish bee and wasp allergy.
Mittermann, Irene; Zidarn, Mihaela; Silar, Mira; Markovic-Housley, Zora; Aberer, Werner; Korosec, Peter; Kosnik, Mitja; Valenta, Rudolf
2010-06-01
The identification of the disease-causing insect in venom allergy is often difficult. To establish recombinant allergen-based IgE tests to diagnose bee and yellow jacket wasp allergy. Sera from patients with bee and/or wasp allergy (n = 43) and patients with pollen allergy with false-positive IgE serology to venom extracts were tested for IgE reactivity in allergen extract-based tests or with purified allergens, including nonglycosylated Escherichia coli-expressed recombinant (r) Api m 1, rApi m 2, rVes v 5, and insect cell-expressed, glycosylated rApi m 2 as well as 2 natural plant glycoproteins (Phl p 4, bromelain). The patients with venom allergy could be diagnosed with a combination of E coli-expressed rApi m 1, rApi m 2, and rVes v 5 whereas patients with pollen allergy remained negative. For a group of 29 patients for whom the sensitizing venom could not be identified with natural allergen extracts, testing with nonglycosylated allergens allowed identification of the sensitizing venom. Recombinant nonglycosylated allergens also allowed definition of the sensitizing venom for those 14 patients who had reacted either with bee or wasp venom extracts. By IgE inhibition studies, it is shown that glycosylated Api m 2 contains carbohydrate epitopes that cross-react with natural Api m 1, Ves v 2, natural Phl p 4, and bromelain, thus identifying cross-reactive structures responsible for serologic false-positive test results or double-positivity to bee and wasp extracts. Nonglycosylated recombinant bee and wasp venom allergens allow the identification of patients with bee and wasp allergy and should facilitate accurate prescription of venom immunotherapy. Copyright (c) 2010 American Academy of Allergy, Asthma & Immunology. Published by Mosby, Inc. All rights reserved.
Write a scientific paper (WASP) - a career-critical skill.
Grech, Victor; Cuschieri, Sarah
2018-02-01
The ability to write a scientific paper (WASP) is becoming progressively more critical because the "publish or perish" mantra is increasingly valid in today's world where success is judged by number of publications and quality of publications based on journals which publish the researcher's work. These metrics are used to gauge applicants in often cut-throat competitions for jobs and/or career advancement. However, the science and art of paper-writing comprise a vast panoply of different skills, from writing a proposal, to ethics and data protection applications, to data collection and analysis, to writing and dealing with editors and authors, and so on. Over the next few issues, Early Human Development will embark on a series of Best Practice Guidelines that will outline and explain the various requisite WASP skills while providing practical guidelines for paper writing. The purpose is to impart the authors' collective experience to trainees in this crucial aspect of career progress. This first set of WASP papers will mainly focus on statistical analysis using Excel™. Copyright © 2018 Elsevier B.V. All rights reserved.
Wasps are the cause of an increasing mastitis problem in dairy cattle in Israel.
Yeruham, I; Braverman, Y; Schwimmer, A
1998-07-01
The German wasp Vespula germanica (Fabr.) (Hymenoptera: Vespidae) has been observed to injure dairy cows teats, causing lesions which can lead to mastitis. The number of dairy herds in Israel reported to be affected in this way has increased from five prior to 1989 to 32 from 1989 to 1993. Likewise, the geographical distribution of the colonies of these wasps has expanded from the Galilee to the northern Negev. Most cases of mastitis appeared during August and September when the wasps were most active; the predominant organism isolated was Streptococcus dysgalactiae. Apparently the wasps served as a vector in spreading S. dysgalactiae infection in the herds. More adult cows than first-calving cows were affected. The teats of the front quarters were more affected than those of the hind quarters.
Polydnaviruses of Parasitic Wasps: Domestication of Viruses To Act as Gene Delivery Vectors
Directory of Open Access Journals (Sweden)
Michael R. Strand
2012-01-01
Full Text Available Symbiosis is a common phenomenon in which associated organisms can cooperate in ways that increase their ability to survive, reproduce, or utilize hostile environments. Here, we discuss polydnavirus symbionts of parasitic wasps. These viruses are novel in two ways: (1 they have become non-autonomous domesticated entities that cannot replicate outside of wasps; and (2 they function as a delivery vector of genes that ensure successful parasitism of host insects that wasps parasitize. In this review we discuss how these novelties may have arisen, which genes are potentially involved, and what the consequences have been for genome evolution.
A checklist of Ropalidiini wasps (Hymenoptera: Vespidae: Polistinae in Indochina
Directory of Open Access Journals (Sweden)
Pham Phong Huy
2014-01-01
Full Text Available As a basis for intensive study of the taxonomy and biogeography of Ropalidiini wasps in Indochina (Hymenoptera: Vespidae: Polistinae, a checklist of Ropalidiini wasps (Hymenoptera: Vespidae is presented. A total of 57 Ropalidiini species and subspecies belonging to three genera from Indochina are listed, together with information of the type material deposited in the Natural History Collection, Ibaraki University, Japan (IUNH and the Institute of Ecology and Biological Resources (IEBR. References of their distribution in Indochina are also provided.
Campbell, Joshua W; Smithers, Cherice; Irvin, Allyn; Kimmel, Chase B; Stanley-Stahr, Cory; Daniels, Jaret C; Ellis, James D
2017-10-10
Wildflower strip plantings in intensive agricultural systems have become a widespread tool for promoting pollination services and biological conservation because of their use by wasps and bees. Many of the trap-nesting wasps are important predators of common crop pests, and cavity-nesting bees that utilize trap-nests are important pollinators for native plants and many crops. The impact of wildflower strips on the nesting frequency of trap-nesting wasps or bees within localized areas has not been thoroughly investigated. Trap-nests made of bamboo reeds ( Bambusa sp.) were placed adjacent to eight 0.1 ha wildflower plots and paired fallow areas (control plots) to determine if wildflower strips encourage the nesting of wasps and bees. From August 2014 to November 2015, occupied reeds were gathered and adults were collected as they emerged from the trap-nests. Treatment (wildflower or fallow plots) did not impact the number of occupied reeds or species richness of trap-nesting wasps using the occupied reeds. The wasps Pachodynerus erynnis , Euodynerus megaera , Parancistrocerus pedestris , and Isodontia spp. were the most common trap-nesting species collected. Less than 2% of the occupied reeds contained bees, and all were from the genus Megachile . The nesting wasp and bee species demonstrated preferences for reeds with certain inside diameters (IDs). The narrow range of ID preferences exhibited by each bee/wasp may provide opportunities to take advantage of their natural histories for biological control and/or pollination purposes.
Directory of Open Access Journals (Sweden)
Joshua W. Campbell
2017-10-01
Full Text Available Wildflower strip plantings in intensive agricultural systems have become a widespread tool for promoting pollination services and biological conservation because of their use by wasps and bees. Many of the trap-nesting wasps are important predators of common crop pests, and cavity-nesting bees that utilize trap-nests are important pollinators for native plants and many crops. The impact of wildflower strips on the nesting frequency of trap-nesting wasps or bees within localized areas has not been thoroughly investigated. Trap-nests made of bamboo reeds (Bambusa sp. were placed adjacent to eight 0.1 ha wildflower plots and paired fallow areas (control plots to determine if wildflower strips encourage the nesting of wasps and bees. From August 2014 to November 2015, occupied reeds were gathered and adults were collected as they emerged from the trap-nests. Treatment (wildflower or fallow plots did not impact the number of occupied reeds or species richness of trap-nesting wasps using the occupied reeds. The wasps Pachodynerus erynnis, Euodynerus megaera, Parancistrocerus pedestris, and Isodontia spp. were the most common trap-nesting species collected. Less than 2% of the occupied reeds contained bees, and all were from the genus Megachile. The nesting wasp and bee species demonstrated preferences for reeds with certain inside diameters (IDs. The narrow range of ID preferences exhibited by each bee/wasp may provide opportunities to take advantage of their natural histories for biological control and/or pollination purposes.
Nested Houses: Domestication dynamics of human-wasp relations in contemporary rural Japan.
Payne, Charlotte L R; Evans, Joshua D
2017-02-08
Domestication is an important and contested concept. Insects are used as food worldwide, and while some have been described as domesticated and even 'semi-domesticated', the assumptions and implications of this designation are not clear. The purpose of this paper is to explore these aspects of insect domestication, and broader debates in domestication studies, through the case of edible wasps in central rural Japan. Both authors conducted ethnographic fieldwork with communities in central rural Japan. Fieldwork comprised participant observation, semi-structured interviews, quantitative surveys and a review of resources including the personal and public records of wasp collectors. The practice of keeping wasps in hive boxes has historical roots and has changed significantly within living memory. Current attempts to further develop the practice involve collectors' great efforts to keep new queens during their hibernation. Collectors have also tried, still without success, to keep wasps living within a human-made enclosure for their entire life cycle. These and other practices are costly in both time and money for collectors, who emphasise enjoyment as their primary motivation. At the same time, they also engage in practices such as pesticide use that they recognise as damaging to wasp ecology. These practices can be understood to some extent in domesticatory terms, and in terms of care. We develop a framework for understanding domesticatory practices of insect care, discuss how this case contributes to ongoing debates within domestication studies, and recommend further research to be pursued.
Use of a Parasitic Wasp as a Biosensor
Directory of Open Access Journals (Sweden)
Dawn Olson
2014-05-01
Full Text Available Screening cargo for illicit substances is in need of rapid high-throughput inspection systems that accurately identify suspicious cargo. Here we investigate the ability of a parasitic wasp, Microplitis croceipes to detect and respond to methyl benzoate, the volatile component of cocaine, by examining their response to training concentrations, their sensitivity at low concentrations, and their ability to detect methyl benzoate when two concealment substances (green tea and ground coffee are added to the testing arena. Utilizing classical associative learning techniques with sucrose as reward, we found that M. croceipes learns individual concentrations of methyl benzoate, and they can generalize this learning to concentrations 100× lower than the training concentration. Their sensitivity to methyl benzoate is very low at an estimated 3 ppb. They are also able to detect methyl benzoate when covered completely by green tea, but were not able to detect methyl benzoate when covered completely by coffee grounds. Habituation to the tea and coffee odors prior to testing improves their responses, resulting in effective detection of methyl benzoate covered by the coffee grounds. With the aid of the portable device called ‘the wasp hound’, the wasps appear to have potential to be effective on-site biosensors for the detection of cocaine.
Woude, van der Emma; Smid, Hans M.
2017-01-01
Trichogramma evanescens parasitic wasps show large phenotypic plasticity in brain and body size, resulting in a 5-fold difference in brain volume among genetically identical sister wasps. Brain volume scales linearly with body volume in these wasps. This isometric brain scaling forms an exception to
New Types of Behavioral Manipulation of Host Spiders by a Parasitoid Wasp
Directory of Open Access Journals (Sweden)
William G. Eberhard
2010-01-01
Full Text Available The larva of the parasitic wasp Zatypota sp. nr. solanoi induces its host spiders Anelosimus spp. to modify its web in ways not seen in normal webs of this species or in any other species, providing apparent protection and support for the wasp's cocoon by covering the entire web with a protective sheet and adding a central platform and opening a space below in the enclosed tangle, where the larva suspends its cocoon. These modifications differ qualitatively from those induced by a congeneric wasp. Parasitized spiders appeared to adjust modified web construction behavior to local conditions, implying that larval manipulations may occur at higher rather than lower levels of behavioral control (e.g., eliciting overall design decisions, rather than particular motor patterns.
Description of the 'Variable System' in WASP
International Nuclear Information System (INIS)
Roberts, J.T.
1975-01-01
The VARSYS modul of the WASP code prepares a disc data file describing the plant types to be considered as candidates for possible addition to installed capacity in order to be able to meet forecast loads. (RW) [de
Sensitivity to European wasps in a group of allergic patients in Marseille: preliminary results.
Panzani, R; Blanca, M; Sánchez, F; Juarez, C
1994-01-01
The wasp Polistes dominulus (PD), the yellow jacket Vespula germanica (VG) and the hornet Vespa crabro (VC) are allergenically important social wasps found in Europe. Serum samples obtained from allergic subjects in Marseille were studied in order to determine the positivity by RAST to these venoms. All the sera studied had IgE antibodies to at least one of the wasp venoms tested and 50% had IgE antibodies that reacted with more than one venom. The presence in some sera of IgE antibodies to the venoms of all three wasps and RAST inhibition studies suggested that the three venoms were relevant in the area studied and that most sera were positive to the three venoms due to allergenic cross-reactivity. However, inhibition studies revealed that 2 patients may have had antibodies that did not cross-react and that were specific for the venom of only one species.
Kovac, Helmut; Stabentheiner, Anton
2012-09-15
In insect groups with the ability of endothermy, the thermoregulatory capacity has a direct relation to body mass. To verify this relationship in vespine wasps, we compared the thermoregulation of hornets (Vespa crabro), the largest species of wasps in Central Europe, with two smaller wasps (Vespula vulgaris and Vespula germanica) in the entire range of ambient temperature (T(a): ~0-40°C) where the insects exhibited foraging flights.Despite the great difference in body weight of Vespula (V. vulgaris: 84.1±19.0 mg, V. germanica: 74.1±9.6 mg) and Vespa (477.5±59.9 mg), they exhibited similarities in the dependence of thorax temperature on T(a) on their arrival (mean T(th) = 30-40°C) and departure (mean T(th) = 33-40°C) at the nest entrance. However, the hornets' thorax temperature was up to 2.5°C higher upon arrival and up to 3°C lower at departure. The thorax temperature excess (T(th)-T(a)) above ambient air of about 5-18°C indicates a high endothermic capacity in both hornets and wasps. Heat gain from solar radiation elevated the temperature excess by up to 1°C. Results show that hornets and wasps are able to regulate their body temperature quite well, even during flight. A comparison of flight temperature with literature reports on other vespine wasps revealed a dependence of the T(th) on the body mass in species weighing less than about 200 mg.
HST HOT-JUPITER TRANSMISSION SPECTRAL SURVEY: CLEAR SKIES FOR COOL SATURN WASP-39b
Energy Technology Data Exchange (ETDEWEB)
Fischer, Patrick D.; Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Sing, David K.; Kataria, Tiffany; Nikolov, Nikolay [Astrophysics Group, School of Physics, University of Exeter, Stocker Road, Exeter, EX4 4QL (United Kingdom); Henry, Gregory W.; Williamson, Michael W. [Center of Excellence in Information Systems, Tennessee State University, Nashville, TN 37209 (United States); Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California Santa Cruz, CA 95064 (United States); Burrows, Adam S. [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Showman, Adam P.; Ballester, Gilda E. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Désert, Jean-Michel [CASA, Department of Astrophysical and Planetary Sciences, University of Colorado, 389-UCB, Boulder, CO 80309 (United States); Aigrain, Suzanne [Department of Physics, University of Oxford, Denys Wilkinson Building, Keble Road, Oxford OX1 3RH (United Kingdom); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Etangs, Alain Lecavelier des; Vidal-Madjar, Alfred [CNRS, Institut dAstrophysique de Paris, UMR 7095, 98bis boulevard Arago, F-75014 Paris (France)
2016-08-10
We present the Hubble Space Telescope (HST) Space Telescope Imaging Spectrograph (STIS) optical transmission spectroscopy of the cool Saturn-mass exoplanet WASP-39b from 0.29-1.025 μ m, along with complementary transit observations from Spitzer IRAC at 3.6 and 4.5 μ m. The low density and large atmospheric pressure scale height of WASP-39b make it particularly amenable to atmospheric characterization using this technique. We detect a Rayleigh scattering slope as well as sodium and potassium absorption features; this is the first exoplanet in which both alkali features are clearly detected with the extended wings predicted by cloud-free atmosphere models. The full transmission spectrum is well matched by a clear H{sub 2}-dominated atmosphere, or one containing a weak contribution from haze, in good agreement with the preliminary reduction of these data presented in Sing et al. WASP-39b is predicted to have a pressure-temperature profile comparable to that of HD 189733b and WASP-6b, making it one of the coolest transiting gas giants observed in our HST STIS survey. Despite this similarity, WASP-39b appears to be largely cloud-free, while the transmission spectra of HD 189733b and WASP-6b both indicate the presence of high altitude clouds or hazes. These observations further emphasize the surprising diversity of cloudy and cloud-free gas giant planets in short-period orbits and the corresponding challenges associated with developing predictive cloud models for these atmospheres.
Baracchi, D.; Dapporto, L.; Turillazzi, S.
2011-01-01
The phylogeny of the Stenogastrinae wasps is still under discussion and their systematic incomplete. In the present work we used geometric morphometrics, a technique based on a rigorous statistical assessment of shape, to compare the forewings of fifteen species of Stenogastrinae wasps belonging to
Wang, Bo; Lu, Min; Cook, James M; Yang, Da-Rong; Dunn, Derek W; Wang, Rui-Wu
2018-01-30
Different types of mutualisms may interact, co-evolve and form complex networks of interdependences, but how species interact in networks of a mutualistic community and maintain its stability remains unclear. In a mutualistic network between treehoppers-weaver ants and fig-pollinating wasps, we found that the cuticular hydrocarbons of the treehoppers are more similar to the surface chemical profiles of fig inflorescence branches (FIB) than the cuticular hydrocarbons of the fig wasps. Behavioral assays showed that the cuticular hydrocarbons from both treehoppers and FIBs reduce the propensity of weaver ants to attack treehoppers even in the absence of honeydew rewards, suggesting that chemical camouflage helps enforce the mutualism between weaver ants and treehoppers. High levels of weaver ant and treehopper abundances help maintain the dominance of pollinating fig wasps in the fig wasp community and also increase fig seed production, as a result of discriminative predation and disturbance by weaver ants of ovipositing non-pollinating fig wasps (NPFWs). Ants therefore help preserve this fig-pollinating wasp mutualism from over exploitation by NPFWs. Our results imply that in this mutualistic network chemical camouflage plays a decisive role in regulating the behavior of a key species and indirectly shaping the architecture of complex arthropod-plant interactions.
How does an invasive social wasp deal with changing contextual cues while foraging?
Lozada, M; D'Adamo, P
2009-06-01
In this study, we explore how an invasive social wasp, Vespula germanica (F.), deals with contextual changes while searching for a food source that is no longer available. Four experiments were conducted to evaluate the effect of different degrees of context modification on wasp behavior. Learning sessions consisted of a variable number of feeding trials during which an individual wasp fed from a landmark array made up of a feeder surrounded by four cylinders of the same color. The food and cylinders were subsequently removed from the training site, and this learned landmark array was modified in such a way that information relating to color and/or location of the resulting feeding arrays varied from that previously learned. The results indicate that the color most recently associated with food is prioritized over a formerly learned color, and this pattern is also maintained when wasps have learned the alternative color during a higher number of feeding experiences. This highlights the high plasticity with which V. germanica responds to unpredictable contextual changes while foraging.
Genome-wide association between DNA methylation and alternative splicing in an invertebrate
Directory of Open Access Journals (Sweden)
Flores Kevin
2012-09-01
Full Text Available Abstract Background Gene bodies are the most evolutionarily conserved targets of DNA methylation in eukaryotes. However, the regulatory functions of gene body DNA methylation remain largely unknown. DNA methylation in insects appears to be primarily confined to exons. Two recent studies in Apis mellifera (honeybee and Nasonia vitripennis (jewel wasp analyzed transcription and DNA methylation data for one gene in each species to demonstrate that exon-specific DNA methylation may be associated with alternative splicing events. In this study we investigated the relationship between DNA methylation, alternative splicing, and cross-species gene conservation on a genome-wide scale using genome-wide transcription and DNA methylation data. Results We generated RNA deep sequencing data (RNA-seq to measure genome-wide mRNA expression at the exon- and gene-level. We produced a de novo transcriptome from this RNA-seq data and computationally predicted splice variants for the honeybee genome. We found that exons that are included in transcription are higher methylated than exons that are skipped during transcription. We detected enrichment for alternative splicing among methylated genes compared to unmethylated genes using fisher’s exact test. We performed a statistical analysis to reveal that the presence of DNA methylation or alternative splicing are both factors associated with a longer gene length and a greater number of exons in genes. In concordance with this observation, a conservation analysis using BLAST revealed that each of these factors is also associated with higher cross-species gene conservation. Conclusions This study constitutes the first genome-wide analysis exhibiting a positive relationship between exon-level DNA methylation and mRNA expression in the honeybee. Our finding that methylated genes are enriched for alternative splicing suggests that, in invertebrates, exon-level DNA methylation may play a role in the construction of splice
DEFF Research Database (Denmark)
Mortensen, Niels Gylling; Heathfield, D.N.; Myllerup, Lisbeth
. The analysis part consists of a transformation of an observed wind climate (speed and direction distributions) to a wind atlas data set. The wind atlas data set can subsequently be applied for estimation of the wind climate and wind power potential, as well as for siting of specific wind turbines. The WAsP 9...
Directory of Open Access Journals (Sweden)
Michael Poulsen
2011-02-01
Full Text Available Identifying new sources for small molecule discovery is necessary to help mitigate the continuous emergence of antibiotic-resistance in pathogenic microbes. Recent studies indicate that one potentially rich source of novel natural products is Actinobacterial symbionts associated with social and solitary Hymenoptera. Here we test this possibility by examining two species of solitary mud dauber wasps, Sceliphron caementarium and Chalybion californicum. We performed enrichment isolations from 33 wasps and obtained more than 200 isolates of Streptomyces Actinobacteria. Chemical analyses of 15 of these isolates identified 11 distinct and structurally diverse secondary metabolites, including a novel polyunsaturated and polyoxygenated macrocyclic lactam, which we name sceliphrolactam. By pairing the 15 Streptomyces strains against a collection of fungi and bacteria, we document their antifungal and antibacterial activity. The prevalence and anti-microbial properties of Actinobacteria associated with these two solitary wasp species suggest the potential role of these Streptomyces as antibiotic-producing symbionts, potentially helping defend their wasp hosts from pathogenic microbes. Finding phylogenetically diverse and chemically prolific Actinobacteria from solitary wasps suggests that insect-associated Actinobacteria can provide a valuable source of novel natural products of pharmaceutical interest.
Directory of Open Access Journals (Sweden)
Bianca Baranek
2018-03-01
Full Text Available Social wasps perform a variety of tasks with their mouthparts. Female workers use them to feed on carbohydrate-rich fluids, to build nests by collecting wood fibers and forming paper, to hunt and manipulate insect prey for feeding larvae as well as for brood care. Since male wasps neither feed on insects nor participate in nest building, sex-specific differences in mouthpart morphology are expected. Despite these different applications, general mouthpart morphology of male and female wasps from the genus Vespula was similar. However, males possessed significantly shorter mandibles with fewer teeth than females. Furthermore, the adductor muscles of the mandibles were distinctly smaller in males than in females. Male wasps showed a higher number of sensilla on the mandibles and the labial palpi. Mouthpart dimorphism and functional morphology of fluid uptake are discussed.
Altaisky, M V; Soloviev, A G; Stadnik, A V; Shitov, A B
2001-01-01
WASP package is a C++ program aimed to analyze angular distributions of secondary particles generated in nuclear interactions. WASP package is based on wavelet transform algorithms. This work includes the user's guide, description of algorithms and mathematical methods, graphical user interface. We have also analyzed what problems of nuclear physics can be tackled with WASP.
Larger fig wasps are more careful about which figs to enter--with good reason.
Liu, Cong; Yang, Da-Rong; Compton, Stephen G; Peng, Yan-Qiong
2013-01-01
Floral longevity reflects a balance between gains in pollinator visitation and the costs of flower maintenance. Because rewards to pollinators change over time, older flowers may be less attractive, reducing the value of extended longevity. Un-pollinated figs, the inflorescences of Ficus species, can remain receptive for long periods, but figs that are older when entered by their host-specific fig wasp pollinators produce fewer seeds and fig wasp offspring. Our field experiments with Ficushispida, a dioecious fig tree, examined how the length of time that receptive figs have remained un-pollinated influences the behaviour and reproductive success of its short-lived fig wasp pollinator, Ceratosolensolmsi marchali. The results were consistent in three different seasons, and on male and female trees, although receptivity was greatly extended during colder months. Pollinators took longer to find the ostioles of older figs, and longer to penetrate them. They also became increasingly unwilling to enter figs as they aged, and increasing numbers of the wasps became trapped in the ostiolar bracts. Larger individuals were particularly unwilling to enter older figs, resulting in older figs being pollinated by smaller wasps. On female trees, where figs produce only seeds, seed production declined rapidly with fig age. On male trees, the numbers and size of fig wasp offspring declined, and a higher proportion were male. Older male figs are harder to enter, especially for larger individuals, and offer poorer quality oviposition opportunities. This study opens an interesting new perspective on the coevolution of figs and their pollinators, especially factors influencing pollinator body size and emphasises the subtleties of interactions between mutualists.
Hierarchical genetic structure of the introduced wasp Vespula germanica in Australia.
Goodisman, M A; Matthews, R W; Crozier, R H
2001-06-01
The wasp Vespula germanica is a highly successful invasive pest. This study examined the population genetic structure of V. germanica in its introduced range in Australia. We sampled 1320 workers and 376 males from 141 nests obtained from three widely separated geographical areas on the Australian mainland and one on the island of Tasmania. The genotypes of all wasps were assayed at three polymorphic DNA microsatellite markers. Our analyses uncovered significant allelic differentiation among all four V. germanica populations. Pairwise estimates of genetic divergence between populations agreed with the results of a model-based clustering algorithm which indicated that the Tasmanian population was particularly distinct from the other populations. Within-population analyses revealed that genetic similarity declined with spatial distance, indicating that wasps from nests separated by more than approximately 25 km belonged to separate mating pools. We suggest that the observed genetic patterns resulted from frequent bottlenecks experienced by the V. germanica populations during their colonization of Australia.
Ponzio, C.A.M.; Weldegergis, B.T.; Dicke, M.; Gols, R.
2016-01-01
The three data sheets show the data for the three types of comparisons that were made: (1) wasp choice when offered acaterpillar infested plant and a caterpillar + pathogen infected plant (2) wasp choice when offered a healthy plant against a singleattacker infected/infected plant and (3) wasp
The influence of past experience on wasp choice related to foraging behavior.
Sabrina, Moreyra; D'Adamo, Paola; Lozada, Mariana
2014-12-01
Memory has been little studied in social wasps. Vespula germanica (Fab.) (Hymenoptera: Vespidae) frequently revisits nondepleted food sources, making several trips between the resource and the nest. In this study, we analyzed this relocating behavior in order to evaluate whether this species is capable of remembering an established association after 1 h. To this end, we trained wasps to feed from a certain array. Then it was removed, setting it up again 1 h later, but this time 2 baited feeders were put in place, one at the original feeding site and the other opposite the first. We recorded the proportion of returning foragers, and their choice of feeder, after either 1 or 4 feeding trials. After 1 h, 78% of wasps trained with 4 feeding trials and 65% trained with 1, returned to the experimental area. Furthermore, during the testing phase, wasps trained with 4 feeding trials collected food from the previously learned feeder significantly more frequently than from the nonlearned one (P germanica is capable of remembering an association 1 h after the last associative event, demonstrating that 1 h does not impair memory retention if 4 feeding experiences have occurred. © 2013 Institute of Zoology, Chinese Academy of Sciences.
The implementation and application of the WASP-III at CNEN/Brazil
International Nuclear Information System (INIS)
Sakamoto, L.H.; Lima, J.O.V.; Silva, R.C.O. da.
1983-09-01
The main dificulties faced in the implementation of the WASP-III on the Honeywell Bull DPS 6/64 computer at CNEN, are discribed. After the implementation, tests making use of input data provided by International Atomic Energy Agency - IAEA were performed and comparative results from accomplishment peiods of time are presented with the basic characteristics of the computer employed and the modifications carried out to adapt the programm. The WASP-III was applied to middle-sized electric system based upon the Brazilian North/Northeast System. (Author) [pt
Searching for Rapid Orbital Decay of WASP-18b
Wilkins, Ashlee N.; Delrez, Laetitia; Barker, Adrian J.; Deming, Drake; Hamilton, Douglas; Gillon, Michael; Jehin, Emmanuel
2017-02-01
The WASP-18 system, with its massive and extremely close-in planet, WASP-18b (M p = 10.3M J , a = 0.02 au, P = 22.6 hr), is one of the best-known exoplanet laboratories to directly measure Q‧, the modified tidal quality factor and proxy for efficiency of tidal dissipation, of the host star. Previous analysis predicted a rapid orbital decay of the planet toward its host star that should be measurable on the timescale of a few years, if the star is as dissipative as is inferred from the circularization of close-in solar-type binary stars. We have compiled published transit and secondary eclipse timing (as observed by WASP, TRAPPIST, and Spitzer) with more recent unpublished light curves (as observed by TRAPPIST and Hubble Space Telescope) with coverage spanning nine years. We find no signature of a rapid decay. We conclude that the absence of rapid orbital decay most likely derives from Q‧ being larger than was inferred from solar-type stars and find that Q‧ ≥ 1 × 106, at 95% confidence; this supports previous work suggesting that F stars, with their convective cores and thin convective envelopes, are significantly less tidally dissipative than solar-type stars, with radiative cores and large convective envelopes.
The sphecid wasps (Hym. Ampulicidae, Sphecidae & Crabronidae ...
African Journals Online (AJOL)
The list of Egyptian sphecid wasps includes the current names of those species recorded in the literature with indications where these have changed together with previously unrecorded genera and species. Three genera have not been recorded from Egypt hitherto (Spilomena, Crossocerus, Lestica). Twenty-four species ...
Social wasps are a Saccharomyces mating nest.
Stefanini, Irene; Dapporto, Leonardo; Berná, Luisa; Polsinelli, Mario; Turillazzi, Stefano; Cavalieri, Duccio
2016-02-23
The reproductive ecology of Saccharomyces cerevisiae is still largely unknown. Recent evidence of interspecific hybridization, high levels of strain heterozygosity, and prion transmission suggest that outbreeding occurs frequently in yeasts. Nevertheless, the place where yeasts mate and recombine in the wild has not been identified. We found that the intestine of social wasps hosts highly outbred S. cerevisiae strains as well as a rare S. cerevisiae×S. paradoxus hybrid. We show that the intestine of Polistes dominula social wasps favors the mating of S. cerevisiae strains among themselves and with S. paradoxus cells by providing a succession of environmental conditions prompting cell sporulation and spores germination. In addition, we prove that heterospecific mating is the only option for European S. paradoxus strains to survive in the gut. Taken together, these findings unveil the best hidden secret of yeast ecology, introducing the insect gut as an environmental alcove in which crosses occur, maintaining and generating the diversity of the ascomycetes.
Directory of Open Access Journals (Sweden)
Benjamin J. Taylor
2011-01-01
Full Text Available Scent marking food resources is expected to enhance foraging efficiency reducing search time. Many social bees exhibit this behavior, but scent-marking is absent in social wasps, except for Vespa mandarinia. We tested for scent marking in the swarm-founding wasp, Polybia occidentalis. This wasp has moderately large colonies and utilizes resources that are concentrated in time and space, making scent marking profitable. Also, this wasp uses chemical markings to lead nestmates to a new nest site during swarm emigration, making it possible that it could use the same behavior to recruit nestmates to a food source. Foragers from 11 colonies were given a choice between a previously visited feeder and an unvisited one, both containing a rich, unscented sucrose solution. There was no difference in the number of visits to the two treatments. However, some individuals chose the feeder on one side more often. We conclude that foragers of this species of wasp do not use odor marks left behind by nestmates to find food, but they do exhibit the tendency, when returning to a food source that has not been depleted, to choose a resource based on its relative position, presumably by using visual cues.
Transiting planetary system WASP-17 (Southworth+, 2012)
DEFF Research Database (Denmark)
Southworth, J.; Hinse, T. C.; Dominik, M.
2013-01-01
A light curve of four transits of the extrasolar planetary system WASP-17 is presented. The data were obtained using the Danish 1.5m telescope and DFOSC camera at ESO La Silla in 2012, with substantial telescope defocussing in order to improve the photometric precision of the observations...
The WASP-South search for transiting exoplanets
Directory of Open Access Journals (Sweden)
Queloz D.
2011-02-01
Full Text Available Since 2006 WASP-South has been scanning the Southern sky for transiting exoplanets. Combined with Geneva Observatory radial velocities we have so far found over 30 transiting exoplanets around relatively bright stars of magnitude 9–13. We present a status report for this ongoing survey.
Male killing Spiroplasma protects Drosophila melanogaster against two parasitoid wasps
Xie, J; Butler, S; Sanchez, G; Mateos, M
2014-01-01
Maternally transmitted associations between endosymbiotic bacteria and insects are diverse and widespread in nature. Owing to imperfect vertical transmission, many heritable microbes have evolved compensational mechanisms to enhance their persistence in host lineages, such as manipulating host reproduction and conferring fitness benefits to host. Symbiont-mediated defense against natural enemies of hosts is increasingly recognized as an important mechanism by which endosymbionts enhance host fitness. Members of the genus Spiroplasma associated with distantly related Drosophila hosts are known to engage in either reproductive parasitism (i.e., male killing) or defense against natural enemies (the parasitic wasp Leptopilina heterotoma and a nematode). A male-killing strain of Spiroplasma (strain Melanogaster Sex Ratio Organism (MSRO)) co-occurs with Wolbachia (strain wMel) in certain wild populations of the model organism Drosophila melanogaster. We examined the effects of Spiroplasma MSRO and Wolbachia wMel on Drosophila survival against parasitism by two common wasps, Leptopilina heterotoma and Leptopilina boulardi, that differ in their host ranges and host evasion strategies. The results indicate that Spiroplasma MSRO prevents successful development of both wasps, and confers a small, albeit significant, increase in larva-to-adult survival of flies subjected to wasp attacks. We modeled the conditions under which defense can contribute to Spiroplasma persistence. Wolbachia also confers a weak, but significant, survival advantage to flies attacked by L. heterotoma. The host protective effects exhibited by Spiroplasma and Wolbachia are additive and may provide the conditions for such cotransmitted symbionts to become mutualists. Occurrence of Spiroplasma-mediated protection against distinct parasitoids in divergent Drosophila hosts suggests a general protection mechanism. PMID:24281548
Expression of Enzymatically Inactive Wasp Venom Phospholipase A1 in Pichia pastoris
DEFF Research Database (Denmark)
Borodina, Irina; Jensen, Bettina M.; Wagner, Tim
2011-01-01
Wasp venom allergy is the most common insect venom allergy in Europe. It is manifested by large local reaction or anaphylactic shock occurring after a wasp sting. The allergy can be treated by specific immunotherapy with whole venom extracts. Wasp venom is difficult and costly to obtain...... and is a subject to composition variation, therefore it can be advantageous to substitute it with a cocktail of recombinant allergens. One of the major venom allergens is phospholipase A1, which so far has been expressed in Escherichia coli and in insect cells. Our aim was to produce the protein in secreted form...... in yeast Pichia pastoris, which can give high yields of correctly folded protein on defined minimal medium and secretes relatively few native proteins simplifying purification.Residual amounts of enzymatically active phospholipase A1 could be expressed, but the venom protein had a deleterious effect...
Expression of enzymatically inactive wasp venom phospholipase A1 in Pichia pastoris
DEFF Research Database (Denmark)
Borodina, Irina; Jensen, Bettina M.; Wagner, Tim
Wasp venom allergy is the most common insect venom allergy in Europe. It is manifested by large local reaction or anaphylactic shock occurring after a wasp sting. The allergy can be treated by specific immunotherapy with whole venom extracts. Wasp venom is difficult and costly to obtain...... and is a subject to composition variation, therefore it can be advantageous to substitute it with a cocktail of recombinant allergens. One of the major venom allergens is phospholipase A1, which so far has been expressed in Escherichia coli and in insect cells. Our aim was to produce the protein in secreted form...... in yeast Pichia pastoris, which can give high yields of correctly folded protein on defined minimal medium and secretes relatively few native proteins simplifying purification. Residual amounts of enzymatically active phospholipase A1 could be expressed, but the venom protein had a deleterious effect...
Expression of enzymatically inactive wasp venom phospholipase A1 in Pichia pastoris
DEFF Research Database (Denmark)
Borodina, Irina; Jensen, Bettina M; Wagner, Tim
2011-01-01
Wasp venom allergy is the most common insect venom allergy in Europe. It is manifested by large local reaction or anaphylactic shock occurring after a wasp sting. The allergy can be treated by specific immunotherapy with whole venom extracts. Wasp venom is difficult and costly to obtain...... and is a subject to composition variation, therefore it can be advantageous to substitute it with a cocktail of recombinant allergens. One of the major venom allergens is phospholipase A1, which so far has been expressed in Escherichia coli and in insect cells. Our aim was to produce the protein in secreted form...... in yeast Pichia pastoris, which can give high yields of correctly folded protein on defined minimal medium and secretes relatively few native proteins simplifying purification.Residual amounts of enzymatically active phospholipase A1 could be expressed, but the venom protein had a deleterious effect...
Transmission spectroscopy of the hot Jupiter WASP-12b from 0.7 to 5 μm
Energy Technology Data Exchange (ETDEWEB)
Stevenson, Kevin B.; Bean, Jacob L.; Seifahrt, Andreas; Kreidberg, Laura [Department of Astronomy and Astrophysics, University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Désert, Jean-Michel [Division of Geological and Planetary Sciences, California Institute of Technology, MC 170-25 1200, East California Boulevard, Pasadena, CA 91125 (United States); Madhusudhan, Nikku [Department of Physics and Department of Astronomy, Yale University, P.O. Box 208120, New Haven, CT 06520 (United States); Bergmann, Marcel [National Optical Astronomy Observatory (NOAO), Tucson, AZ 85719 (United States); Homeier, Derek, E-mail: kbs@uchicago.edu [Centre de Recherche Astrophysique de Lyon, UMR 5574, CNRS, Université de Lyon, École Normale Supérieure de Lyon, 46 Allée d' Italie, F-69364 Lyon Cedex 07 (France)
2014-06-01
Since the first report of a potentially non-solar carbon-to-oxygen ratio (C/O) in its dayside atmosphere, the highly irradiated exoplanet WASP-12b has been under intense scrutiny and the subject of many follow-up observations. Additionally, the recent discovery of stellar binary companions ∼1'' from WASP-12 has obfuscated interpretation of the observational data. Here we present new ground-based multi-object transmission-spectroscopy observations of WASP-12b that we acquired over two consecutive nights in the red optical with Gemini-N/GMOS. After correcting for the influence of WASP-12's stellar companions, we find that these data rule out a cloud-free H{sub 2} atmosphere with no additional opacity sources. We detect features in the transmission spectrum that may be attributed to metal oxides (such as TiO and VO) for an O-rich atmosphere or to metal hydrides (such as TiH) for a C-rich atmosphere. We also reanalyzed NIR transit-spectroscopy observations of WASP-12b from HST/WFC3 and broadband transit photometry from Warm Spitzer. We attribute the broad spectral features in the WFC3 data to either H{sub 2}O or CH{sub 4} and HCN for an O-rich or C-rich atmosphere, respectively. The Spitzer data suggest shallower transit depths than the models predict at infrared wavelengths, albeit at low statistical significance. A multi-instrument, broad-wavelength analysis of WASP-12b suggests that the transmission spectrum is well approximated by a simple Rayleigh scattering model with a planet terminator temperature of 1870 ± 130 K. We conclude that additional high-precision data and isolated spectroscopic measurements of the companion stars are required to place definitive constraints on the composition of WASP-12b's atmosphere.
Recognition of human face images by the free flying wasp Vespula vulgaris
Directory of Open Access Journals (Sweden)
Aurore Avarguès-Weber
2017-08-01
Full Text Available The capacity to recognize perceptually similar complex visual stimuli such as human faces has classically been thought to require a large primate, and/or mammalian brain with neurobiological adaptations. However, recent work suggests that the relatively small brain of a paper wasp, Polistes fuscatus, possesses specialized face processing capabilities. In parallel, the honeybee, Apis mellifera, has been shown to be able to rely on configural learning for extensive visual learning, thus converging with primate visual processing. Therefore, the honeybee may be able to recognize human faces, and show sophisticated learning performance due to its foraging lifestyle involving visiting and memorizing many flowers. We investigated the visual capacities of the widespread invasive wasp Vespula vulgaris, which is unlikely to have any specialization for face processing. Freely flying individual wasps were trained in an appetitive-aversive differential conditioning procedure to discriminate between perceptually similar human face images from a standard face recognition test. The wasps could then recognize the target face from novel dissimilar or similar human faces, but showed a significant drop in performance when the stimuli were rotated by 180°, thus paralleling results acquired on a similar protocol with honeybees. This result confirms that a general visual system can likely solve complex recognition tasks, the first stage to evolve a visual expertise system to face recognition, even in the absence of neurobiological or behavioral specialization.
TRANSIT TIMING VARIATION MEASUREMENTS OF WASP-12b AND QATAR-1b: NO EVIDENCE OF ADDITIONAL PLANETS
Energy Technology Data Exchange (ETDEWEB)
Collins, Karen A.; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Kielkopf, John F. [Department of Physics and Astronomy, University of Louisville, Louisville, KY 40292 (United States)
2017-02-01
WASP-12b and Qatar-1b are transiting hot Jupiters for which previous works have suggested the presence of transit timing variations (TTVs) indicative of additional bodies in these systems—an Earth-mass planet in WASP-12 and a brown-dwarf mass object in Qatar-1. Here, we present 23 new WASP-12b and 18 new Qatar-1b complete (or nearly complete) transit observations. We perform global system fits to all of our light curves for each system, as well as RV and stellar spectroscopic parameters from the literature. The global fits provide refined system parameters and uncertainties for each system, including precise transit center times for each transit. The transit model residuals of the combined and five minute binned light curves have an rms of 183 and 255 parts per million (ppm) for WASP-12b and Qatar-1b, respectively. Most of the WASP-12b system parameter values from this work are consistent with values from previous studies, but have ∼40%–50% smaller uncertainties. Most of the Qatar-1b system parameter values and uncertainties from this work are consistent with values recently reported in the literature. We find no convincing evidence for sinusoidal TTVs with a semi-amplitude of more than ∼35 and ∼25 s in the WASP-12b and Qatar-1b systems, respectively.
Social Learning in Vespula Germanica Wasps: Do They Use Collective Foraging Strategies?
Lozada, Mariana; D? Adamo, Paola; Buteler, Micaela; Kuperman, Marcelo N.
2016-01-01
Vespula germanica is a social wasp that has become established outside its native range in many regions of the world, becoming a major pest in the invaded areas. In the present work we analyze social communication processes used by V. germanica when exploiting un-depleted food sources. For this purpose, we investigated the arrival pattern of wasps at a protein bait and evaluated whether a forager recruited conspecifics in three different situations: foragers were able to return to the nest (f...
Directory of Open Access Journals (Sweden)
Alexandre Somavilla
2014-12-01
Full Text Available Diversity and aspects of the ecology of social wasps (Vespidae, Polistinae in Central Amazonian "terra firme" forest. The knowledge of social wasp richness and biology in the Amazonian region is considered insufficient. Although the Amazonas state is the largest in the region, until now only two brief surveys were conducted there. Considering that the systematic inventory of an area is the first step towards its conservation and wise use, this study presents faunal data on social wasp diversity in a 25 km² area of "terra firme" (upland forest at the Ducke Reserve, Manaus, Amazonas, Brazil. Wasps were collected in the understory, following a protocol of three collectors walking along 60 trails 1,000 m in extension for 16 days between August and October 2010. Methods used were active search of individuals with entomological nets and nest collecting. Fifty-eight species of social wasps, allocated in 13 genera, were recorded; 67% of the collected species belong to Polybia, Agelaia and Mischocyttarus; other genera were represented by only four species or less. The most frequent species in active searches were Agelaia fulvofasciata (DeGeer, 1773, Agelaia testacea (Fabricius, 1804 and Angiopolybia pallens (Lepeletier, 1836. Twelve species were collected in nests. Prior to this study, 65 Polistinae species were deposited at the INPA Collection. Collecting in the study grid, an area not previously sampled for wasps, resulted in an increase of 25% species, and species richness was 86. According to the results, there is evidence that the diversity of social wasps at the Ducke Reserve is even higher, making it one of the richest areas in the Brazilian Amazonia.
Searching for Rapid Orbital Decay of WASP-18b
Energy Technology Data Exchange (ETDEWEB)
Wilkins, Ashlee N.; Deming, Drake; Hamilton, Douglas [Department of Astronomy, University of Maryland, College Park, MD 20742-2421 (United States); Delrez, Laetitia [Cavendish Laboratory, University of Cambridge, J J Thomson Avenue, Cambridge CB3 0HE (United Kingdom); Barker, Adrian J. [Department of Applied Mathematics, School of Mathematics, University of Leeds, Leeds LS2 9JT (United Kingdom); Gillon, Michael; Jehin, Emmanuel, E-mail: awilkins@astro.umd.edu [Space Sciences, Technologies and Astrophysics Research (STAR) Institute, Université de Liège, allée du 6 Août 19C, B-4000 Lige (Belgium)
2017-02-20
The WASP-18 system, with its massive and extremely close-in planet, WASP-18b ( M{sub p} = 10.3 M{sub J}, a = 0.02 au, P = 22.6 hr), is one of the best-known exoplanet laboratories to directly measure Q ′, the modified tidal quality factor and proxy for efficiency of tidal dissipation, of the host star. Previous analysis predicted a rapid orbital decay of the planet toward its host star that should be measurable on the timescale of a few years, if the star is as dissipative as is inferred from the circularization of close-in solar-type binary stars. We have compiled published transit and secondary eclipse timing (as observed by WASP, TRAPPIST, and Spitzer ) with more recent unpublished light curves (as observed by TRAPPIST and Hubble Space Telescope ) with coverage spanning nine years. We find no signature of a rapid decay. We conclude that the absence of rapid orbital decay most likely derives from Q ′ being larger than was inferred from solar-type stars and find that Q ′ ≥ 1 × 10{sup 6}, at 95% confidence; this supports previous work suggesting that F stars, with their convective cores and thin convective envelopes, are significantly less tidally dissipative than solar-type stars, with radiative cores and large convective envelopes.
Eocene and not Cretaceous origin of spider wasps: Fossil evidence from amber
Directory of Open Access Journals (Sweden)
Juanita Rodriguez
2016-02-01
Full Text Available Spider wasps had long been proposed to originate in the mid-Cretaceous based on the Burmese amber fossil Bryopompilus interfector Engel and Grimaldi, 2006. We performed a morphological examination of this fossil and determined it does not belong to Pompilidae or any other described hymenopteran family. Instead, we place it in the new family Bryopompilidae. The oldest verifiable member of the Pompilidae is from Baltic amber, which suggests the family probably originated in the Eocene, not in the mid-Cretaceous as previously proposed. The origin of spider wasps appears to be correlated with an increase in spider familial diversity in the Cenozoic. We also we add two genera to the extinct pompilid fauna: Tainopompilus gen. nov., and Paleogenia gen. nov., and describe three new species of fossil spider wasps: Anoplius planeta sp. nov., from Dominican amber (Burdigalian to Langhian; Paleogenia wahisi sp. nov., from Baltic amber (Lutetian to Priabonian; and Tainopompilus argentum sp. nov, from Dominican amber (Chattian to Langhian.
Cammack, Jonathan A; Nelder, Mark P
2010-02-25
The hairy maggot blow fly Chrysomya rufifacies (Macquart) (Diptera: Calliphoridae) has expanded its range in the United States since its introduction into Texas (ca. 1980) and has been collected in 15 states. We investigated the bionomics of immature and adult C. rufifacies collected from carcasses of a raccoon Procyon lotor (Linnaeus) and white-tailed deer Odocoileus virginianus Zimmerman in Upstate South Carolina during November 2007, and used these insects to estimate the minimum period of insect activity. Puparia of C. rufifacies were collected from deer carrion; 28% were parasitized by Nasonia vitripennis (Walker) (Hymenoptera: Pteromalidae). The mean daily ambient temperature during this study was 11.4+/-1.02 degrees C, representing the lowest recorded mean temperature for adult activity of C. rufifacies; adults of C. rufifacies were observed flying among the carcasses at 9.0 degrees C. Although C. rufifacies is considered a warm-weather blow fly, researchers should be aware of its activity at suboptimal conditions, behavior that might aid its expansion into more northern areas. 2009 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
V. Lohrmann
2017-08-01
Full Text Available Rhopalosomatidae are an unusual family of wasps (Hymenoptera: Aculeata comprising less than 100 species found in the tropics and subtropics of all continents except Europe and Antarctica. Whereas some species resemble nocturnal Ichneumonidae, others might be mistaken for spider wasps or different groups of brachypterous Hymenoptera. Despite their varied morphology, all members of the family supposedly develop as larval ectoparasitoids of crickets (Orthoptera: Grylloidea. Here, we report on the first record of a fossil rhopalosomatid larva which was discovered in mid-Cretaceous amber from northern Myanmar (Burma. The larva is attached to the lateral side of a cricket between the metafemur and the abdomen, impacting the natural position of the hind leg, exactly as documented for modern species. Additionally, the larval gestalt is strikingly similar to those of extant forms. These observations imply that this behavioral specialization, e.g., host association and positioning on host, likely evolved in the stem of the family at least 100 million years ago.
International Nuclear Information System (INIS)
Crossfield, Ian J. M.; Barman, Travis; Hansen, Brad M. S.; Tanaka, Ichi; Kodama, Tadayuki
2012-01-01
We revisit the atmospheric properties of the extremely hot Jupiter WASP-12b in light of several new developments. First, we present new narrowband (2.315 μm) secondary eclipse photometry, which exhibits a planet/star flux ratio of 0.45% ± 0.06%, corresponding to a brightness temperature of 3640 ± 230 K; second, recent Spitzer/Infrared Array Camera and Hubble Space Telescope/Wide Field Camera 3 observations; and third, a recently observed star only 1'' from WASP-12, which has diluted previous observations and which we further characterize here. We correct past WASP-12b eclipse measurements for the presence of this object, and we revisit the interpretation of WASP-12b's dilution-corrected emission spectrum. The resulting planetary emission spectrum is well approximated by a blackbody, and consequently our primary conclusion is that the planet's infrared photosphere is nearly isothermal. Thus, secondary eclipse spectroscopy is relatively ill suited to constrain WASP-12b's atmospheric abundances, and transmission spectroscopy may be necessary to achieve this goal.
Climate warming and the potential extinction of fig wasps, the obligate pollinators of figs.
Jevanandam, Nanthinee; Goh, Alexander G R; Corlett, Richard T
2013-06-23
Figs (Ficus) have a reciprocally obligate mutualism with tiny, short-lived (1-2 days) fig wasps (Agaonidae). The small size and short life of these pollinators is expected to make them more vulnerable to climate change than their larger and longer-lived hosts. We experimentally tested the thermal tolerances of four species of adult female fig wasp from equatorial Singapore. The results suggest that an increase of 3°C or more above the current temperatures experienced across much of the equatorial tropics would markedly decrease the active adult lifespan of all four species. Fig plants are the centre of an intricate web of specialist and generalist animals. Unless fig wasps can acclimate or adapt to warmer temperatures in time, these responses may disrupt the mutualism, potentially affecting multiple trophic levels.
Experience with the Agency's WASP for nuclear power planning in developing countries
International Nuclear Information System (INIS)
1986-02-01
An Advisory Group Meeting to discuss recent experience with, and to suggest improvements to, Wien Automatic System Planning Program (WASP), was held in Vienna in September 1985. It was clear from the meeting that WASP is a very useful tool as an aid in planning electric power generation systems. It is widely used in both developed and developing countries and its use will continue particularly if some of the suggestions for its improvements are implemented. A separate abstract was prepared for each of the 15 presentations of this meeting
Competitive exclusion among fig wasps achieved via entrainment of host plant flowering phenology.
Directory of Open Access Journals (Sweden)
Min Liu
Full Text Available Molecular techniques are revealing increasing numbers of morphologically similar but co-existing cryptic species, challenging the niche theory. To understand the co-existence mechanism, we studied phenologies of morphologically similar species of fig wasps that pollinate the creeping fig (F. pumila in eastern China. We compared phenologies of fig wasp emergence and host flowering at sites where one or both pollinators were present. At the site where both pollinators were present, we used sticky traps to capture the emerged fig wasps and identified species identity using mitochondrial DNA COI gene. We also genotyped F. pumila individuals of the three sites using polymorphic microsatellites to detect whether the host populations were differentiated. Male F. pumila produced two major crops annually, with figs receptive in spring and summer. A small partial third crop of receptive figs occurred in the autumn, but few of the second crop figs matured at that time. Hence, few pollinators were available to enter third crop figs and they mostly aborted, resulting in two generations of pollinating wasps each year, plus a partial third generation. Receptive figs were produced on male plants in spring and summer, timed to coincide with the release of short-lived adult pollinators from the same individual plants. Most plants were pollinated by a single species. Plants pollinated by Wiebesia sp. 1 released wasps earlier than those pollinated by Wiebesia sp. 3, with little overlap. Plants occupied by different pollinators were not spatially separated, nor genetically distinct. Our findings show that these differences created mismatches with the flight periods of the other Wiebesia species, largely 'reserving' individual plants for the resident pollinator species. This pre-emptive competitive displacement may prevent long term co-existence of the two pollinators.
El-Sayed, Ashraf M; Manning, Lee-Anne; Unelius, C Rikard; Park, Kye Chung; Stringer, Lloyd D; White, Nicola; Bunn, Barry; Twidle, Andrew; Suckling, David M
2009-09-01
The common wasp, Vespula vulgaris (L.), and the German wasp, Vespula germanica (F.), are significant problems in New Zealand beech forests (Nothofagus spp.), adversely affecting native birds and invertebrate biodiversity. This work was undertaken to develop synthetic attractants for these species to enable more efficient monitoring and management. Seven known wasp attractants (acetic acid, butyl butyrate, isobutanol, heptyl butyrate, octyl butyrate and 2,4-hexadienyl butyrate) were field tested, and only heptyl butyrate and octyl butyrate attracted significantly higher numbers of wasps than a non-baited trap. Accordingly, a series of straight-chain esters from methyl to decyl butyrate were prepared and field tested for attraction of social wasps. Peak biological activity occurred with hexyl butyrate, heptyl butyrate, octyl butyrate and nonyl butyrate. Polyethylene bags emitting approximately 18.4-22.6 mg day(-1) of heptyl butyrate were more attractive than polyethylene bags emitting approximately 14.7-16.8 mg day(-1) of heptyl butyrate in the field. Electroantennogram (EAG) studies indicated that queens and workers of V. vulgaris had olfactory receptor neurons responding to various aliphatic butyrates. These results are the first to be reported on the EAG response and the attraction of social wasps to synthetic chemicals in New Zealand beech forests and will enable monitoring of social wasp activity in beech forests. Copyright 2009 Society of Chemical Industry.
Provisional host catalogue of Fig wasps (Hymenoptera, Chalcidoidea)
Wiebes, J.T.
1966-01-01
INTRODUCTION In this catalogue — entitled "provisional" because our knowledge of the subject is still so evidently incomplete — all species of Ficus mentioned as hosts of fig wasps, are listed with the Hymenoptera Chalcidoidea reared from their receptacles. The names used for the Agaonidae are in
Social wasps promote social behavior in Saccharomyces spp.
This commentary provides background and an evaluation of a paper to be published in the Proceedings of the National Academy of Sciences in which social wasps were found to harbor significant populations of two species of the yeast genus Saccharomyces. Apparently, the yeasts were acquired during feed...
WASP7 BENTHIC ALGAE - MODEL THEORY AND USER'S GUIDE
The standard WASP7 eutrophication module includes nitrogen and phosphorus cycling, dissolved oxygen-organic matter interactions, and phytoplankton kinetics. In many shallow streams and rivers, however, the attached algae (benthic algae, or periphyton, attached to submerged substr...
Ultraviolet anomalies of the WASP-12 and HD 189733 systems: Trojan satellites as a plasma source
Kislyakova, Kristina; Pilat-Lohinger, Elke; Funk, Barbara; Lammer, Helmut; Fossati, Luca; Eggl, Siegfried; Schwarz, Richard; Boudyada, Mohammed; Erkaev, Nikolai
2017-04-01
We suggest an additional possible plasma source in the WASP-12 and HD189733b systems to explain part of the phenomena observed in ultraviolet (UV) light curves during planetary transits. In the proposed scenario, material originates from the molten surface of Trojan satellites on orbits near the Lagrange points L4 and L5. We show that the temperature at the orbital location of WASP-12b is high enough to melt the surface of rocky Trojans and to form shallow lava oceans on them. At the orbital distance of WASP-12b, this leads to the release of elements such as Mg and Ca, which are expected to surround the system. The predicted Mg and Ca outgassing rates from two Io-sized WASP-12b Trojans are ≈ 2.2 × 1027 s-1 and ≈ 2.2 × 1026 s-1, respectively. Trojan outgassing can lead to the observed lack of emission in MgII h&k and CaII H&K line cores of WASP-12. For HD 189733b, the mechanism is only marginally possible due to the lower temperature. The early ingress of HD 189733b observed in the far-UV (FUV) CII doublet couldn't be explained by this mechanism due to absence of carbon within elements outgassed by molten lava. We investigate the long-term stability region of WASP-12b and HD 189733b in case of planar and inclined motion of these satellites and show that unlike the classical exomoons orbiting the planet, Io-sized Trojans can be stable for the whole systems life time.
WASP-121b: An ultrahot gas-giant exoplanet with a stratosphere
Kataria, Tiffany; Evans, Thomas M.; Sing, David; Goyal, Jayesh; Nikolov, Nikolay; Wakeford, Hannah R.; Deming, Drake; Marley, Mark S.; PanCET Team
2018-01-01
Stratospheres are ubiquitous in the atmospheres of solar system planets, and provide crucial information about an atmosphere’s chemical composition, vertical temperature structure, and energy budget. While it has been suggested that stratospheres could form in highly irradiated exoplanets, the extent to which this occurs has so far been unresolved both theoretically and observationally. Here we present secondary eclipse observations of the ultra-hot (Teq ~ 2500 K) gas giant exoplanet WASP-121b made using HST/WFC3 in spectroscopic mode across the 1.12-1.64 micron wavelength range. The spectrum is inconsistent with an isothermal atmosphere and has spectrally-resolved water features in emission, providing a detection of an exoplanet stratosphere at 5-sigma confidence. WASP-121b is one of the standout exoplanets available for atmospheric characterization, both in transmission and emission, due to its large radius (1.8 Rjup), high temperature, and bright host star (H=9.4mag). As such, we will also discuss follow-up observations of WASP-121b with HST and JWST to probe the longitudinal extent of its stratosphere, and the molecular absorbers that may produce it.
Learning in an exotic social wasp while relocating a food source.
Lozada, Mariana; D'Adamo, Paola
2014-01-01
In this paper we review several studies on Vespulagermanica behavioral plasticity while relocating a food source in natural environments. This exotic social wasp, which has become established in many parts of the world, displays diverse cognitive abilities when foraging. Given its successful invasiveness worldwide, our initial hypothesis was that this species has great behavioral plasticity, which enables it to face environmental uncertainty. In our work we have analyzed foraging behavior associated with undepleted resources. Throughout several experiments, rapid learning was observed in this species; after few learning experiences they associate diverse contextual cues with a food source. However, by exploring wasp behavior when food suddenly disappeared, either because it had been removed or displaced, we found that they continued searching over a no longer rewarding site for a considerable period of time, suggesting that past experience can hinder new learning. Particularly surprising is the fact that when food was displaced nearby, wasps persisted in searching over the empty dish, ignoring the presence of food close by. We propose that this species could be a suitable model for studying cognitive plasticity in relation to environmental uncertainty. Copyright © 2014 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Mendonça, João M.; Malik, Matej; Demory, Brice-Olivier
2018-01-01
red noise due to intra-pixel sensitivity, which leads to greater fluxes emanating from the nightside of WASP-43b, thus reducing the tension between theory and data. On the theoretical front, we construct cloud-free and cloudy atmospheres of WASP-43b using our Global Circulation Model (GCM), THOR...
Mendonça, João M.; Malik, Matej; Demory, Brice-Olivier; Heng, Kevin
2018-04-01
Recently acquired Hubble and Spitzer phase curves of the short-period hot Jupiter WASP-43b make it an ideal target for confronting theory with data. On the observational front, we re-analyze the 3.6 and 4.5 μm Spitzer phase curves and demonstrate that our improved analysis better removes residual red noise due to intra-pixel sensitivity, which leads to greater fluxes emanating from the nightside of WASP-43b, thus reducing the tension between theory and data. On the theoretical front, we construct cloud-free and cloudy atmospheres of WASP-43b using our Global Circulation Model (GCM), THOR, which solves the non-hydrostatic Euler equations (compared to GCMs that typically solve the hydrostatic primitive equations). The cloud-free atmosphere produces a reasonable fit to the dayside emission spectrum. The multi-phase emission spectra constrain the cloud deck to be confined to the nightside and have a finite cloud-top pressure. The multi-wavelength phase curves are naturally consistent with our cloudy atmospheres, except for the 4.5 μm phase curve, which requires the presence of enhanced carbon dioxide in the atmosphere of WASP-43b. Multi-phase emission spectra at higher spectral resolution, as may be obtained using the James Webb Space Telescope, and a reflected-light phase curve at visible wavelengths would further constrain the properties of clouds in WASP-43b.
Hon, Kam Lun; Leung, Alexander K C
2017-09-01
While jogging in a local park in Hong Kong, a 55-year-old, previously healthy man was stung on the ventral aspect of his right wrist. The tiny stinger was gently removed with nail cutters and examined under a microscope at 80x magni cation; plucking the stinger is ill- advised as this may inject more venom into the wounded site. Two days after stinging, the microscopic appearance of the stinger con rmed the diagnosis to be from a bee instead of a wasp or other insect. A simple method of con rming the nature of insect stings and an overview of Hymenoptera stings and their management are provided herein.
Directory of Open Access Journals (Sweden)
Helmut Kovac
2012-07-01
In insect groups with the ability of endothermy, the thermoregulatory capacity has a direct relation to body mass. To verify this relationship in vespine wasps, we compared the thermoregulation of hornets (Vespa crabro, the largest species of wasps in Central Europe, with two smaller wasps (Vespula vulgaris and Vespula germanica in the entire range of ambient temperature (Ta: ∼0–40°C where the insects exhibited foraging flights. Despite the great difference in body weight of Vespula (V. vulgaris: 84.1±19.0 mg, V. germanica: 74.1±9.6 mg and Vespa (477.5±59.9 mg, they exhibited similarities in the dependence of thorax temperature on Ta on their arrival (mean Tth = 30–40°C and departure (mean Tth = 33–40°C at the nest entrance. However, the hornets' thorax temperature was up to 2.5°C higher upon arrival and up to 3°C lower at departure. The thorax temperature excess (Tth−Ta above ambient air of about 5–18°C indicates a high endothermic capacity in both hornets and wasps. Heat gain from solar radiation elevated the temperature excess by up to 1°C. Results show that hornets and wasps are able to regulate their body temperature quite well, even during flight. A comparison of flight temperature with literature reports on other vespine wasps revealed a dependence of the Tth on the body mass in species weighing less than about 200 mg.
Kovac, Helmut; Stabentheiner, Anton
2012-01-01
Summary In insect groups with the ability of endothermy, the thermoregulatory capacity has a direct relation to body mass. To verify this relationship in vespine wasps, we compared the thermoregulation of hornets (Vespa crabro), the largest species of wasps in Central Europe, with two smaller wasps (Vespula vulgaris and Vespula germanica) in the entire range of ambient temperature (Ta: ∼0–40°C) where the insects exhibited foraging flights. Despite the great difference in body weight of Vespula (V. vulgaris: 84.1±19.0 mg, V. germanica: 74.1±9.6 mg) and Vespa (477.5±59.9 mg), they exhibited similarities in the dependence of thorax temperature on Ta on their arrival (mean Tth = 30–40°C) and departure (mean Tth = 33–40°C) at the nest entrance. However, the hornets' thorax temperature was up to 2.5°C higher upon arrival and up to 3°C lower at departure. The thorax temperature excess (Tth−Ta) above ambient air of about 5–18°C indicates a high endothermic capacity in both hornets and wasps. Heat gain from solar radiation elevated the temperature excess by up to 1°C. Results show that hornets and wasps are able to regulate their body temperature quite well, even during flight. A comparison of flight temperature with literature reports on other vespine wasps revealed a dependence of the Tth on the body mass in species weighing less than about 200 mg. PMID:23162695
Comparison of Inoculation with the InoqulA and WASP Automated Systems with Manual Inoculation
Croxatto, Antony; Dijkstra, Klaas; Prod'hom, Guy
2015-01-01
The quality of sample inoculation is critical for achieving an optimal yield of discrete colonies in both monomicrobial and polymicrobial samples to perform identification and antibiotic susceptibility testing. Consequently, we compared the performance between the InoqulA (BD Kiestra), the WASP (Copan), and manual inoculation methods. Defined mono- and polymicrobial samples of 4 bacterial species and cloudy urine specimens were inoculated on chromogenic agar by the InoqulA, the WASP, and manual methods. Images taken with ImagA (BD Kiestra) were analyzed with the VisionLab version 3.43 image analysis software to assess the quality of growth and to prevent subjective interpretation of the data. A 3- to 10-fold higher yield of discrete colonies was observed following automated inoculation with both the InoqulA and WASP systems than that with manual inoculation. The difference in performance between automated and manual inoculation was mainly observed at concentrations of >106 bacteria/ml. Inoculation with the InoqulA system allowed us to obtain significantly more discrete colonies than the WASP system at concentrations of >107 bacteria/ml. However, the level of difference observed was bacterial species dependent. Discrete colonies of bacteria present in 100- to 1,000-fold lower concentrations than the most concentrated populations in defined polymicrobial samples were not reproducibly recovered, even with the automated systems. The analysis of cloudy urine specimens showed that InoqulA inoculation provided a statistically significantly higher number of discrete colonies than that with WASP and manual inoculation. Consequently, the automated InoqulA inoculation greatly decreased the requirement for bacterial subculture and thus resulted in a significant reduction in the time to results, laboratory workload, and laboratory costs. PMID:25972424
Trapping social wasps (Hymenoptera: Vespidae) with acetic acid and saturated short chain alcohols.
Landolt, P J; Smithhisler, C S; Reed, H C; McDonough, L M
2000-12-01
Nineteen compounds were evaluated in combination with a solution of acetic acid as baits for trapping the German yellowjacket, Vespula germanica (F.), the western yellowjacket Vespula pensylvanica (Sausssure), and the golden paper wasp Polistes aurifer Saussure. Compounds with three to six carbon chains or branched chains and with a hydroxy functional group were selected for testing based on their similarity to isobutanol. They were compared with isobutanol with acetic acid, which is a known wasp attractant. None of the compounds tested were superior to isobutanol when presented with acetic acid as a lure for these species of wasps. However, traps baited with either the S-(-)- or the racemic mixture of 2-methyl-1-butanol in combination with acetic acid captured similar numbers of both species of yellowjackets, compared with isobutanol with acetic acid. Polistes aurifer responded strongly to the S-(-)-enantiomer and to the racemic mixture of 2-methyl-1-butanol with acetic acid and not to the R-(+)-enantiomer with acetic acid.
Nest Architectural Patterns by Three Wasp Species ( and with Reference to Their Behavior
Directory of Open Access Journals (Sweden)
Farzana Perveen
2013-01-01
Full Text Available In the present study, the nest architectural patterns, elemental analysis and their behavior were carried out in three wasp species: Vespa velutina (Lepeletier, Polistes flavus (Cresson and Sceliphron formosum (Smith from the different localities of the Mansehra, Pakistan. The V. velutina nest was completely closed except for one opening for entry or exit with 1–10 layers of hexagonal cells inside the nest. The nests of P. flavus were found among bunches of leaves of trees with 1–5 layers and hexagonal cells same as in V. velutina. Nests of the S. formosum were pitcher-shaped, found in muddy places, and consisted of 1–10 cells. Social behavior of wasps showed strong foraging, defensive behaviors, pseudo-attack, subsequent erratic flight, wing buzzing, mandibular pecking, abdominal pumping and abdominal twisting with highly developed parental care. It was concluded that the behaviors of these 3 wasp species was highly developed as compared with other insects.
Distributional record of oak gall wasp (Hymenoptera: Cynipidae ...
African Journals Online (AJOL)
In this survey, oak gall wasp species were collected from the oak forests of Pardanan, Mirabad, Nalas, Sardasht, Hamran and Dar-ghabr in West-Azerbaijan province. The galls occurring on 50 cm sampled branches from four cardinal directions on each tree were counted multiple times throughout the season. Species ...
Sasakawa, Kôji; Uchijima, Kenta; Shibao, Harunobu; Shimada, Masakazu
2013-02-01
Many parasitoid wasps learn host-associated cues and use them in subsequent host-searching behavior. This associative learning, namely "oviposition learning," has been investigated in many studies. However, few studies have compared multiple species, and no comparative study has previously been conducted on ectoparasitoid species. We compared the effects of oviposition learning on host preference and offspring sex ratio in two closely related ectoparasitoid wasps with contrasting reproductive strategies, Anisopteromalus calandrae (r-strategist) and its sibling species (K-strategist). Using two bruchine hosts, Callosobruchus chinensis and Callosobruchus maculatus larvae infesting the cowpea Vigna unguiculata, oviposition choice experiments were performed at high and low host densities. In both species, no conspicuous effect on the offspring sex ratio was detected, but effects on host preference were found to differ between the species. In A. calandrae, the effects were detected only at high host density, suggesting that oviposition learning plays a role in host discrimination from a short distance but not from a long distance. In the sibling species, those effects were not detected in any of the cases, suggesting the absence of oviposition learning. These results are compatible with those of previous comparative studies of endoparasitoid wasps in that few lifetime oviposition experiences and/or low reward per foraging decision result in low or absent oviposition learning ability. This finding may indicate that ecological traits contributing to learning ability are similar between endoparasitoid and ectoparasitoid wasps. Thus, our species comparison of ectoparasitoids provides another model system for investigating learning and memory dynamics in parasitoid wasps.
Pereira, Ana Julia; Pirk, Gabriela I.; Corley, Juan C.
2016-01-01
Vespula vulgaris is an invasive scavenging social wasp that has very recently arrived in Patagonia (Argentina), a territory previously invaded ? 35 yrs earlier ? by another wasp, Vespula germanica. Although V. vulgaris wasps possess features that could be instrumental in overcoming obstacles through several invasion stages, the presence of preestablished populations of V. germanica could affect their success. We studied the potential role played by V. germanica on the subsequent invasion proc...
Practices to manage chestnut orchards infested by the Chinese gall wasp
Directory of Open Access Journals (Sweden)
Turchetti T
2012-10-01
Full Text Available The rapid spread of the Chinese gall wasp (Dryocosmus kuriphilus Yasumatsu in Italian chestnut growing areas is causing new criticisms. In this context, in addition to a clear plant suffering due to the wasp infestation, the dangerous recurrence of chestnut blight and the sudden spread of Gnomoniopsis sp., a coloniser of galls but also the etiological agent of nut brown rot, must be considered. Therefore, it is very important to increase the plants’ vigour and prevent their decline. Preliminary experiments were carried out in different Italian regions between 2010 and 2011. Organic plant fertilizers were applied to plants showing middle or high defoliation levels caused by the wasp attacks. The observations carried out during the growing season indicate a good vegetative restart in the treated plants compared to the untreated controls, in all the situations and independently of the fertilizers applied. Most of the treated plants (between the 75% and the 100% showed an evident improvement in the canopy vegetation, while the untreated controls were always classified in the worse classes of crown condition. These preliminary results highlight the efficacy of this kind of treatments for infested chestnut stands. This strategy, which is based on the preliminary evaluation of the plant vigour (following the proposed scale of attack severity and lack of foliage, consists in a manuring treatment at vegetative restart, which can be repeated in the following years in dependence on the results obtained. Moreover, pruning may be suggested only to manage the development of plants showing a definite recovery. The gall wasp pullulation requires new management strategies aimed at preserving the chestnut orchards, in order to avoid the chestnut cultivation to be marginalized or abandoned.
Kjellberg, Finn; Suleman, Nazia; Raja, Shazia; Tayou, Abelouahad; Hossaert-McKey, Martine; Compton, Stephen G.
2014-05-01
The nursery pollination system of fig trees (Ficus) results in the plants providing resources for pollinator fig wasp larvae as part of their male reproductive investment, with selection determining relative investment into pollinating wasps and the pollen they carry. The small size of Ficus pollen suggests that the quantities of pollen transported by individual wasps often limits male reproductive success. We assessed variation in fig wasp pollen loads and its influence on seed production in actively pollinated (Ficus montana) and passively pollinated (Ficus carica) dioecious fig trees.
The Optical Transmission Spectrum of the Inflated Hot Jupiter WASP-94Ab
Berta-Thompson, Zachory; Diamond-Lowe, Hannah; Osip, David; McDonald, Michael; Triaud, Amaury; Hellier, Coel; Gillon, Michael; Delrez, Laetitia; Queloz, Didier; Neveu-VanMalle, Marion; Demory, Brice-Olivier
2018-01-01
Exoplaneteers study the color of sunset on other planets, by measuring the wavelength-dependence of the fraction of starlight transmitted through the planets' atmospheres during transit. These transmission spectroscopy observations can reveal the molecular composition and aerosol distribution along the planet's day-night terminator. Here, we present new observations of the transmission spectrum of WASP-94Ab, an inflated hot Jupiter in a 3.95 day orbit around a bright 6200K, V=10.1 dwarf star. The star is in a visual binary with a nearly identical star (6100K, V=10.5) located 15" away. We observed three transits of WASP-94Ab with the Magellan/LDSS3C multiobject spectrograph, taking advantage of the nearby companion to correct for temporal variations in Earth's telluric spectrum. Thanks to the Magellan Clay telescope's large 6.5m aperture and WASP-94Ab's low surface gravity, we achieve a spectrophotometric precision (in units of atmospheric scale heights) that rivals Hubble/STIS spectroscopy of the famous and much brighter hot Jupiter system HD209458b. We highlight the valuable role ground-based telescopes can play for exoplanetary characterization in the TESS era.
Directory of Open Access Journals (Sweden)
Cuihong Xie
Full Text Available BACKGROUND: Massive wasp stings have been greatly underestimated and have not been systematically studied. The aim of this study was to identify the clinical features and treatment strategies of severe wasp stings. METHODS AND FINDINGS: A multicenter retrospective study was undertaken in 35 hospitals and medical centers including 12 tertiary care hospitals and 23 secondary care hospitals in the Hubei Province, China. The detailed clinical data of 1091 hospitalized wasp sting patients were investigated. Over three-fourths (76.9% of the cases had 10 or more stings and the in-hospital mortality of patients was 5.1%. Forty-eight patients died of organ injury following toxic reactions to the stings, whereas six died from anaphylactic shock. The in-hospital mortality in patients with >10 stings was higher than that of ≤10 stings (5.2% vs. 1.0%, p = 0.02. Acute kidney injury (AKI was seen in 21.0% patients and most patients required blood purification therapy. Rhabdomyolysis was seen in 24.1% patients, hemolysis in 19.2% patients, liver injury in 30.1% patients, and coagulopathy in 22.5% patients. Regression analysis revealed that high creatinine level, shock, oliguria, and anemia were risk factors for death. Blood purification therapy was beneficial for patients with ≥20 stings and delayed hospital admission of patients (≥4 hours after sting. CONCLUSIONS: In China, most patients with multiple wasp stings presented with toxic reactions and multiple organ dysfunction caused by the venom rather than an anaphylactic reaction. AKI is the prominent clinical manifestation of wasp stings with toxic reaction. High creatinine levels, shock, oliguria, and anemia were risk factors for death.
WAsP for offshore sites in confined coastal waters - the influence of the sea fetch
Energy Technology Data Exchange (ETDEWEB)
Lange, B [Risoe National Lab., Roskilde (Denmark); Hoejstrup, J [NEG Micon, Randers (Denmark)
1999-03-01
The increasing interest in harvesting wind energy offshore requires reliable tools for the wind resource estimation at these sites. Most commonly used for wind resource predictions on land as well as offshore is the WAsP program. This program has been validated extensively for sites on land and at the coast. However, due to the lack of suitable measurements there is still a need for further validation for offshore sites. New data from ongoing measurements in the Danish Baltic Sea region are available now. The wind resources estimated from these measurements are compared to WAsP-predictions. They are found to agree well. The only deviation found is for two sites with comparable distance to the coast but with a different distribution of land. Here the measurements show slightly different wind resources which are not predicted by WAsP. Wind speed ratios of several pairs of stations are modelled with WAsP for 12 directional sectors and compared with the measurements. Deviations in the directional wind speed predictions were found to be dependent on the corresponding sea fetches: For smaller sea fetches WAsP seems to slightly overpredict the wind speed, while for long fetches of more than 30 km an underprediction is found. (au)
Directory of Open Access Journals (Sweden)
Gaelen R Burke
Full Text Available Insect parasitoids must complete part of their life cycle within or on another insect, ultimately resulting in the death of the host insect. One group of parasitoid wasps, the 'microgastroid complex' (Hymenoptera: Braconidae, engage in an association with beneficial symbiotic viruses that are essential for successful parasitism of hosts. These viruses, known as Bracoviruses, persist in an integrated form in the wasp genome, and activate to replicate in wasp ovaries during development to ultimately be delivered into host insects during parasitism. The lethal nature of host-parasitoid interactions, combined with the involvement of viruses in mediating these interactions, has led to the hypothesis that Bracoviruses are engaged in an arms race with hosts, resulting in recurrent adaptation in viral (and host genes. Deep sequencing was employed to characterize sequence variation across the encapsidated Bracovirus genome within laboratory and field populations of the parasitoid wasp species Microplitis demolitor. Contrary to expectations, there was a paucity of evidence for positive directional selection among virulence genes, which generally exhibited signatures of purifying selection. These data suggest that the dynamics of host-parasite interactions may not result in recurrent rounds of adaptation, and that adaptation may be more variable in time than previously expected.
Kin discrimination and sex ratios in a parasitoid wasp
Reece, S.E.; Shuker, D.M.; Pen, I.R.; Duncan, A.B.; Choudhary, A.; Batchelor, C.M.; West, S.A.
Sex ratio theory provides a clear and simple way to test if nonsocial haplodiploid wasps can discriminate between kin and nonkin. Specifically, if females can discriminate siblings from nonrelatives, then they are expected to produce a higher proportion of daughters if they mate with a sibling. This
Venom gland components of the ectoparasitoid wasp, Anisopteromalus calandrae
The wasp Anisopteromalus calandrae is a small ectoparasitoid that attacks stored product pest beetle larvae that develop inside grain kernels, and is thus a potential insect control tool. The components of the venom have not been studied, but venom peptides from other organisms have been identified ...
Directory of Open Access Journals (Sweden)
Xiao Jinhua
2009-02-01
Full Text Available Abstract Background The interactions of fig wasps and their host figs provide a model for investigating co-evolution. Fig wasps have specialized morphological characters and lifestyles thought to be adaptations to living in the fig's syconium. Although these aspects of natural history are well documented, the genetic mechanism(s underlying these changes remain(s unknown. Fig wasp olfaction is the key to host-specificity. The Or83b gene class, an unusual member of olfactory receptor family, plays a critical role in enabling the function of conventional olfactory receptors. Four Or83b orthologous genes from one pollinator (PFW (Ceratosolen solmsi and three non-pollinator fig wasps (NPFWs (Apocrypta bakeri, Philotrypesis pilosa and Philotrypesis sp. associated with one species of fig (Ficus hispida can be used to better understand the molecular mechanism underlying the fig wasp's adaptation to its host. We made a comparison of spatial tissue-specific expression patterns and substitution rates of one orthologous gene in these fig wasps and sought evidence for selection pressures. Results A newly identified Or83b orthologous gene was named Or2. Expressions of Or2 were restricted to the heads of all wingless male fig wasps, which usually live in the dark cavity of a fig throughout their life cycle. However, expressions were widely detected in the antennae, legs and abdomens of all female fig wasps that fly from one fig to another for oviposition, and secondarily pollination. Weak expression was also observed in the thorax of PFWs. Compared with NPFWs, the Or2 gene in C. solmsi had an elevated rate of substitutions and lower codon usage. Analyses using Tajima's D, Fu and Li's D* and F* tests indicated a non-neutral pattern of nucleotide variation in all fig wasps. Unlike in NPFWs, this non-neutral pattern was also observed for synonymous sites of Or2 within PFWs. Conclusion The sex- and species-specific expression patterns of Or2 genes detected beyond
Energy Technology Data Exchange (ETDEWEB)
Kataria, Tiffany; Showman, Adam P. [Department of Planetary Sciences and Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Fortney, Jonathan J.; Line, Michael R. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Stevenson, Kevin B.; Kreidberg, Laura; Bean, Jacob L. [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Désert, Jean-Michel, E-mail: tkataria@astro.ex.ac.uk [CASA, Department of Astrophysical and Planetary Sciences, University of Colorado, Boulder, CO 80309 (United States)
2015-03-10
The hot Jupiter WASP-43b (2 M{sub J}, 1 R{sub J}, T {sub orb} = 19.5 hr) has now joined the ranks of transiting hot Jupiters HD 189733b and HD 209458b as an exoplanet with a large array of observational constraints. Because WASP-43b receives a similar stellar flux as HD 209458b but has a rotation rate four times faster and a higher gravity, studying WASP-43b probes the effect of rotation rate and gravity on the circulation when stellar irradiation is held approximately constant. Here we present three-dimensional (3D) atmospheric circulation models of WASP-43b, exploring the effects of composition, metallicity, and frictional drag. We find that the circulation regime of WASP-43b is not unlike other hot Jupiters, with equatorial superrotation that yields an eastward-shifted hotspot and large day-night temperature variations (∼600 K at photospheric pressures). We then compare our model results to Hubble Space Telescope (HST)/WFC3 spectrophotometric phase curve measurements of WASP-43b from 1.12 to 1.65 μm. Our results show the 5× solar model light curve provides a good match to the data, with a peak flux phase offset and planet/star flux ratio that is similar to observations; however, the model nightside appears to be brighter. Nevertheless, our 5× solar model provides an excellent match to the WFC3 dayside emission spectrum. This is a major success, as the result is a natural outcome of the 3D dynamics with no model tuning. These results demonstrate that 3D circulation models can help interpret exoplanet atmospheric observations, even at high resolution, and highlight the potential for future observations with HST, James Webb Space Telescope, and other next-generation telescopes.
Tibbetts, Elizabeth A; Forrest, Taylor; Vernier, Cassondra; Jinn, Judy; Madagame, Andrew
2015-11-01
Many animals have ornaments that mediate choice and competition in social and sexual contexts. Individuals with elaborate sexual ornaments typically have higher fitness than those with less elaborate ornaments, but less is known about whether socially selected ornaments are associated with fitness. Here, we test the relationship between fitness and facial patterns that are a socially selected signal of fighting ability in Polistes dominula wasps. We found wasps that signal higher fighting ability have larger nests, are more likely to survive harsh winters, and obtain higher dominance rank than wasps that signal lower fighting ability. In comparison, body weight was not associated with fitness. Larger wasps were dominant over smaller wasps, but showed no difference in nest size or survival. Overall, the positive relationship between wasp facial patterns and fitness indicates that receivers can obtain diverse information about a signaler's phenotypic quality by paying attention to socially selected ornaments. Therefore, there are surprisingly strong parallels between the information conveyed by socially and sexually selected signals. Similar fitness relationships in social and sexually selected signals may be one reason it can be difficult to distinguish the role of social versus sexual selection in ornament evolution. © 2015 The Author(s). Evolution © 2015 The Society for the Study of Evolution.
Hendrichs, J; Katsoyannos, B I; Wornoayporn, V; Hendrichs, M A
1994-09-01
Predation is probably the most important male mortality factor in insect species with courtship displays that render males performing them conspicuous targets of predators. Sexually active Mediterranean fruit fly males, Ceratitis capitata (Wied.), aggregate in leks, where they participate in agonistic encounters and engage in visual, acoustic and pheromone-calling displays to attract receptive females. The objective of this study was to assess: a) whether sexually displaying C. capitata males in leks inside host and non-host foliage are subject to predation by the most prominent predators yellow-jacket wasps, Vespula germanica (F.), and if so, b) whether olfactory, visual or auditive stimuli are used by foraging wasps in locating male C. capitata prey. Studies were carried out in a citrus orchard and surroundings on the island of Chios, Greece. Observations were conducted using perforated containers hung within mulberry, fig or citrus foliage. Living C. capitata flies of different sex and either mature or immature were placed inside. Our results show that the yellowjacket wasps have learned to associate the presence of sexually active medfly males aggregated in leks with their prey's pheromone (kairomone). Foraging wasps, flying through the crowns of host trees, responded to the odour source of C. capitata male pheromone by approaching from downwind. Even inside dense citrus tree foliage, wasps keyed in on aggregations of pheromone-calling males using olfactory stimuli. Stimuli of visual and acoustic male signalling were only used at close range, after having followed the pheromone plume close to its source. Visual cues played a greater role in directing wasp foraging under more open and exposed host foliage conditions. Odour-based foraging of wasps inside host foliage in the mid-morning hours, when medfly male lekking activities peak, shifted gradually to a more visual-based host fruit patrolling in the afternoons to capture ovipositing and feeding medfly females
Wang, Zhen-Bo; Ma, Xue-Shan; Hu, Meng-Wen; Jiang, Zong-Zhe; Meng, Tie-Gang; Dong, Ming-Zhe; Fan, Li-Hua; Ouyang, Ying-Chun; Snapper, Scott B; Schatten, Heide; Sun, Qing-Yuan
2016-09-01
There is an unexplored physiological role of N-WASP (neural Wiskott-Aldrich syndrome protein) in oocyte maturation that prevents completion of second meiosis. In mice, N-WASP deletion did not affect oocyte polarity and asymmetric meiotic division in first meiosis, but did impair midbody formation and second meiosis completion. N-WASP regulates actin dynamics and participates in various cell activities through the RHO-GTPase-Arp2/3 (actin-related protein 2/3 complex) pathway, and specifically the Cdc42 (cell division cycle 42)-N-WASP-Arp2/3 pathway. Differences in the functions of Cdc42 have been obtained from in vitro compared to in vivo studies. By conditional knockout of N-WASP in mouse oocytes, we analyzed its in vivo functions by employing a variety of different methods including oocyte culture, immunofluorescent staining and live oocyte imaging. Each experiment was repeated at least three times, and data were analyzed by paired-samples t-test. Oocyte-specific deletion of N-WASP did not affect the process of oocyte maturation including spindle formation, spindle migration, polarity establishment and maintenance, and homologous chromosome or sister chromatid segregation, but caused failure of cytokinesis completion during second meiosis (P meiosis completion and failures in this process that affect oocyte quality. None. This work was supported by the National Basic Research Program of China (No. 2012CB944404) and the National Natural Science Foundation of China (Nos 30930065, 31371451, 31272260 and 31530049). There are no potential conflicts of interests. © The Author 2016. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Herzner Gudrun
2008-01-01
Full Text Available Abstract Background Host-parasite interactions are among the most important biotic relationships. Host species should evolve mechanisms to detect their enemies and employ appropriate counterstrategies. Parasites, in turn, should evolve mechanisms to evade detection and thus maximize their success. Females of the European beewolf (Philanthus triangulum, Hymenoptera, Crabronidae hunt exclusively honeybee workers as food for their progeny. The brood cells containing the paralyzed bees are severely threatened by a highly specialized cuckoo wasp (Hedychrum rutilans, Hymenoptera, Chrysididae. Female cuckoo wasps enter beewolf nests to oviposit on paralyzed bees that are temporarily couched in the nest burrow. The cuckoo wasp larva kills the beewolf larva and feeds on it and the bees. Here, we investigated whether H. rutilans evades detection by its host. Since chemical senses are most important in the dark nest, we hypothesized that the cuckoo wasp might employ chemical camouflage. Results Field observations suggest that cuckoo wasps are attacked by beewolves in front of their nest, most probably after being recognized visually. In contrast, beewolves seem not to detect signs of the presence of these parasitoids neither when these had visited the nest nor when directly encountered in the dark nest burrow. In a recognition bioassay in observation cages, beewolf females responded significantly less frequently to filter paper discs treated with a cuticular extract from H. rutilans females, than to filter paper discs treated with an extract from another cuckoo wasp species (Chrysis viridula. The behavior to paper discs treated with a cuticular extract from H. rutilans females did not differ significantly from the behavior towards filter paper discs treated with the solvent only. We hypothesized that cuckoo wasps either mimic the chemistry of their beewolf host or their host's prey. We tested this hypothesis using GC-MS analyses of the cuticles of male and
WASP: a Web-based Allele-Specific PCR assay designing tool for detecting SNPs and mutations
Directory of Open Access Journals (Sweden)
Assawamakin Anunchai
2007-08-01
Full Text Available Abstract Background Allele-specific (AS Polymerase Chain Reaction is a convenient and inexpensive method for genotyping Single Nucleotide Polymorphisms (SNPs and mutations. It is applied in many recent studies including population genetics, molecular genetics and pharmacogenomics. Using known AS primer design tools to create primers leads to cumbersome process to inexperience users since information about SNP/mutation must be acquired from public databases prior to the design. Furthermore, most of these tools do not offer the mismatch enhancement to designed primers. The available web applications do not provide user-friendly graphical input interface and intuitive visualization of their primer results. Results This work presents a web-based AS primer design application called WASP. This tool can efficiently design AS primers for human SNPs as well as mutations. To assist scientists with collecting necessary information about target polymorphisms, this tool provides a local SNP database containing over 10 million SNPs of various populations from public domain databases, namely NCBI dbSNP, HapMap and JSNP respectively. This database is tightly integrated with the tool so that users can perform the design for existing SNPs without going off the site. To guarantee specificity of AS primers, the proposed system incorporates a primer specificity enhancement technique widely used in experiment protocol. In particular, WASP makes use of different destabilizing effects by introducing one deliberate 'mismatch' at the penultimate (second to last of the 3'-end base of AS primers to improve the resulting AS primers. Furthermore, WASP offers graphical user interface through scalable vector graphic (SVG draw that allow users to select SNPs and graphically visualize designed primers and their conditions. Conclusion WASP offers a tool for designing AS primers for both SNPs and mutations. By integrating the database for known SNPs (using gene ID or rs number
Novel insights into the ontogeny of nestmate recognition in Polistes social wasps.
Signorotti, Lisa; Cappa, Federico; d'Ettorre, Patrizia; Cervo, Rita
2014-01-01
The importance of early experience in animals' life is unquestionable, and imprinting-like phenomena may shape important aspects of behaviour. Early learning typically occurs during a sensitive period, which restricts crucial processes of information storage to a specific developmental phase. The characteristics of the sensitive period have been largely investigated in vertebrates, because of their complexity and plasticity, both in behaviour and neurophysiology, but early learning occurs also in invertebrates. In social insects, early learning appears to influence important social behaviours such as nestmate recognition. Yet, the mechanisms underlying recognition systems are not fully understood. It is currently believed that Polistes social wasps are able to discriminate nestmates from non-nestmates following the perception of olfactory cues present on the paper of their nest, which are learned during a strict sensitive period, immediately after emergence. Here, through differential odour experience experiments, we show that workers of Polistes dominula develop correct nestmate recognition abilities soon after emergence even in absence of what have been so far considered the necessary cues (the chemicals spread on nest paper). P. dominula workers were exposed for the first four days of adult life to paper fragments from their nest, or from a foreign conspecific nest or to a neutral condition. Wasps were then transferred to their original nests where recognition abilities were tested. Our results show that wasps do not alter their recognition ability if exposed only to nest material, or in absence of nest material, during the early phase of adult life. It thus appears that the nest paper is not used as a source of recognition cues to be learned in a specific time window, although we discuss possible alternative explanations. Our study provides a novel perspective for the study of the ontogeny of nestmate recognition in Polistes wasps and in other social insects.
Wiemer, A P; Sérsic, A N; Marino, S; Simões, A O; Cocucci, A A
2012-01-01
BACKGROUND AND AIMS The extreme complexity of asclepiad flowers (Asclepiadoideae-Apocynaceae) has generated particular interest in the pollination biology of this group of plants especially in the mechanisms involved in the pollination processes. This study compares two South American species, Morrenia odorata and Morrenia brachystephana, with respect to morphology and anatomy of flower structures, dynamic aspects of the pollination mechanism, diversity of visitors and effectiveness of pollinators. Floral structure was studied with fresh and fixed flowers following classical techniques. The pollination mechanism was studied by visiting fresh flowers in the laboratory with artificial pollinator body parts created with an eyelash. Morphometric and nectar measurements were also taken. Pollen transfer efficiency in the flowers was calculated by recording the frequency of removed and inserted pollinia. Visitor activity was recorded in the field, and floral visitors were captured for subsequent analysis of pollen loads. Finally, pollinator effectiveness was calculated with an index. The detailed structure of the flowers revealed a complex system of guide rails and chambers precisely arranged in order to achieve effective pollinaria transport. Morrenia odorata is functionally specialized for wasp pollination, and M. brachystephana for wasp and bee pollination. Pollinators transport chains of pollinaria adhered to their mouthparts. Morrenia odorata and M. brachystephana present differences in the morphology and size of their corona, gynostegium and pollinaria, which explain the differences in details of the functioning of the general pollination mechanism. Pollination is performed by different groups of highly effective pollinators. Morrenia species are specialized for pollination mainly by several species of wasps, a specialized pollination which has been poorly studied. In particular, pompilid wasps are reported as important pollinators in other regions outside South
Yin, Chuanlin; Li, Meizhen; Hu, Jian; Lang, Kun; Chen, Qiming; Liu, Jinding; Guo, Dianhao; He, Kang; Dong, Yipei; Luo, Jiapeng; Song, Zhenkun; Walters, James R; Zhang, Wenqing; Li, Fei; Chen, Xuexin
2018-05-30
Parasitoid wasps are well-known natural enemies of major agricultural pests and arthropod borne diseases. The parasitoid wasp Macrocentrus cingulum (Hymenoptera: Braconidae) has been widely used to control the notorious insect pests Ostrinia furnacalis (Asian Corn Borer) and O. nubilalis (European corn borer). One striking phenomenon exhibited by M. cingulum is polyembryony, the formation of multiple genetically identical offspring from a single zygote. Moreover, M. cingulum employs a passive parasitic strategy by preventing the host's immune system from recognizing the embryo as a foreign body. Thus, the embryos evade the host's immune system and are not encapsulated by host hemocytes. Unfortunately, the mechanism of both polyembryony and immune evasion remains largely unknown. We report the genome of the parasitoid wasp M. cingulum. Comparative genomics analysis of M. cingulum and other 11 insects were conducted, finding some gene families with apparent expansion or contraction which might be linked to the parasitic behaviors or polyembryony of M. cingulum. Moreover, we present the evidence that the microRNA miR-14b regulates the polyembryonic development of M. cingulum by targeting the c-Myc Promoter-binding Protein 1 (MBP-1), histone-lysine N-methyltransferase 2E (KMT2E) and segmentation protein Runt. In addition, Hemomucin, an O-glycosylated transmembrane protein, protects the endoparasitoid wasp larvae from being encapsulated by host hemocytes. Motif and domain analysis showed that only the hemomucin in two endoparasitoids, M. cingulum and Venturia canescens, possessing the ability of passive immune evasion has intact mucin domain and similar O-glycosylation patterns, indicating that the hemomucin is a key factor modulating the immune evasion. The microRNA miR-14b participates in the regulation of polyembryonic development, and the O-glycosylation of the mucin domain in the hemomucin confers the passive immune evasion in this wasp. These key findings provide
THE HOMOGENEOUS STUDY OF TRANSITING SYSTEMS (HoSTS). I. THE PILOT STUDY OF WASP-13
Energy Technology Data Exchange (ETDEWEB)
Gomez Maqueo Chew, Yilen; Cargile, Phillip; Hebb, Leslie; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Faedi, Francesca; Pollacco, Don [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom); Doyle, Amanda P.; Smalley, Barry [Astrophysics Group, Keele University, Staffordshire ST5 5BG (United Kingdom); Ghezzi, Luan; Cunha, Katia; Smith, Verne V. [Observatorio Nacional, Rua Gal. Jose Cristino 77, Rio de Janeiro, RJ 20921-400 (Brazil); Sousa, Sergio; Santos, Nuno C. [Centro de Astrofisica, Universidade do Porto, Rua das Estrelas, 4150-762 Porto (Portugal); Barros, Susana C. C. [LAM (Laboratoire d' Astrophysique de Marseille) UMR 7326, Aix Marseille Universite, CNRS, F-13388 Marseille (France); Schuler, Simon C. [Stewart Observatory, University of Arizona, Tucson, AZ 85721 (United States); Collier Cameron, Andrew, E-mail: yilen.gomez@vanderbilt.edu [School of Physics and Astronomy, University of St Andrews, St Andrews, Fife KY16 9SS (United Kingdom)
2013-05-01
We present the fundamental stellar and planetary properties of the transiting planetary system WASP-13 within the framework of the Homogeneous Study of Transiting Systems (HoSTS). HoSTS aims to derive the fundamental stellar (T{sub eff}, [Fe/H], M{sub *}, R{sub *}) and planetary (M{sub pl}, R{sub pl}, T{sub eq}) physical properties of known transiting planets using a consistent methodology and homogeneous high-quality data set. Four spectral analysis techniques are independently applied to a Keck+HIRES spectrum of WASP-13 considering two distinct cases: unconstrained parameters and constrained log g from transit light curves. We check the derived stellar temperature against that from a different temperature diagnostic based on an INT+IDS H{alpha} spectrum. The four unconstrained analyses render results that are in good agreement, and provide an improvement of 50% in the precision of T{sub eff}, and of 85% in [Fe/H] with respect to the WASP-13 discovery paper. The planetary parameters are then derived via the Monte Carlo Markov Chain modeling of the radial velocity and light curves, in iteration with stellar evolutionary models to derive realistic uncertainties. WASP-13 (1.187 {+-} 0.065 M{sub Sun }; 1.574 {+-} 0.048 R{sub Sun }) hosts a Saturn-mass, transiting planet (0.500 {+-} 0.037 M{sub Jup}; 1.407 {+-} 0.052 R{sub Jup}), and is at the end of its main-sequence lifetime (4-5.5 Gyr). Our analysis of WASP-13 showcases that both a detailed stellar characterization and transit modeling are necessary to well determine the fundamental properties of planetary systems, which are paramount in identifying and determining empirical relationships between transiting planets and their hosts.
History and management of sirex wood wasp in Australia
Angus J. Carnegie
2007-01-01
This paper reviews the history and management of Sirex noctilio in Australia, including information from previous reviews as well as more recent data. The sirex wood wasp, Sirex noctilio, is one of the most important insect pests of Pinus radiata in Australia. Native to Europe, North Africa and Turkey, S...
Smid, H.M.; Bleeker, M.A.K.; Loon, van J.J.A.; Vet, L.E.M.
2003-01-01
Two closely related parasitoid wasp species, Cotesia glomerata and C. rubecula, differ in their use of associative learning. To investigate the neural basis underlying these differences, it is necessary to describe the olfactory pathway of both wasp species. This paper focuses on the organization of
Sugary secretions of wasp galls: a want-to-be extrafloral nectar?
Aranda-Rickert, Adriana; Rothen, Carolina; Diez, Patricia; González, Ana María; Marazzi, Brigitte
2017-11-10
The most widespread form of protective mutualisms is represented by plants bearing extrafloral nectaries (EFNs) that attract ants and other arthropods for indirect defence. Another, but less common, form of sugary secretion for indirect defence occurs in galls induced by cynipid wasps. Until now, such galls have been reported only for cynipid wasps that infest oak trees in the northern hemisphere. This study provides the first evidence of galls that exude sugary secretions in the southern hemisphere and asks whether they can be considered as analogues of plants' EFNs. The ecology and anatomy of galls and the chemical composition of the secretion were investigated in north-western Argentina, in natural populations of the host trees Prosopis chilensis and P. flexuosa . To examine whether ants protect the galls from natural enemies, ant exclusion experiments were conducted in the field. The galls produce large amounts of sucrose-rich, nectar-like secretions. No typical nectary and sub-nectary parenchymatic tissues or secretory trichomes can be observed; instead there is a dense vascularization with phloem elements reaching the gall periphery. At least six species of ants, but also vespid wasps, Diptera and Coleoptera, consumed the gall secretions. The ant exclusion experiment showed that when ants tended galls, no differences were found in the rate of successful emergence of gall wasps or in the rate of parasitism and inquiline infestation compared with ant-excluded galls. The gall sugary secretion is not analogous to extrafloral nectar because no nectar-producing structure is associated with it, but is functionally equivalent to arthropod honeydew because it provides indirect defence to the plant parasite. As in other facultative mutualisms mediated by sugary secretions, the gall secretion triggers a complex multispecies interaction, in which the outcome of individual pair-wise interactions depends on the ecological context in which they take place. © The Author
Photosynthesis and sink activity of wasp-induced galls in Acacia pycnantha.
Dorchin, Netta; Cramer, Michael D; Hoffmann, John H
2006-07-01
Although insect galls are widely known to influence source-sink relationships in plants, the relationship between photosynthesis and gall activity has not been extensively studied. In this study we used 14CO2, photosynthesis, and respiration measurements to examine the capacity of bud galls induced by the wasp Trichilogaster signiventris (Pteromalidae) as carbon sinks in Acacia pycnantha. Galls of this species develop either in vegetative or reproductive buds, depending on the availability of tissues at different times of the year, and effectively eliminate seed production by the plant. Photosynthetic rates in phyllodes subtending clusters of galls were greater than rates in control phyllodes, a result we attributed to photosynthesis compensating for increased carbon demand by the galls. Contrary to previous studies, we found that photosynthesis within galls contributed substantially to the carbon budgets of the galls, particularly in large, mature galls, which exhibited lower specific respiration rates allowing for a net carbon gain in the light. To determine the sink capacity and competitive potential of galls, we measured the proportion of specific radioactivity in galls originating from either vegetative or reproductive buds and found no difference between them. The proportion of the total amount of phyllode-derived 14C accumulated in both clustered and solitary galls was less than that in fruits. Galls and fruits were predominantly reliant on subtending rather than on distant phyllodes for photosynthate. Solitary galls that developed in vegetative buds constituted considerably stronger sinks than galls in clusters on inflorescences where there was competition between galls or fruits for resources from the subtending phyllode. Wasps developing in solitary vegetative galls were correspondingly significantly larger than those from clustered galls. We conclude that, in the absence of inflorescence buds during summer and fall, the ability of the wasps to cause gall
Primary cutaneous nocardiosis caused by Nocardia brasiliensis following a wasp sting.
Chu, L; Xu, X; Ran, Y
2017-04-10
We report a case of an 87-year-old woman who presented with painful erythema of her right forearm 10 days after she had been stung by a wasp on her right hand. The lesion had rapidly deteriorated during the week before presentation, and treatment with antibiotics and glucocorticoids did not improve the condition. After careful evaluation, we performed cultures from the lesion aspiration, and morphological and genetic analysis of bacteria cultures confirmed a bacterial infection with Nocardia brasiliensis. The patient recovered after 3 weeks. Primary cutaneous nocardiosis due to Nocardia spp. is relatively uncommon in clinics, but it was the distance of the lesions from the affected area of the wasp sting that has made this an even rarer case and of interest to report. © 2017 British Association of Dermatologists.
Temporal polyethism and worker specialization in the wasp, Vespula germanica.
Hurd, Christine R; Jeanne, Robert L; Nordheim, Erik V
2007-01-01
Temporal polyethism is a common mechanism of worker specialization observed in social insect species with large colony sizes, Vespula wasp colonies consist of thousands of monomorphic workers, yet studies based on small cohorts of workers report that temporal polyethism is either weak or completely absent in different Vespula species. Concerned that the small sample size of these studies precluded detection of temporal polyethism, several hundred, known-age Vespula germanica (F.) (Hymenoptera: Vespidae) workers were studied. High variability was found in the sequence and diversity of tasks workers perform, suggesting that V. germanica colonies exhibit weak temporal polyethism. The most common order in which tasks were taken up was 1) nest work, 2) pulp foraging, 3) carbohydrate foraging, and 4) protein foraging. However, only 61% of the wasps performed more than two of the tasks during their lives. Thorax size had a significant negative effect on the age at first foraging, but the magnitude of the effect was small. The daily ratio of task generalists to specialists was relatively constant despite the high turnover of workers, growth of the colony, and the colony's transition from rearing worker larvae to rearing reproductives. Over the course of their lives, 43% of the workers averaged more than one kind of task performed per day. Life history traits are identified that may explain why vespines with large colonies use a generalist strategy of labor division rather than the specialist strategy observed in honey bees (Apis mellifera) and large colonies of wasps (Polybia occidentalis).
Revisiting the Energy Budget of WASP-43b: Enhanced Day–Night Heat Transport
Energy Technology Data Exchange (ETDEWEB)
Keating, Dylan; Cowan, Nicolas B. [Department of Physics, McGill University, 3600 rue University, Montréal, QC H3A 2T8 (Canada)
2017-11-01
The large day–night temperature contrast of WASP-43b has so far eluded explanation. We revisit the energy budget of this planet by considering the impact of reflected light on dayside measurements and the physicality of implied nightside temperatures. Previous analyses of the infrared eclipses of WASP-43b have assumed reflected light from the planet is negligible and can be ignored. We develop a phenomenological eclipse model including reflected light, thermal emission, and water absorption, and we use it to fit published Hubble and Spitzer eclipse data. We infer a near-infrared geometric albedo of 24% ± 1% and a cooler dayside temperature of 1483 ± 10 K. Additionally, we perform light curve inversion on the three published orbital phase curves of WASP-43b and find that each suggests unphysical, negative flux on the nightside. By requiring non-negative brightnesses at all longitudes, we correct the unphysical parts of the maps and obtain a much hotter nightside effective temperature of 1076 ± 11 K. The cooler dayside and hotter nightside suggest a heat recirculation efficiency of 51% for WASP-43b, essentially the same as for HD 209458b, another hot Jupiter with nearly the same temperature. Our analysis therefore reaffirms the trend that planets with lower irradiation temperatures have more efficient day–night heat transport. Moreover, we note that (1) reflected light may be significant for many near-IR eclipse measurements of hot Jupiters, and (2) phase curves should be fit with physically possible longitudinal brightness profiles—it is insufficient to only require that the disk-integrated light curve be non-negative.
The Water Quality Analysis Simulation Program (WASP) is a dynamic, spatially-resolved, differential mass balance fate and transport modeling framework. WASP is used to develop models to simulate concentrations of environmental contaminants in surface waters and sediments. As a mo...
WASP as a planning tool of electrical generation systems expansion
International Nuclear Information System (INIS)
D'Isidoro, G.
1984-01-01
The ''Wien Automatic System Package'' (WASP), consists of six modules or computer programmes which assist in decision taking process in expanding an electrical generation network. A general description of this model is made and some conclusions are drawn from the data processed to this date
Wasp sting induced STEMI with complete coronary artery occlusion: a case of Kounis syndrome.
Cross, Benjamin; Choudhury, Tawfiqur Rahman; Hindle, Mark; Galasko, Gavin
2017-09-07
A 45-year-old previously healthy man with minimal coronary artery disease on imaging presented with an acute MI after sustaining a wasp sting following previous non-eventful exposures throughout his life. This is the first case of Kounis syndrome with optical coherence tomography imaging and proven IgE wasp venom hypersensitivity. The Hymenoptera venom is composed of allergenic proteins and vasoactive amines which are responsible for venom toxicity. This patient also has a history of atopy giving a predisposition for developing IgE-mediated allergic reactions. Hymenoptera stings can be severe in atopic individuals and anaphylaxis may ensue. However, it is a rare cause of myocardial infarction (MI) (Kounis syndrome). Multiple wasp stings in the past may have contributed to sensitisation. Kounis syndrome is a rare clinical manifestation which should remain in the minds of physicians, especially with younger patients with no history of ischaemic heart disease or few risk factors. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Description and Flight Performance Results of the WASP Sounding Rocket
De Pauw, J. F.; Steffens, L. E.; Yuska, J. A.
1968-01-01
A general description of the design and construction of the WASP sounding rocket and of the performance of its first flight are presented. The purpose of the flight test was to place the 862-pound (391-kg) spacecraft above 250 000 feet (76.25 km) on free-fall trajectory for at least 6 minutes in order to study the effect of "weightlessness" on a slosh dynamics experiment. The WASP sounding rocket fulfilled its intended mission requirements. The sounding rocket approximately followed a nominal trajectory. The payload was in free fall above 250 000 feet (76.25 km) for 6.5 minutes and reached an apogee altitude of 134 nautical miles (248 km). Flight data including velocity, altitude, acceleration, roll rate, and angle of attack are discussed and compared to nominal performance calculations. The effect of residual burning of the second stage motor is analyzed. The flight vibration environment is presented and analyzed, including root mean square (RMS) and power spectral density analysis.
Directory of Open Access Journals (Sweden)
Philip J Lester
Full Text Available When invasive species move to new environments they typically experience population bottlenecks that limit the probability that pathogens and parasites are also moved. The invasive species may thus be released from biotic interactions that can be a major source of density-dependent mortality, referred to as enemy release. We examined for evidence of enemy release in populations of the common wasp (Vespula vulgaris, which attains high densities and represents a major threat to biodiversity in its invaded range. Mass spectrometry proteomic methods were used to compare the microbial communities in wasp populations in the native (Belgium and England and invaded range (Argentina and New Zealand. We found no evidence of enemy release, as the number of microbial taxa was similar in both the introduced and native range. However, some evidence of distinctiveness in the microbial communities was observed between countries. The pathogens observed were similar to a variety of taxa observed in honey bees. These taxa included Nosema, Paenibacillus, and Yersina spp. Genomic methods confirmed a diversity of Nosema spp., Actinobacteria, and the Deformed wing and Kashmir bee viruses. We also analysed published records of bacteria, viruses, nematodes and fungi from both V. vulgaris and the related invader V. germanica. Thirty-three different microorganism taxa have been associated with wasps including Kashmir bee virus and entomophagous fungi such as Aspergillus flavus. There was no evidence that the presence or absence of these microorganisms was dependent on region of wasp samples (i.e. their native or invaded range. Given the similarity of the wasp pathogen fauna to that from honey bees, the lack of enemy release in wasp populations is probably related to spill-over or spill-back from bees and other social insects. Social insects appear to form a reservoir of generalist parasites and pathogens, which makes the management of wasp and bee disease difficult.
Lester, Philip J; Bosch, Peter J; Gruber, Monica A M; Kapp, Eugene A; Peng, Lifeng; Brenton-Rule, Evan C; Buchanan, Joe; Stanislawek, Wlodek L; Archer, Michael; Corley, Juan C; Masciocchi, Maitè; Van Oystaeyen, Annette; Wenseleers, Tom
2015-01-01
When invasive species move to new environments they typically experience population bottlenecks that limit the probability that pathogens and parasites are also moved. The invasive species may thus be released from biotic interactions that can be a major source of density-dependent mortality, referred to as enemy release. We examined for evidence of enemy release in populations of the common wasp (Vespula vulgaris), which attains high densities and represents a major threat to biodiversity in its invaded range. Mass spectrometry proteomic methods were used to compare the microbial communities in wasp populations in the native (Belgium and England) and invaded range (Argentina and New Zealand). We found no evidence of enemy release, as the number of microbial taxa was similar in both the introduced and native range. However, some evidence of distinctiveness in the microbial communities was observed between countries. The pathogens observed were similar to a variety of taxa observed in honey bees. These taxa included Nosema, Paenibacillus, and Yersina spp. Genomic methods confirmed a diversity of Nosema spp., Actinobacteria, and the Deformed wing and Kashmir bee viruses. We also analysed published records of bacteria, viruses, nematodes and fungi from both V. vulgaris and the related invader V. germanica. Thirty-three different microorganism taxa have been associated with wasps including Kashmir bee virus and entomophagous fungi such as Aspergillus flavus. There was no evidence that the presence or absence of these microorganisms was dependent on region of wasp samples (i.e. their native or invaded range). Given the similarity of the wasp pathogen fauna to that from honey bees, the lack of enemy release in wasp populations is probably related to spill-over or spill-back from bees and other social insects. Social insects appear to form a reservoir of generalist parasites and pathogens, which makes the management of wasp and bee disease difficult.
Pereira, Ana Julia; Pirk, Gabriela I; Corley, Juan C
2016-01-01
Vespula vulgaris is an invasive scavenging social wasp that has very recently arrived in Patagonia (Argentina), a territory previously invaded - 35 yrs earlier - by another wasp, Vespula germanica Although V. vulgaris wasps possess features that could be instrumental in overcoming obstacles through several invasion stages, the presence of preestablished populations of V. germanica could affect their success. We studied the potential role played by V. germanica on the subsequent invasion process of V. vulgaris wasps in Patagonia by focusing on the foraging interaction between both species. This is because food searching and exploitation are likely to overlap strongly among Vespula wasps. We carried out choice tests where two types of baits were presented in a pairwise manner. We found experimental evidence supporting the hypothesis that V. germanica and V. vulgaris have an asymmetrical response to baits with stimuli simulating the presence of each other. V. germanica avoided baits with either visual or olfactory cues indicating the V. vulgaris presence. However, V. vulgaris showed no preference between baits with or lacking V. germanica stimuli. These results suggest that the presence of an established population of V. germanica may not contribute to added biotic resistance to V. vulgaris invasion. © The Author 2016. Published by Oxford University Press on behalf of the Entomological Society of America.
Kilpatrick, Brian; Cubillos, Patricio; Bruno, Giovanni; Lewis, Nikole K.; Stevenson, Kevin B.; Wakeford, Hannah; Blecic, Jasmina; Burrows, Adam Seth; Deming, Drake; Heng, Kevin; Line, Michael R.; Madhusudhan, Nikku; Morley, Caroline; Waldmann, Ingo P.; Transiting Exoplanet Early Release Science Community
2017-06-01
We present observations of the Hubble Space Telescope (HST) ``A Preparatory Program to Identify the Single Best Transiting Exoplanet for JWST Early Release Science" for WASP-63b, one of the community targets proposed for the James Webb Space Telescope (JWST) Early Release Science (ERS) program. A large collaboration of transiting exoplanet scientists identified a set of ``community targets" which meet a certain set of criteria for ecliptic latitude, period, host star brightness, well constrained orbital parameters, and strength of spectroscopic features. WASP-63b was one of the targets identified as a potential candidate for the ERS program. It is presented as an inflated planet with a large signal. It will be accessible to JWST approximately six months after the planned start of Cycle 1/ERS in April 2019 making it an ideal candidate should there be any delays in the JWST timetable. Here, we observe WASP-63b to evaluate its suitability as the best target to test the capabilities of JWST. Ideally, a clear atmosphere will be best suited for bench marking the instruments ability to detect spectroscopic features. We can use the strength of the water absorption feature at 1.4 μm as a way to determine the presence of obscuring clouds/hazes. The results of atmospheric retrieval are presented along with a discussion on the suitability of WASP-63b as the best target to be observed during the ERS Program.
Variation in the diversity and richness of parasitoid wasps based on sampling effort.
Saunders, Thomas E; Ward, Darren F
2018-01-01
Parasitoid wasps are a mega-diverse, ecologically dominant, but poorly studied component of global biodiversity. In order to maximise the efficiency and reduce the cost of their collection, the application of optimal sampling techniques is necessary. Two sites in Auckland, New Zealand were sampled intensively to determine the relationship between sampling effort and observed species richness of parasitoid wasps from the family Ichneumonidae. Twenty traps were deployed at each site at three different times over the austral summer period, resulting in a total sampling effort of 840 Malaise-trap-days. Rarefaction techniques and non-parametric estimators were used to predict species richness and to evaluate the variation and completeness of sampling. Despite an intensive Malaise-trapping regime over the summer period, no asymptote of species richness was reached. At best, sampling captured two-thirds of parasitoid wasp species present. The estimated total number of species present depended on the month of sampling and the statistical estimator used. Consequently, the use of fewer traps would have caught only a small proportion of all species (one trap 7-21%; two traps 13-32%), and many traps contributed little to the overall number of individuals caught. However, variation in the catch of individual Malaise traps was not explained by seasonal turnover of species, vegetation or environmental conditions surrounding the trap, or distance of traps to one another. Overall the results demonstrate that even with an intense sampling effort the community is incompletely sampled. The use of only a few traps and/or for very short periods severely limits the estimates of richness because (i) fewer individuals are caught leading to a greater number of singletons; and (ii) the considerable variation of individual traps means some traps will contribute few or no individuals. Understanding how sampling effort affects the richness and diversity of parasitoid wasps is a useful
Wind profile modelling using WAsP and "tall" wind measurements
DEFF Research Database (Denmark)
Floors, Rogier Ralph; Kelly, Mark C.; Troen, Ib
2015-01-01
extrapolations (the wind profile) this is done using the Weibull distribution and the geostrophic drag law. Wind lidar measurements obtained during the ’Tall wind’ campaign at three different sites are used to evaluate the assumptions and equations that are used in the WAsP vertical extrapolation strategy...
Essential oils and their compositions as spatial repellents for pestiferous social wasps.
Zhang, Qing-He; Schneidmiller, Rodney G; Hoover, Doreen R
2013-04-01
The study objectives were: (1) to field test potential repellency of common essential oils against several pestiferous social wasps (Hymenoptera: Vespidae), using attractant-baited traps; (2) to identify vespid antennally active compounds from the repellent essential oils; (3) to determine potential repellency of these electroantennographic detection (EAD) active compounds in the field. Of the 21 essential oils tested, 17 showed significant repellency on yellowjackets [mainly Vespula pensylvanica (Saussure)] and paper wasps [mainly Polistes dominulus (Christ)]: clove, pennyroyal, lemongrass, ylang ylang, spearmint, wintergreen, sage, rosemary, lavender, geranium, patchouli, citronella, Roman chamomile, thyme, fennel seed, anise and peppermint. Two essential oil mixtures - 3EO-mix (clove, geranium and lemongrass) and 4EO-mix (clove, geranium, lemongrass and rosemary) - totally blocked the attraction of vespid workers. Twenty-nine vespid antennally active compounds were identified from solid-phase microextraction (SPME) samples of 11 strongly repellent essential oils by GC-EAD/MS techniques. Among the synthetic EAD-active compounds field tested, eugenol, P/I-menthone, pulegone, α/β-thujone, l-carvone, E/Z-citral, citronellal, methyl benzoate, benzyl acetate, methyl salicylate and 3-octanol showed a significant repellency on vespid workers. These compounds are likely responsible for the repellency of their corresponding essential oils. These repellent essential oils and their active compositions have great potential for efficient, environmentally sound semiochemical-based IPM of pestiferous vespid wasps. © 2012 Society of Chemical Industry.
Spitzer observations of the thermal emission from WASP-43b
Energy Technology Data Exchange (ETDEWEB)
Blecic, Jasmina; Harrington, Joseph; Stevenson, Kevin B.; Hardy, Ryan A.; Cubillos, Patricio E.; Hardin, Matthew; Bowman, Oliver; Nymeyer, Sarah [Planetary Sciences Group, Department of Physics, University of Central Florida, Orlando, FL 32816-2385 (United States); Madhusudhan, Nikku [Department of Physics and Department of Astronomy, Yale University, New Haven, CT 06511 (United States); Anderson, David R.; Hellier, Coel; Smith, Alexis M. S. [Astrophysics Group, Keele University, Keele, Staffordshire ST5 5BG (United Kingdom); Cameron, Andrew Collier, E-mail: jasmina@physics.ucf.edu [SUPA, School of Physics and Astronomy, University of St. Andrews, North Haugh, St. Andrews, Fife KY16 9SS (United Kingdom)
2014-02-01
WASP-43b is one of the closest-orbiting hot Jupiters, with a semimajor axis of a = 0.01526 ± 0.00018 AU and a period of only 0.81 days. However, it orbits one of the coolest stars with a hot Jupiter (T {sub *} = 4520 ± 120 K), giving the planet a modest equilibrium temperature of T {sub eq} = 1440 ± 40 K, assuming zero Bond albedo and uniform planetary energy redistribution. The eclipse depths and brightness temperatures from our jointly fit model are 0.347% ± 0.013% and 1670 ± 23 K at 3.6 μm and 0.382% ± 0.015% and 1514 ± 25 K at 4.5 μm. The eclipse timings improved the estimate of the orbital period, P, by a factor of three (P = 0.81347436 ± 1.4 × 10{sup –7} days) and put an upper limit on the eccentricity (e=0.010{sub −0.007}{sup +0.010}). We use our Spitzer eclipse depths along with four previously reported ground-based photometric observations in the near-infrared to constrain the atmospheric properties of WASP-43b. The data rule out a strong thermal inversion in the dayside atmosphere of WASP-43b. Model atmospheres with no thermal inversions and fiducial oxygen-rich compositions are able to explain all the available data. However, a wide range of metallicities and C/O ratios can explain the data. The data suggest low day-night energy redistribution in the planet, consistent with previous studies, with a nominal upper limit of about 35% for the fraction of energy incident on the dayside that is redistributed to the nightside.
Signs of strong Na and K absorption in the transmission spectrum of WASP-103b
Lendl, M.; Cubillos, P. E.; Hagelberg, J.; Müller, A.; Juvan, I.; Fossati, L.
2017-09-01
Context. Transmission spectroscopy has become a prominent tool for characterizing the atmospheric properties on close-in transiting planets. Recent observations have revealed a remarkable diversity in exoplanet spectra, which show absorption signatures of Na, K and H2O, in some cases partially or fully attenuated by atmospheric aerosols. Aerosols (clouds and hazes) themselves have been detected in the transmission spectra of several planets thanks to wavelength-dependent slopes caused by the particles' scattering properties. Aims: We present an optical 550-960 nm transmission spectrum of the extremely irradiated hot Jupiter WASP-103b, one of the hottest (2500 K) and most massive (1.5 MJ) planets yet to be studied with this technique. WASP-103b orbits its star at a separation of less than 1.2 times the Roche limit and is predicted to be strongly tidally distorted. Methods: We have used Gemini/GMOS to obtain multi-object spectroscopy throughout three transits of WASP-103b. We used relative spectrophotometry and bin sizes between 20 and 2 nm to infer the planet's transmission spectrum. Results: We find that WASP-103b shows increased absorption in the cores of the alkali (Na, K) line features. We do not confirm the presence of any strong scattering slope as previously suggested, pointing towards a clear atmosphere for the highly irradiated, massive exoplanet WASP-103b. We constrain the upper boundary of any potential cloud deck to reside at pressure levels above 0.01 bar. This finding is in line with previous studies on cloud occurrence on exoplanets which find that clouds dominate the transmission spectra of cool, low surface gravity planets while hot, high surface gravity planets are either cloud-free, or possess clouds located below the altitudes probed by transmission spectra. The spectrophotometric time series data are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http
The Apparently Decaying Orbit of WASP-12b
Patra, Kishore C.; Winn, Joshua N.; Holman, Matthew J.; Yu, Liang; Deming, Drake; Dai, Fei
2017-07-01
We present new transit and occultation times for the hot Jupiter WASP-12b. The data are compatible with a constant period derivative: \\dot{P}=-29+/- 3 ms yr-1 and P/\\dot{P}=3.2 {Myr}. However, it is difficult to tell whether we have observed orbital decay or a portion of a 14-year apsidal precession cycle. If interpreted as decay, the star’s tidal quality parameter {Q}\\star is about 2× {10}5. If interpreted as precession, the planet’s Love number is 0.44 ± 0.10. Orbital decay appears to be the more parsimonious model: it is favored by {{Δ }}{χ }2=5.5 despite having two fewer free parameters than the precession model. The decay model implies that WASP-12 was discovered within the final ˜0.2% of its existence, which is an unlikely coincidence but harmonizes with independent evidence that the planet is nearing disruption. Precession does not invoke any temporal coincidence, but it does require some mechanism to maintain an eccentricity of ≈ 0.002 in the face of rapid tidal circularization. To distinguish unequivocally between decay and precession will probably require a few more years of monitoring. Particularly helpful will be occultation timing in 2019 and thereafter.
Subordinate wasps are more aggressive in colonies with low reproductive skew
DEFF Research Database (Denmark)
Fanelli, D.; Boomsma, Jacobus Jan; Turillazzi, S.
2008-01-01
The small societies of primitively eusocial wasps have provided interesting testing grounds for reproductive skew theory because all individuals have similar reproductive potential, which is unusual in social insects but common in vertebrate societies. Aggression is a key parameter in testing the...
Jiang, Li; Huang, Tian
2018-04-01
Food poisoning due to wild wasp broods ingestion has long been noted in the upstream region of the Lancang river valley, Yunnan province, China. This study describes the epidemiological and clinical features of the poisoning and possible causes. Surveillance data collected between 2008 and 2016 were analyzed to produce demographic data on patients, information on clinical presentations, wasp species identification, and estimations of possible risk factors for symptomatic cases. Eleven poisoning events were associated with the ingestion of wild wasp broods, including 46 exposed persons with 31 symptomatic living cases and 8 deceased cases that were reported in the Yunnan province between 2008 and 2016. Poisoning cases were only detected in the upstream region of the Lancang river valley in the autumn. The severity of the symptoms was correlated with an evident dose-effect relationship regarding the quantity ingested. The mean latent period from wild wasp broods ingestion to the onset of the symptoms was 10 h for symptomatic living cases and 7 h for deceased cases, respectively. Both gastrointestinal and neurological symptoms were commonly observed in the poisoning cases. The toxin source may be indirectly caused by the wasp broods due to the prevalence of local poisonous plants, such as Tripterygium wilfordii Hook F, Tripterygium hypoglaucum Hutch and Vaccinium bracteatum Thunb. Educational programs at the start of wasp harvest season in September in the high-risk area should be carried out to reduce the incidence of poisonings. Copyright © 2018 Elsevier Ltd. All rights reserved.
EXAMINING THE BROADBAND EMISSION SPECTRUM OF WASP-19b: A NEW z-BAND ECLIPSE DETECTION
Energy Technology Data Exchange (ETDEWEB)
Zhou, George; Bayliss, Daniel D. R. [Research School of Astronomy and Astrophysics, Australian National University, Cotter Rd, Weston Creek, ACT 2611 (Australia); Kedziora-Chudczer, Lucyna; Bailey, Jeremy, E-mail: george@mso.anu.edu.au [School of Physics, University of New South Wales, Sydney, NSW 2052 (Australia)
2013-09-10
WASP-19b is one of the most irradiated hot-Jupiters known. Its secondary eclipse is the deepest of all transiting planets and has been measured in multiple optical and infrared bands. We obtained a z-band eclipse observation with a measured depth of 0.080% {+-} 0.029%, using the 2 m Faulkes Telescope South, which is consistent with the results of previous observations. We combined our measurement of the z-band eclipse with previous observations to explore atmosphere models of WASP-19b that are consistent with its broadband spectrum. We use the VSTAR radiative transfer code to examine the effect of varying pressure-temperature profiles and C/O abundance ratios on the emission spectrum of the planet. We find that models with super-solar carbon enrichment best match the observations, which is consistent with previous model retrieval studies. We also include upper atmosphere haze as another dimension in the interpretation of exoplanet emission spectra and find that particles <0.5 {mu}m in size are unlikely to be present in WASP-19b.
Cdc42/N-WASP signaling links actin dynamics to pancreatic β cell delamination and differentiation
Kesavan, Gokul; Lieven, Oliver; Mamidi, Anant; Öhlin, Zarah Löf; Johansson, Jenny Kristina; Li, Wan-Chun; Lommel, Silvia; Greiner, Thomas Uwe; Semb, Henrik
2014-01-01
Delamination plays a pivotal role during normal development and cancer. Previous work has demonstrated that delamination and epithelial cell movement within the plane of an epithelium are associated with a change in cellular phenotype. However, how this positional change is linked to differentiation remains unknown. Using the developing mouse pancreas as a model system, we show that β cell delamination and differentiation are two independent events, which are controlled by Cdc42/N-WASP signaling. Specifically, we show that expression of constitutively active Cdc42 in β cells inhibits β cell delamination and differentiation. These processes are normally associated with junctional actin and cell-cell junction disassembly and the expression of fate-determining transcription factors, such as Isl1 and MafA. Mechanistically, we demonstrate that genetic ablation of N-WASP in β cells expressing constitutively active Cdc42 partially restores both delamination and β cell differentiation. These findings elucidate how junctional actin dynamics via Cdc42/N-WASP signaling cell-autonomously control not only epithelial delamination but also cell differentiation during mammalian organogenesis. PMID:24449844
Metagenomic analysis of microbial community of a parasitoid wasp Megaphragma amalphitanum
Directory of Open Access Journals (Sweden)
A.V. Nedoluzhko
2017-03-01
Full Text Available The vast majority of multicellular organisms coexist with bacterial symbionts that may play various roles during their life cycle. Parasitoid wasp Megaphragma amalphitanum (Hymenoptera: Trichogrammatidae belongs to the smallest known insects whose size is comparable with some bacteria. Using 16S rRNA gene sequencing and Whole Genome Sequencing (WGS, we described microbiota diversity for this arthropod and its potential impact on their lifecycle. Metagenomic sequences were deposited to SRA database which is available at NCBI with accession number SRX2363723 and SRX2363724. We found that small body size and limited lifespan do not lead to a significant reduction of bacterial symbionts diversity. At the same time, we show here a specific feature of microbiota composition in M. amalphitanum – the absence of the Rickettsiaceae family representatives that are known to cause sex-ratio distortion in arthropods and well represented in other populations of parasitoid wasps.
Pietrantuono, A L; Moreyra, S; Lozada, M
2017-09-19
Vespula germanica is a social wasp and an opportunistic predator. While foraging, these wasps learn and integrate different kinds of cues. They have successfully invaded many parts of the world, including native Nothofagus and Lophozonia forests located in the Andean-Patagonian region, where they forage on native arthropods. Perzelia arda, a lepidopteron defoliator of Lophozonia obliqua, uses the foliage to hide in and feed on. The purpose of this work is to study whether V. germanica use olfactory cues when foraging on P. arda. To do this, we used a Y-tube olfactometer and established three treatments to compare pairs of all combinations of stimuli (larvae, leaves with larval traces, and leaves without larval traces) and controls. Data were analysed via two developed models that showed decisions made by V. germanica and allowed to establish a scale of preferences between the stimuli. The analysis demonstrates that V. germanica wasps choose P. arda as larval prey and are capable of discriminating between the offered stimuli (deviance information criterion (DIC) null model = 873.97; DIC simple model = 84.5, n = 152). According to the preference scale, V. germanica preferred leaves with traces of larvae, suggesting its ability to associate these traces with the presence of the prey. This may be because, under natural conditions, larvae are never exposed outside their shelters of leaves and therefore V. germanica uses indirect signals. The presence of V. germanica foraging on P. arda highlights the flexible foraging behaviour of this wasp which may also act as a positive biological control, reducing lepidopteran populations.
Life-history strategies in parasitoid wasps: a comparative analysis of 'ovigeny'
Jervis, M.A.; Heimpel, G.E.; Ferns, P.N.; Harvey, J.A.; Kidd, N.A.C.
2001-01-01
1. Ecologists concerned with life-history strategies of parasitoid wasps have recently focused on interspecific variation in the fraction of the maximum potential lifetime egg complement that is mature when the female emerges into the environment. Species that have all of this complement mature upon
DEFF Research Database (Denmark)
Bank, Sarah; Sann, Manuela; Mayer, Christoph
2017-01-01
The wasp family Vespidae comprises more than 5000 described species which represent life history strategies ranging from solitary and presocial to eusocial and socially parasitic. The phylogenetic relationships of the major vespid wasp lineages (i.e., subfamilies and tribes) have been investigate...... studies on species of the family Vespidae, including their genomes, life styles, evolution of sociality, and co-evolution with other organisms....
Golden, Aaron; McLellan, Andrew S; Dubin, Robert A; Jing, Qiang; O Broin, Pilib; Moskowitz, David; Zhang, Zhengdong; Suzuki, Masako; Hargitai, Joseph; Calder, R Brent; Greally, John M
2012-01-01
Massively-parallel sequencing (MPS) technologies and their diverse applications in genomics and epigenomics research have yielded enormous new insights into the physiology and pathophysiology of the human genome. The biggest hurdle remains the magnitude and diversity of the datasets generated, compromising our ability to manage, organize, process and ultimately analyse data. The Wiki-based Automated Sequence Processor (WASP), developed at the Albert Einstein College of Medicine (hereafter Einstein), uniquely manages to tightly couple the sequencing platform, the sequencing assay, sample metadata and the automated workflows deployed on a heterogeneous high performance computing cluster infrastructure that yield sequenced, quality-controlled and 'mapped' sequence data, all within the one operating environment accessible by a web-based GUI interface. WASP at Einstein processes 4-6 TB of data per week and since its production cycle commenced it has processed ~ 1 PB of data overall and has revolutionized user interactivity with these new genomic technologies, who remain blissfully unaware of the data storage, management and most importantly processing services they request. The abstraction of such computational complexity for the user in effect makes WASP an ideal middleware solution, and an appropriate basis for the development of a grid-enabled resource - the Einstein Genome Gateway - as part of the Extreme Science and Engineering Discovery Environment (XSEDE) program. In this paper we discuss the existing WASP system, its proposed middleware role, and its planned interaction with XSEDE to form the Einstein Genome Gateway.
Why wasp foundresses change nests: relatedness, dominance, and nest quality.
Directory of Open Access Journals (Sweden)
Perttu Seppä
Full Text Available The costs and benefits of different social options are best understood when individuals can be followed as they make different choices, something that can be difficult in social insects. In this detailed study, we follow overwintered females of the social wasp Polistes carolina through different nesting strategies in a stratified habitat where nest site quality varies with proximity to a foraging area, and genetic relatedness among females is known. Females may initiate nests, join nests temporarily or permanently, or abandon nests. Females can become helpers or egglayers, effectively workers or queens. What they actually do can be predicted by a combination of ecological and relatedness factors. Advantages through increased lifetime success of individuals and nests drives foundresses of the social wasp Polistes from solitary to social nest founding. We studied reproductive options of spring foundresses of P. carolina by monitoring individually-marked wasps and assessing reproductive success of each foundress by using DNA microsatellites. We examined what behavioral decisions foundresses make after relaxing a strong ecological constraint, shortage of nesting sites. We also look at the reproductive consequences of different behaviors. As in other Polistes, the most successful strategy for a foundress was to initiate a nest as early as possible and then accept others as subordinates. A common feature for many P. carolina foundresses was, however, that they reassessed their reproductive options by actively monitoring other nests at the field site and sometimes moving permanently to new nests should that offer better (inclusive fitness prospects compared to their original nests. A clear motivation for moving to new nests was high genetic relatedness; by the end of the foundress period all females were on nests with full sisters.
Why Wasp Foundresses Change Nests: Relatedness, Dominance, and Nest Quality
Seppä, Perttu; Queller, David C.; Strassmann, Joan E.
2012-01-01
The costs and benefits of different social options are best understood when individuals can be followed as they make different choices, something that can be difficult in social insects. In this detailed study, we follow overwintered females of the social wasp Polistes carolina through different nesting strategies in a stratified habitat where nest site quality varies with proximity to a foraging area, and genetic relatedness among females is known. Females may initiate nests, join nests temporarily or permanently, or abandon nests. Females can become helpers or egglayers, effectively workers or queens. What they actually do can be predicted by a combination of ecological and relatedness factors. Advantages through increased lifetime success of individuals and nests drives foundresses of the social wasp Polistes from solitary to social nest founding. We studied reproductive options of spring foundresses of P. carolina by monitoring individually-marked wasps and assessing reproductive success of each foundress by using DNA microsatellites. We examined what behavioral decisions foundresses make after relaxing a strong ecological constraint, shortage of nesting sites. We also look at the reproductive consequences of different behaviors. As in other Polistes, the most successful strategy for a foundress was to initiate a nest as early as possible and then accept others as subordinates. A common feature for many P. carolina foundresses was, however, that they reassessed their reproductive options by actively monitoring other nests at the field site and sometimes moving permanently to new nests should that offer better (inclusive) fitness prospects compared to their original nests. A clear motivation for moving to new nests was high genetic relatedness; by the end of the foundress period all females were on nests with full sisters. PMID:23049791
A mechanical signal biases caste development in a social wasp
Sainath Suryanarayanan; John C. Hermanson; Robert L. Jeanne
2011-01-01
Understanding the proximate mechanisms of caste development in eusocial taxa can reveal how social species evolved from solitary ancestors. In Polistes wasps, the current paradigm holds that differential amounts of nutrition during the larval stage cause the divergence of worker and gyne (potential queen) castes. But nutrition level alone cannot explain how the first...
ENPEP and the microcomputer version of WASP-III: Overview and recent experience
International Nuclear Information System (INIS)
Buehring, W.A.; Wolsko, T.D.
1987-01-01
Argonne National Laboratory (ANL) has developed a microcomputer-based energy planning package entitled ENergy and Power Evaluation Program (ENPEP). It consists of seven technical modules, four commercial software packages, and an executive system that conveniently integrates the many options associated with performing energy studies. The seven technical modules and their functions are as follows: MACRO allows the user to specify macroeconomic growth (global or sectoral) that will be the drivers of energy demand. DEMAND projects energy demand based upon the macroeconomic growth information supplied in MACRO. PLANTDATA provides a library of technical data on electric generating plants that is used by BALANCE and ELECTRIC. BALANCE computes marketplace energy supply/demand balances over the study period. LOAD computes detailed electric load forecast information for use in ELECTRIC. ELECTRIC, the microcomputer (PC) version of WASP-III, calculates a minimum cost electric supply system to meet electric demand and reliability goals. IMPACTS calculates environmental impacts and resource requirements associated with energy supply system options. ENPEP provides the potential for energy planners in developing countries to carry out important studies without access to inconvenient and/or expensive mainframe computers. The ELECTRIC module of ENPEP provides electric system planners the opportunity to use the WASP-III model for expansion planning of electrical generating systems. Extensive efforts have been made in converting WASP-III to the microcomputer to provide user-friendly data entry forms and options for operations. (author). 3 refs, 20 figs
Sting microsculpture in the digger wasp Bembix rostrata (Hymenoptera, Crabronidae
Directory of Open Access Journals (Sweden)
Natalia Matushkina
2011-03-01
Full Text Available The sting microsculpture of the digger wasp Bembix rostrata (Fabricius, 1781 (Hymenoptera, Crabronidae is studied with the scanning electron microscope (SEM for the first time. As in many other hymenopterans, the second valvifer of B. rostrata possesses two fields of styloconic sensilla (hair plates of proprioceptive function. The presence of two paired fields of campaniform sensilla on the second valvula and second valvifer is first shown in an apoid wasp. The first and the second valvulae bear scattered sensilla-like structures on the external surface, more numerous apically. The first valvula has two subapical barbs externally and a pair of valvilli on its inner surface, whereas the outer surface of the second valvula is smooth. The third valvula is sclerotized externally, consisting of proximal and distal parts, and bearing four sensilla morphotypes of mechanoreceptive and probably chemoreceptive functions. The inner surface of the valvulae and the membranous cuticle that is touching the sting have microstructures of different shapes directed distally. Functional aspects of characters studied are discussed.
Yeruham, I; Schwimmer, A; Brami, Y
2002-12-01
The German wasp, Vespula germanica has been observed to injure teats of dairy cows, causing lesions that are associated with clinical and subclinical mastitis. The presence of skin lesions on the teats, caused by the wasps, was recorded in a dairy cattle herd located in the Samaria foothills during July-October 1999. Wasp-inflicted injuries were found in 43.6% (58 of 133) of the adult cows and 1.4% (one of 71) of the first-calving cows. They were located in 42.4% of cows (n = 25) on all quarters, 18 cows (30.5%) had lesions on the front quarters and 27.1% (n = 16) of cows on the hind quarters only. Clinical and subclinical mastitis were diagnosed in 61% (36 of 59) and 28.8% (17 of 59), respectively, of the injured adult and first-calving cows. The most common bacterial isolates from the mastitic cows were Staphylococcus aureus 45.1% (n = 14), Streptococcus dysgalactiae 16.1% (n = 5), Streptococcus spp. 19.4% (n = 7) and others 13.9% (n = 5). The loss of milk production was estimated at 300 kg milk for each cow injured by wasps and exhibiting clinical mastitis. An increase in the bulk-milk somatic cell count, from 186 x 103 at 1 month prior to the outbreak to a peak of 1200 x 10(3) in the post-outbreak month, was noted. The culling rate reached 13.6% (eight of 59) of the affected cows. In summary, the considerable economic losses caused by the wasp infestation resulted from decreased milk production and a decline in milk quality, culling of affected cows, and increased demand for use of drugs and veterinary care.
Directory of Open Access Journals (Sweden)
Larissa G. Elias
Full Text Available Relações ecológicas interespecíficas, que resultam em benefício para todos os organismos participantes, são conhecidas como mutualismo. No entanto, tal cooperação abre espaço para o surgimento de estratégias oportunistas (ou de trapaça, representadas por indivíduos parasitas do mutualismo, que recebem o benefício de um dos parceiros sem oferecer nada em troca. A interação figueiras - vespas - de - figo é um sistema adequado para o estudo do mutualismo e de estratégias oportunistas (parasitas de mutualismos. Representantes do gênero Ficus (Moraceae apresentam uma relação mutualística com pequenas vespas polinizadoras (Agaonidae e são explorados por outras espécies de vespas não-polinizadoras. Esse trabalho teve como objetivo avaliar o impacto das vespas não-polinizadoras sobre o mutualismo Ficus citrifolia e suas vespas polinizadoras, Pegoscapus tonduzi Grandi, 1919. Para tal, foi comparada a produção de aquênios (função feminina e de fêmeas da espécie polinizadora (função masculina entre amostras de sicônios altamente infestados e pouco infestados por vespas não-polinizadoras, coletadas nos municípios de Londrina (Paraná, Campinas e Ribeirão Preto (São Paulo, Brasil. Nossos resultados apontaram que as vespas não-polinizadoras exercem impacto negativo nos componentes feminino e masculino da planta, sendo maior no masculino. A produção de vespas polinizadoras foi cerca de sete vezes menor nos figos infestados, ao passo que a produção de aquênios foi 1,5 vez menor nesses mesmos figos. Hipóteses sobre a estabilidade do mutualismo na presença das espécies oportunistas são discutidas.Mutualism is the name given to interspecific interactions which result in benefit for all partners involved. However, such cooperation is open to opportunistic strategies: individuals that extract the benefit from the partner, but do not offer any benefit in exchange. The fig-fig wasp interaction is an appropriate case to
Selfish element maintains sex in natural populations of a parasitoid wasp.
Stouthamer, R.; Tilborg, van M.; Jong, de J.H.; Nunney, L.; Luck, R.F.
2001-01-01
Genomic conflicts between heritable elements with different modes of inheritance are important in the maintenance of sex and in the evolution of sex ratio. Generally, we expect sexual populations to exhibit a 1:1 sex ratio. However, because of their biology, parasitoid wasps often exhibit a
DAY-SIDE z'-BAND EMISSION AND ECCENTRICITY OF WASP-12b
International Nuclear Information System (INIS)
Lopez-Morales, Mercedes; Rogers, Justin C.; Coughlin, Jeffrey L.; Sing, David K.; Burrows, Adam; Spiegel, David S.; Apai, Daniel; Adams, Elisabeth R.
2010-01-01
We report the detection of the eclipse of the very hot Jupiter WASP-12b via z'-band time-series photometry obtained with the 3.5 m Astrophysical Research Consortium telescope at Apache Point Observatory. We measure a decrease in flux of 0.082% ± 0.015% during the passage of the planet behind the star. That planetary flux is equally well reproduced by atmospheric models with and without extra absorbers, and blackbody models with f ≥ 0.585 ± 0.080. It is therefore necessary to measure the planet at other wavelengths to further constrain its atmospheric properties. The eclipse appears centered at phase φ = 0.5100 +0.0072 -0.0061 , consistent with an orbital eccentricity of |ecos ω| = 0.016 +0.011 -0.009 (see note at the end of Section 4). If the orbit of the planet is indeed eccentric, the large radius of WASP-12b can be explained by tidal heating.
Directory of Open Access Journals (Sweden)
Joke J. F. A. Van Vugt
2015-09-01
Full Text Available Even though learning and memory are universal traits in the Animal Kingdom, closely related species reveal substantial variation in learning rate and memory dynamics. To determine the genetic background of this natural variation, we studied two congeneric parasitic wasp species, Cotesia glomerata and C. rubecula, which lay their eggs in caterpillars of the large and small cabbage white butterfly. A successful egg laying event serves as an unconditioned stimulus in a classical conditioning paradigm, where plant odors become associated to the encounter of a suitable host caterpillar. Depending on the host species, the number of conditioning trials and the parasitic wasp species, three different types of transcription-dependent long-term memory (LTM and one type of transcription-independent, anesthesia-resistant memory (ARM can be distinguished. To identify transcripts underlying these differences in memory formation, we isolated mRNA from parasitic wasp heads at three different time points between induction and consolidation of each of the four memory types, and for each sample three biological replicates, where after strand-specific paired-end 100 bp deep sequencing. Transcriptomes were assembled de novo and differential expression was determined for each memory type and time point after conditioning, compared to unconditioned wasps. Most differentially expressed (DE genes and antisense transcripts were only DE in one of the LTM types. Among the DE genes that were DE in two or more LTM types, were many protein kinases and phosphatases, small GTPases, receptors and ion channels. Some genes were DE in opposing directions between any of the LTM memory types and ARM, suggesting that ARM in Cotesia requires the transcription of genes inhibiting LTM or vice versa. We discuss our findings in the context of neuronal functioning, including RNA splicing and transport, epigenetic regulation, neurotransmitter/peptide synthesis and antisense transcription. In
Permissive and instructive anterior patterning rely on mRNA localization in the wasp embryo.
Brent, Ava E; Yucel, Gozde; Small, Stephen; Desplan, Claude
2007-03-30
The long-germ mode of embryogenesis, in which segments arise simultaneously along the anteriorposterior axis, has evolved several times in different lineages of the holometabolous, or fully metamorphosing, insects. Drosophila's long-germ fate map is established largely by the activity of the dipteran-specific Bicoid (Bcd) morphogen gradient, which operates both instructively and permissively to accomplish anterior patterning. By contrast, all nondipteran long-germ insects must achieve anterior patterning independently of bcd. We show that bcd's permissive function is mimicked in the wasp by a maternal repression system in which anterior localization of the wasp ortholog of giant represses anterior expression of the trunk gap genes so that head and thorax can properly form.
Associative learning in two closely related parasitoid wasps: a neuroecological approach
Bleeker, M.A.K.
2005-01-01
Insects are useful model organisms to study learning and memory. Their brains are less complex than vertebrate brains, but the basic mechanisms of learning and memory are similar in both taxa. In this thesis I study learning and subsequent memory formation in two parasitoid wasp species that differ
What do foraging wasps optimize in a variable environment, energy investment or body temperature?
Kovac, Helmut; Stabentheiner, Anton; Brodschneider, Robert
2015-11-01
Vespine wasps (Vespula sp.) are endowed with a pronounced ability of endothermic heat production. To show how they balance energetics and thermoregulation under variable environmental conditions, we measured the body temperature and respiration of sucrose foragers (1.5 M, unlimited flow) under variable ambient temperature (T a = 20-35 °C) and solar radiation (20-570 W m(-2)). Results revealed a graduated balancing of metabolic efforts with thermoregulatory needs. The thoracic temperature in the shade depended on ambient temperature, increasing from ~37 to 39 °C. However, wasps used solar heat gain to regulate their thorax temperature at a rather high level at low T a (mean T thorax ~ 39 °C). Only at high T a they used solar heat to reduce their metabolic rate remarkably. A high body temperature accelerated the suction speed and shortened foraging time. As the costs of foraging strongly depended on duration, the efficiency could be significantly increased with a high body temperature. Heat gain from solar radiation enabled the wasps to enhance foraging efficiency at high ambient temperature (T a = 30 °C) by up to 63 %. The well-balanced change of economic strategies in response to environmental conditions minimized costs of foraging and optimized energetic efficiency.
Natural variation in memory formation among Nasonia parasitic wasps : from genes to behaviour
Hoedjes, K.M.
2014-01-01
The ability to learn and form memory has been demonstrated in various animal species, ranging from relatively simple invertebrates, such as snails and insects, to more complex vertebrate species, including birds and mammals. The opportunity to acquire new skills or to adapt behaviour
Hybrid incompatibilities are affected by dominance and dosage in the haplodiploid wasp Nasonia
Beukeboom, Leo W; Koevoets, Tosca; Morales, Hernán E; Ferber, Steven; van de Zande, Louis
2015-01-01
Study of genome incompatibilities in species hybrids is important for understanding the genetic basis of reproductive isolation and speciation. According to Haldane's rule hybridization affects the heterogametic sex more than the homogametic sex. Several theories have been proposed that attribute
Mancini, L.; Esposito, M.; Covino, E.; Southworth, J.; Biazzo, K.; Bruni, I.; Ciceri, S.; Evans, D.; Lanza, A. F.; Poretti, E.; Sarkis, P.; Smith, A. M. S.; Brogi, M.; Affer, L.; Benatti, S.; Bignamini, A.; Boccato, C.; Bonomo, A. S.; Borsa, F.; Carleo, I.; Claudi, R.; Cosentino, R.; Damasso, M.; Desidera, S.; Giacobbe, P.; González-Álvarez, E.; Gratton, R.; Harutyunyan, A.; Leto, G.; Maggio, A.; Malavolta, L.; Maldonado, J.; Martinez-Fiorenzano, A.; Masiero, S.; Micela, G.; Molinari, E.; Nascimbeni, V.; Pagano, I.; Pedani, M.; Piotto, G.; Rainer, M.; Scandariato, G.; Smareglia, R.; Sozzetti, A.; Andreuzzi, G.; Henning, Th.
2018-05-01
Context. The measurement of the orbital obliquity of hot Jupiters with different physical characteristics can provide clues to the mechanisms of migration and orbital evolution of this particular class of giant exoplanets. Aims: We aim to derive the degree of alignment between planetary orbit and stellar spin angular momentum vectors and look for possible links with other orbital and fundamental physical parameters of the star-planet system. We focus on the characterisation of five transiting planetary systems (HAT-P-3, HAT-P-12, HAT-P-22, WASP-39, and WASP-60) and the determination of their sky-projected planet orbital obliquity through the measurement of the Rossiter-McLaughlin effect. Methods: We used HARPS-N high-precision radial velocity measurements, gathered during transit events, to measure the Rossiter-McLaughlin effect in the target systems and determine the sky-projected angle between the planetary orbital plane and stellar equator. The characterisation of stellar atmospheric parameters was performed by exploiting the HARPS-N spectra, using line equivalent width ratios and spectral synthesis methods. Photometric parameters of the five transiting exoplanets were re-analysed through 17 new light curves, obtained with an array of medium-class telescopes, and other light curves from the literature. Survey-time-series photometric data were analysed for determining the rotation periods of the five stars and their spin inclination. Results: From the analysis of the Rossiter-McLaughlin effect we derived a sky-projected obliquity of λ = 21.2° ± 8.7°, λ = -54°-13°+41°, λ = -2.1° ± 3.0°, λ = 0° ± 11°, and λ = -129° ± 17° for HAT-P-3 b, HAT-P-12 b, HAT-P-22 b, WASP-39 b, and WASP-60 b, respectively. The latter value indicates that WASP-60 b is moving on a retrograde orbit. These values represent the first measurements of λ for the five exoplanetary systems under study. The stellar activity of HAT-P-22 indicates a rotation period of 28.7 ± 0
Energy Technology Data Exchange (ETDEWEB)
Huitson, C. M. [CASA, University of Colorado, 389 UCB, Boulder, CO 80309-0389 (United States); Désert, J.-M. [API, University of Amsterdam, P.O. Box 94249, 1090 GE Amsterdam (Netherlands); Bean, J. L. [Department of Astronomy and Astrophysics, University of Chicago, Chicago, IL 60637 (United States); Fortney, J. J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Stevenson, K. B. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Bergmann, M., E-mail: catherine.huitson@colorado.edu [NOAO and Gemini Observatory, present address Palo Alto, CA (United States)
2017-09-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ∼ 400–1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ∼1 μ m. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
International Nuclear Information System (INIS)
Huitson, C. M.; Désert, J.-M.; Bean, J. L.; Fortney, J. J.; Stevenson, K. B.; Bergmann, M.
2017-01-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ∼ 400–1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ∼1 μ m. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
Huitson, C. M.; Désert, J.-M.; Bean, J. L.; Fortney, J. J.; Stevenson, K. B.; Bergmann, M.
2017-09-01
We present the complete optical transmission spectrum of the hot Jupiter WASP-4b from 440 to 940 nm at R ˜ 400-1500 obtained with the Gemini Multi-Object Spectrometers (GMOS); this is the first result from a comparative exoplanetology survey program of close-in gas giants conducted with GMOS. WASP-4b has an equilibrium temperature of 1700 K and is favorable to study in transmission due to its large scale height (370 km). We derive the transmission spectrum of WASP-4b using four transits observed with the MOS technique. We demonstrate repeatable results across multiple epochs with GMOS, and derive a combined transmission spectrum at a precision about twice above photon noise, which is roughly equal to one atmospheric scale height. The transmission spectrum is well fitted with a uniform opacity as a function of wavelength. The uniform opacity and absence of a Rayleigh slope from molecular hydrogen suggest that the atmosphere is dominated by clouds with condensate grain sizes of ˜1 μm. This result is consistent with previous observations of hot Jupiters since clouds have been seen in planets with similar equilibrium temperatures to WASP-4b. We describe a custom pipeline that we have written to reduce GMOS time-series data of exoplanet transits, and present a thorough analysis of the dominant noise sources in GMOS, which primarily consist of wavelength- and time-dependent displacements of the spectra on the detector, mainly due to a lack of atmospheric dispersion correction.
THE CURIOUS CASE OF ELEMENTAL ABUNDANCE DIFFERENCES IN THE DUAL HOT JUPITER HOSTS WASP-94A AND B
Energy Technology Data Exchange (ETDEWEB)
Teske, Johanna K. [Carnegie Department of Terrestrial Magnetism, 5241 Broad Branch Road, NW, Washington, DC 20015 (United States); Khanal, Sandhya; Ramírez, Ivan, E-mail: jteske@carnegiescience.edu [McDonald Observatory and Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1402, Austin, TX 78712-1205 (United States)
2016-03-01
Binary stars provide an ideal laboratory for investigating the potential effects of planet formation on stellar composition. Assuming that the stars formed in the same environment/from the same material, any compositional anomalies between binary components might indicate differences in how material was sequestered in planets, or accreted by the star in the process of planet formation. We present here a study of the elemental abundance differences between WASP-94A and B, a pair of stars that each host a hot Jupiter exoplanet. The two stars are very similar in spectral type (F8 and F9), and their ∼2700 au separation suggests that their protoplanetary disks were likely not influenced by stellar interactions, but WASP-94Ab’s orbit—misaligned with the host star spin axis and likely retrograde—points toward a dynamically active formation mechanism, perhaps different from that of WASP-94Bb, which is not misaligned and has a nearly circular orbit. Based on our high-quality spectra and strictly relative abundance analysis, we detect a depletion of volatiles (∼−0.02 dex, on average) and enhancement of refractories (∼0.01 dex) in WASP-94A relative to B (standard errors are ∼0.005 dex). This is different from every other published case of binary host star abundances, in which either no significant abundance differences are reported or there is some degree of enhancement in all elements, including volatiles. Several scenarios that may explain the abundance trend are discussed, but none can be definitively accepted or rejected. Additional high-contrast imaging observations to search for companions that may be dynamically affecting the system, as well as a larger sample of binary host star studies, are needed to better understand the curious abundance trends we observe in WASP-94A and B.
Elevated and cross‐responsive CD1a‐reactive T cells in bee and wasp venom allergic individuals
Subramaniam, Sumithra; Aslam, Aamir; Misbah, Siraj A.; Salio, Mariolina; Cerundolo, Vincenzo; Moody, D Branch
2015-01-01
The role of CD1a‐reactive T cells in human allergic disease is unknown. We have previously shown that circulating CD1a‐reactive T cells recognize neolipid antigens generated by bee and wasp venom phospholipase, and here tested the hypothesis that venom‐responsive CD1a‐reactive T cells associate with venom allergy. Circulating T cells from bee and wasp venom allergic individuals, before and during immunotherapy, were exposed to CD1a‐transfected K562 cells in the presence of wasp or bee venom. T‐cell response was evaluated based on IFNγ, GM‐CSF, and IL‐13 cytokine production. Venom allergic individuals showed significantly higher frequencies of IFN‐γ, GM‐CSF, and IL‐13 producing CD1a‐reactive T cells responsive to venom and venom‐derived phospholipase than healthy individuals. Venom‐responsive CD1a‐reactive T cells were cross‐responsive between wasp and bee suggesting shared pathways of allergenicity. Frequencies of CD1a‐reactive T cells were initially induced during subcutaneous immunotherapy, peaking by weeks 5, but then reduced despite escalation of antigen dose. Our current understanding of venom allergy and immunotherapy is largely based on peptide and protein‐specific T cell and antibody responses. Here, we show that lipid antigens and CD1a‐reactive T cells associate with the allergic response. These data have implications for mechanisms of allergy and approaches to immunotherapy. PMID:26518614
Kjellberg, Finn; Proffit, Magali
2016-02-01
The food webs consisting of plants, herbivorous insects and their insect parasitoids are a major component of terrestrial biodiversity. They play a central role in the functioning of all terrestrial ecosystems, and the number of species involved is mind-blowing (Nyman et al. 2015). Nevertheless, our understanding of the evolutionary and ecological determinants of their diversity is still in its infancy. In this issue of Molecular Ecology, Sutton et al. (2016) open a window into the comparative analysis of spatial genetic structuring in a set of comparable multitrophic models, involving highly species-specific interactions: figs and fig wasps. This is the first study to compare genetic structure using population genetics tools in a fig-pollinating wasp (Pleistodontes imperialis sp1) and its main parasitoid (Sycoscapter sp.A). The fig-pollinating wasp has a discontinuous spatial distribution that correlates with genetic differentiation, while the parasitoid bridges the discontinuity by parasitizing other pollinator species on the same host fig tree and presents basically no spatial genetic structure. The full implications of these results for our general understanding of plant-herbivorous insect-insect parasitoids diversification become apparent when envisioned within the framework of recent advances in fig and fig wasp biology. © 2016 John Wiley & Sons Ltd.
Suppressed Far-UV Stellar Activity and Low Planetary Mass Loss in the WASP-18 System
Fossati, L.; Koskinen, T.; France, K.; Cubillos, P. E.; Haswell, C. A.; Lanza, A. F.; Pillitteri, I.
2018-03-01
WASP-18 hosts a massive, very close-in Jupiter-like planet. Despite its young age (extinction (E(B-V) ≈ 0.01 mag) and then the interstellar medium (ISM) column density for a number of ions, concluding that ISM absorption is not the origin of the anomaly. We measure the flux of the four stellar emission features detected in the COS spectrum (C II, C III, C IV, Si IV). Comparing the C II/C IV flux ratio measured for WASP-18 with that derived from spectra of nearby stars with known age, we see that the far-UV spectrum of WASP-18 resembles that of old (>5 Gyr), inactive stars, in stark contrast with its young age. We conclude that WASP-18 has an intrinsically low activity level, possibly caused by star–planet tidal interaction, as suggested by previous studies. Re-scaling the solar irradiance reference spectrum to match the flux of the Si IV line, yields an XUV integrated flux at the planet orbit of 10.2 erg s‑1 cm‑2. We employ the rescaled XUV solar fluxes to models of the planetary upper atmosphere, deriving an extremely low thermal mass-loss rate of 10‑20 M J Gyr‑1. For such high-mass planets, thermal escape is not energy limited, but driven by Jeans escape. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from MAST at the Space Telescope Science Institute, which is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555. These observations are associated with program #13859. Based on observations made with ESO Telescopes at the La Silla Paranal Observatory under programme ID 092.D-0587.
Kaya, Murat; Bağrıaçık, Nil; Seyyar, Osman; Baran, Talat
2015-08-01
There has been no study on the chitin structure of wasp species. Here, we selected the three most common wasp species belonging to the family Vespidae for chitin extraction and characterization. Chitin was isolated from each wasp species and characterized by Fourier transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA), X-ray diffractometry (XRD), elemental analysis (EA), and scanning electron microscopy (SEM). The chitin contents of Vespa crabro, Vespa orientalis, and Vespula germanica were 8.3, 6.4, and 11.9%, respectively. The crystalline index (CrI) values for the chitin extracted from each species were 69.88, 53.92, and 50%, respectively. The most important finding of the study is that although the same method was used to extract chitin from each of the three wasp species, the degree of acetylation was different: for V. crabro and V. orientalis it was 96.85 and 99.82% (the chitin was extremely pure), respectively, whereas that for V. germanica the chitin was 79.83%. © 2015 Wiley Periodicals, Inc.
WASP-12b AND HAT-P-8b are members of triple star systems
Energy Technology Data Exchange (ETDEWEB)
Bechter, Eric B.; Crepp, Justin R.; Matthews, Christopher T. [Department of Physics, University of Notre Dame, 225 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Johnson, John Asher [Department of Planetary Science, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Hinkley, Sasha; Muirhead, Philip S.; Montet, Benjamin T.; Morton, Timothy D. [Department of Astronomy, California Institute of Technology, 1200 East California Boulevard, Pasadena, CA 91125 (United States); Howard, Andrew W., E-mail: ebechter@nd.edu [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)
2014-06-10
We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M {sub ☉} using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.
WASP-12b and HAT-P-8b are Members of Triple Star Systems
Bechter, Eric B.; Crepp, Justin R.; Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Hinkley, Sasha; Muirhead, Philip S.; Johnson, John Asher; Howard, Andrew W.; Montet, Benjamin T.; Matthews, Christopher T.; Morton, Timothy D.
2014-06-01
We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M ⊙ using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.
WASP-12b AND HAT-P-8b are members of triple star systems
International Nuclear Information System (INIS)
Bechter, Eric B.; Crepp, Justin R.; Matthews, Christopher T.; Ngo, Henry; Knutson, Heather A.; Batygin, Konstantin; Johnson, John Asher; Hinkley, Sasha; Muirhead, Philip S.; Montet, Benjamin T.; Morton, Timothy D.; Howard, Andrew W.
2014-01-01
We present high spatial resolution images that demonstrate that WASP-12b and HAT-P-8b orbit the primary stars of hierarchical triple star systems. In each case, two distant companions with colors and brightnesses consistent with M dwarfs co-orbit the hot Jupiter planet host as well as one another. Our adaptive optics images spatially resolve the secondary around WASP-12, previously identified by Bergfors et al. and Crossfield et al. into two distinct sources separated by 84.3 ± 0.6 mas (21 ± 3 AU). We find that the secondary to HAT-P-8, also identified by Bergfors et al., is in fact composed of two stars separated by 65.3 ± 0.5 mas (15 ± 1 AU). Our follow-up observations demonstrate physical association through common proper motion. HAT-P-8 C has a particularly low mass, which we estimate to be 0.18 ± 0.02 M ☉ using photometry. Due to their hierarchy, WASP-12 BC and HAT-P-8 BC will enable the first dynamical mass determination for hot Jupiter stellar companions. These previously well studied planet hosts now represent higher-order multi-star systems with potentially complex dynamics, underscoring the importance of diffraction-limited imaging and providing additional context for understanding the migrant population of transiting hot Jupiters.
Rodriguez, Lillian Jennifer; Bain, Anthony; Chou, Lien-Siang; Conchou, Lucie; Cruaud, Astrid; Gonzales, Regielene; Hossaert-McKey, Martine; Rasplus, Jean-Yves; Tzeng, Hsy-Yu; Kjellberg, Finn
2017-08-29
Interspecific interactions have long been assumed to play an important role in diversification. Mutualistic interactions, such as nursery pollination mutualisms, have been proposed as good candidates for diversification through co-speciation because of their intricate nature. However, little is known about how speciation and diversification proceeds in emblematic nursery pollination systems such as figs and fig wasps. Here, we analyse diversification in connection with spatial structuring in the obligate mutualistic association between Ficus septica and its pollinating wasps throughout the Philippines and Taiwan. Ceratosolen wasps pollinating F. septica are structured into a set of three vicariant black coloured species, and a fourth yellow coloured species whose distribution overlaps with those of the black species. However, two black pollinator species were found to co-occur on Lanyu island. Microsatellite data on F. septica indicates the presence of three gene pools that broadly mirrors the distribution of the three black clades. Moreover, receptive fig odours, the specific message used by pollinating wasps to locate their host tree, varied among locations. F. septica and its black pollinator clades exhibited similar geographic structuring. This could be due originally to geographic barriers leading to isolation, local adaptation, and finally co-structuring. Nevertheless, the co-occurrence of two black pollinator species on Lanyu island suggests that the parapatric distribution of the black clades is now maintained by the inability of migrating individuals of black pollinators to establish populations outside their range. On the other hand, the distribution of the yellow clade strongly suggests an initial case of character displacement followed by subsequent range extension: in our study system, phenotypic or microevolutionary plasticity has allowed the yellow clade to colonise hosts presenting distinct odours. Hence, while variation in receptive fig odours
International Nuclear Information System (INIS)
Chernilin, Yu.; Kononov, S.; Zakharova, E.; Kagramanyan, V.; Malenkov, A.
1997-01-01
The Wien Automatic System Planning Package (WASP) is used for the development of optimal capacity expansion plans in Russia. The object of the WASP study is the Central power pool, which is the largest power pool in Russia and has an essential share of nuclear power in electricity generation. The objective of the study is to assess the long-term competitiveness of nuclear power in the region. The major features of the power system analyzed with WASP are the following: 1) four types of electricity generators are considered: condensity fossil fuel plants, cogeneration fossil fuel plants, nuclear power plants and hydraulic plants; 2) nine fuel categories are considered: gas/fuel oil fuel, several types of coal and several nuclear fuels; 3) escalation of capital, operation and maintenance, and fuel costs as a result of economic transition is explicitly modeled. Under these assumptions, a regional optimal capacity expansion plan is developed that showed the following: (a) Until 2004 there is no need for new electricity generation capacities due to the drop in demand in the 90s, certain lifetime margin of existing capacities, committed additions of co-generators and planned refurbishment/repowering measures; (b) The structure of the optimal capacity mix confirms that nuclear power can retain its role as one of the major electricity generation sources in the region. The most important factor with a positive of effect upon the competitiveness of nuclear power plants is the projected escalation of the prices of fossil fuels; (c) The application of WASP has proved that the model can serve as a valuable planning tool at the power pool level in Russia. (author). 14 refs, 8 figs, 10 tabs
Energy Technology Data Exchange (ETDEWEB)
Chernilin, Yu; Kononov, S; Zakharova, E [Russian Research Inst. ` ` Kurchatov Inst.` ` , Moscow (Russian Federation); Kagramanyan, V; Malenkov, A [Institute of Physics and Power Engineering, Obninsk (Russian Federation)
1997-09-01
The Wien Automatic System Planning Package (WASP) is used for the development of optimal capacity expansion plans in Russia. The object of the WASP study is the Central power pool, which is the largest power pool in Russia and has an essential share of nuclear power in electricity generation. The objective of the study is to assess the long-term competitiveness of nuclear power in the region. The major features of the power system analyzed with WASP are the following: 1) four types of electricity generators are considered: condensity fossil fuel plants, cogeneration fossil fuel plants, nuclear power plants and hydraulic plants; 2) nine fuel categories are considered: gas/fuel oil fuel, several types of coal and several nuclear fuels; 3) escalation of capital, operation and maintenance, and fuel costs as a result of economic transition is explicitly modeled. Under these assumptions, a regional optimal capacity expansion plan is developed that showed the following: (a) Until 2004 there is no need for new electricity generation capacities due to the drop in demand in the 90s, certain lifetime margin of existing capacities, committed additions of co-generators and planned refurbishment/repowering measures; (b) The structure of the optimal capacity mix confirms that nuclear power can retain its role as one of the major electricity generation sources in the region. The most important factor with a positive of effect upon the competitiveness of nuclear power plants is the projected escalation of the prices of fossil fuels; (c) The application of WASP has proved that the model can serve as a valuable planning tool at the power pool level in Russia. (author). 14 refs, 8 figs, 10 tabs.
A Model of the Pulsating Extremely Low-mass White Dwarf Precursor WASP 0247-25B
Istrate, A. G.; Fontaine, G.; Heuser, C.
2017-10-01
We present an analysis of the evolutionary and pulsation properties of the extremely low-mass white dwarf precursor (B) component of the double-lined eclipsing system WASP 0247-25. Given that the fundamental parameters of that star have been obtained previously at a unique level of precision, WASP 0247-25B represents the ideal case for testing evolutionary models of this newly found category of pulsators. Taking into account the known constraints on the mass, orbital period, effective temperature, surface gravity, and atmospheric composition, we present a model that is compatible with these constraints and show pulsation modes that have periods very close to the observed values. Importantly, these modes are predicted to be excited. Although the overall consistency remains perfectible, the observable properties of WASP 0247-25B are closely reproduced. A key ingredient of our binary evolutionary models is represented by rotational mixing as the main competitor against gravitational settling. Depending on assumptions made about the values of the degree index ℓ for the observed pulsation modes, we found three possible seismic solutions. We discuss two tests, rotational splitting and multicolor photometry, that should readily identify the modes and discriminate between these solutions. However, this will require improved temporal resolution and higher S/N observations, which are currently unavailable.
Directory of Open Access Journals (Sweden)
PRISCILA S. OLIVEIRA
Full Text Available ABSTRACT Trap-nesting bee and wasp inventories are common in Brazil but many phytophysiognomies are still poorly studied. The main objective of this study is to survey trap-nesting bees and wasps in a Semidecidual Seasonal Forest fragment. Also, we test the differences on nesting between interior and edge transects. A sum of 1,500 trap nests was made with bamboo cane internodes and two consecutive years were monitored. In the first year 46 nests were occupied by Pachodynerus grandis (19 nests, Pachodynerus guadulpensis (19, Centris analis (two, and Centris tarsata, Megachile fiebrigi, Megachile guaranitica, Megachile susurrans, Trypoxylon sp and Zethus smithii with one nest each. No statistical differences were found between interior and edge transects for richness and occupation rate, but the species composition was different. In the second year 39 nests were occupied by four species, three previously recorded, C. analis (seven nests, P. guadulpensis and P. grandis (six nests each, plus Monobia angulosa with 15 nests. Parasitoids from four families and one cleptoparasite were recorded and the mortality rate was higher in bees than in wasps. These findings reinforce the notion that trap nests assemblages from different studies are not directly comparable for richness and composition.
Directory of Open Access Journals (Sweden)
Jesica Perez-Balam
2012-06-01
Full Text Available Although avocado is native to Mexico, there are no comparative measures in this country on the performance of its flower visitors as pollinators. The contribution of honey bees, flies and wasps to the pollination of avocado from tropical Mexico was assessed by comparing abundance, speed of flower visitation, quantity of pollen carried per individual and pollen deposited on virgin flowers after single visits. The values of abundance and frequency of flower visitation with pollen deposition were combined to obtain a measure of pollinator performance (PP. The most abundant insects on avocado were flies (mean ± SE: 15. 2 ± 6.2, followed by honey bees (9.4 ± 6.3 and wasps (4.2 ± 3.1 (ANOVA F = 91.71, d.f. = 2,78; P P P = 0.001, the number of pollen grains deposited on a stigma after a single visit was similar for the three taxa (2-5. There was evidence for a significant and similarly positive PP of both honey bees and flies as avocado pollinators over wasps, given their abundance, potential for pollen transport and deposition of pollen on stigmas.
New potent antimicrobial peptides from the venom of Polistinae wasps and their analogs
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav; Slaninová, Jiřina; Fučík, Vladimír; Hulačová, Hana; Borovičková, Lenka; Ježek, Rudolf; Bednárová, Lucie
2008-01-01
Roč. 29, č. 6 (2008), s. 992-1003 ISSN 0196-9781 Institutional research plan: CEZ:AV0Z40550506 Keywords : antimicrobial peptides * wasp venom * circular dichroism * hemolytic activity Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008
Magdaraog, P.M.; Harvey, J.A.; Tanaka, T.; Gols, R.
2012-01-01
1. Intrinsic competition was compared in three species of braconid wasps, the solitary Meteorus pulchricornis Wesmael, and the gregarious Cotesia kariyai (Watanabe) and Cotesia ruficrus Haliday in caterpillars of their common host, the armyworm Mythimna separata Walker. Competition was determined in
Weiss, Lauren M.; Deck, Katherine M.; Sinukoff, Evan; Petigura, Erik A.; Agol, Eric; Lee, Eve J.; Becker, Juliette C.; Howard, Andrew W.; Isaacson, Howard; Crossfield, Ian J. M.; Fulton, Benjamin J.; Hirsch, Lea; Benneke, Björn
2017-06-01
Measuring precise planet masses, densities, and orbital dynamics in individual planetary systems is an important pathway toward understanding planet formation. The WASP-47 system has an unusual architecture that motivates a complex formation theory. The system includes a hot Jupiter (“b”) neighbored by interior (“e”) and exterior (“d”) sub-Neptunes, and a long-period eccentric giant planet (“c”). We simultaneously modeled transit times from the Kepler K2 mission and 118 radial velocities to determine the precise masses, densities, and Keplerian orbital elements of the WASP-47 planets. Combining RVs and TTVs provides a better estimate of the mass of planet d (13.6+/- 2.0 {M}\\oplus ) than that obtained with only RVs (12.75+/- 2.70 {M}\\oplus ) or TTVs (16.1+/- 3.8 {M}\\oplus ). Planets e and d have high densities for their size, consistent with a history of photoevaporation and/or formation in a volatile-poor environment. Through our RV and TTV analysis, we find that the planetary orbits have eccentricities similar to the solar system planets. The WASP-47 system has three similarities to our own solar system: (1) the planetary orbits are nearly circular and coplanar, (2) the planets are not trapped in mean motion resonances, and (3) the planets have diverse compositions. None of the current single-process exoplanet formation theories adequately reproduce these three characteristics of the WASP-47 system (or our solar system). We propose that WASP-47, like the solar system, formed in two stages: first, the giant planets formed in a gas-rich disk and migrated to their present locations, and second, the high-density sub-Neptunes formed in situ in a gas-poor environment.
Elevated and cross-responsive CD1a-reactive T cells in bee and wasp venom allergic individuals.
Subramaniam, Sumithra; Aslam, Aamir; Misbah, Siraj A; Salio, Mariolina; Cerundolo, Vincenzo; Moody, D Branch; Ogg, Graham
2016-01-01
The role of CD1a-reactive T cells in human allergic disease is unknown. We have previously shown that circulating CD1a-reactive T cells recognize neolipid antigens generated by bee and wasp venom phospholipase, and here tested the hypothesis that venom-responsive CD1a-reactive T cells associate with venom allergy. Circulating T cells from bee and wasp venom allergic individuals, before and during immunotherapy, were exposed to CD1a-transfected K562 cells in the presence of wasp or bee venom. T-cell response was evaluated based on IFNγ, GM-CSF, and IL-13 cytokine production. Venom allergic individuals showed significantly higher frequencies of IFN-γ, GM-CSF, and IL-13 producing CD1a-reactive T cells responsive to venom and venom-derived phospholipase than healthy individuals. Venom-responsive CD1a-reactive T cells were cross-responsive between wasp and bee suggesting shared pathways of allergenicity. Frequencies of CD1a-reactive T cells were initially induced during subcutaneous immunotherapy, peaking by weeks 5, but then reduced despite escalation of antigen dose. Our current understanding of venom allergy and immunotherapy is largely based on peptide and protein-specific T cell and antibody responses. Here, we show that lipid antigens and CD1a-reactive T cells associate with the allergic response. These data have implications for mechanisms of allergy and approaches to immunotherapy. © 2015 The Authors. European Journal of Immunology published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Zhu, Jia-Ying; Ze, Sang-Zi; Stanley, David W; Yang, Bin
2014-09-01
Superoxide dismutase (SOD) is an antioxidant enzyme involved in detoxifying reactive oxygen species. In this study, we identified genes encoding the extracellular and intracellular copper-zinc SODs (ecCuZnSOD and icCuZnSOD) and a manganese SOD (MnSOD) in the yellow mealworm beetle, Tenebrio molitor. The cDNAs for ecCuZnSOD, icCuZnSOD, and MnSOD, respectively, encode 24.55, 15.81, and 23.14 kDa polypeptides, which possess structural features typical of other insect SODs. They showed 20-94% identity to other known SOD sequences from Bombyx mori, Musca domestica, Nasonia vitripennis, Pediculus humanus corporis, and Tribolium castaneum. Expression of these genes was analyzed in selected tissues and developmental stages, and following exposure to Escherichia coli and parasitization by Scleroderma guani. We recorded expression of all three SODs in cuticle, fat body, and hemocytes and in the major developmental stages. Relatively higher expressions were detected in late-instar larvae and pupae, compared to other developmental stages. Transcriptional levels were upregulated following bacterial infection. Analysis of pupae parasitized by S. guani revealed that expression of T. molitor SOD genes was significantly induced following parasitization. We infer that these genes act in immune response and in host-parasitoid interactions. © 2014 Wiley Periodicals, Inc.
Complementary sex determination in the parasitic wasp Diachasmimorpha longicaudata.
Directory of Open Access Journals (Sweden)
Leonela Carabajal Paladino
Full Text Available We studied the sex determination in Diachasmimorpha longicaudata, a parasitoid braconid wasp widely used as biological control agent of fruit pest tephritid flies. We tested the complementary sex determination hypothesis (CSD known in at least 60 species of Hymenoptera. According to CSD, male or female development depends on the allelic composition of one sex locus (single-locus CSD or multiple sex loci (multiple-locus CSD. Hemizygote individuals are normal haploid males, and heterozygotes for at least one sex locus are normal diploid females, but homozygotes for all the sex loci are diploid males. In order to force the occurrence of diploid males in D. longicaudata, we established highly inbred lines and examined their offspring using chromosome counting, flow cytometry, and sex ratio analysis. We found that when mother-son crosses were studied, this wasp produced about 20% of diploid males out of the total male progeny. Our results suggest that this parasitoid may represent the second genus with multiple-locus CSD in Hymenoptera. Knowledge about the sex determination system in D. longicaudata is relevant for the improvement of mass rearing protocols of this species. This information also provides the necessary background for further investigations on the underlying molecular mechanisms of sex determination in this species, and a better insight into the evolution of this pathway in Hymenoptera in particular and insects in general.
Seeing in the dark: vision and visual behaviour in nocturnal bees and wasps.
Warrant, Eric J
2008-06-01
In response to the pressures of predation, parasitism and competition for limited resources, several groups of (mainly) tropical bees and wasps have independently evolved a nocturnal lifestyle. Like their day-active (diurnal) relatives, these insects possess apposition compound eyes, a relatively light-insensitive eye design that is best suited to vision in bright light. Despite this, nocturnal bees and wasps are able to forage at night, with many species capable of flying through a dark and complex forest between the nest and a foraging site, a behaviour that relies heavily on vision and is limited by light intensity. In the two best-studied species - the Central American sweat bee Megalopta genalis (Halictidae) and the Indian carpenter bee Xylocopa tranquebarica (Apidae) - learned visual landmarks are used to guide foraging and homing. Their apposition eyes, however, have only around 30 times greater optical sensitivity than the eyes of their closest diurnal relatives, a fact that is apparently inconsistent with their remarkable nocturnal visual abilities. Moreover, signals generated in the photoreceptors, even though amplified by a high transduction gain, are too noisy and slow to transmit significant amounts of information in dim light. How have nocturnal bees and wasps resolved these paradoxes? Even though this question remains to be answered conclusively, a mounting body of theoretical and experimental evidence suggests that the slow and noisy visual signals generated by the photoreceptors are spatially summed by second-order monopolar cells in the lamina, a process that could dramatically improve visual reliability for the coarser and slower features of the visual world at night.
Directory of Open Access Journals (Sweden)
Feng Gui
2011-04-01
Full Text Available Abstract Background Figs and fig-pollinating wasp species usually display a highly specific one-to-one association. However, more and more studies have revealed that the "one-to-one" rule has been broken. Co-pollinators have been reported, but we do not yet know how they evolve. They may evolve from insect speciation induced or facilitated by Wolbachia which can manipulate host reproduction and induce reproductive isolation. In addition, Wolbachia can affect host mitochondrial DNA evolution, because of the linkage between Wolbachia and associated mitochondrial haplotypes, and thus confound host phylogeny based on mtDNA. Previous research has shown that fig wasps have the highest incidence of Wolbachia infection in all insect taxa, and Wolbachia may have great influence on fig wasp biology. Therefore, we look forward to understanding the influence of Wolbachia on mitochondrial DNA evolution and speciation in fig wasps. Results We surveyed 76 pollinator wasp specimens from nine Ficus microcarpa trees each growing at a different location in Hainan and Fujian Provinces, China. We found that all wasps were morphologically identified as Eupristina verticillata, but diverged into three clades with 4.22-5.28% mtDNA divergence and 2.29-20.72% nuclear gene divergence. We also found very strong concordance between E. verticillata clades and Wolbachia infection status, and the predicted effects of Wolbachia on both mtDNA diversity and evolution by decreasing mitochondrial haplotypes. Conclusions Our study reveals that the pollinating wasp E. verticillata on F. microcarpa has diverged into three cryptic species, and Wolbachia may have a role in this divergence. The results also indicate that Wolbachia strains infecting E. verticillata have likely resulted in selective sweeps on host mitochondrial DNA.
System interconnection studies using WASP
Energy Technology Data Exchange (ETDEWEB)
Bayrak, Y [Turkish Electricity Generation and Transmission Corp., Ankara (Turkey)
1997-09-01
The aim of this paper is to describe the application of WASP as a modelling tool for determining the development of two electric systems with interconnections. A case study has been carried out to determine the possibilities of transfer of baseload energy between Turkey and a neighboring country. The objective of this case study is to determine the amount of energy that can be transferred, variations of Loss Probability (LOLP) and unserved energy, and the cost of additional generation with interconnection. The break-even cost will be determined to obtain the minimum charge rate at which TEAS (Turkish Electricity Generation-Transmission Corp.) needs to sell the energy in order to recover the costs. The minimum charge rate for both capacity and energy will be estimated without considering extra capacity additions, except for the ones needed by the Turkish system alone. (author). 2 figs, 3 tabs.
The Mechanisms of Water Exchange: The Regulatory Roles of Multiple Interactions in Social Wasps.
Agrawal, Devanshu; Karsai, Istvan
2016-01-01
Evolutionary benefits of task fidelity and improving information acquisition via multiple transfers of materials between individuals in a task partitioned system have been shown before, but in this paper we provide a mechanistic explanation of these phenomena. Using a simple mathematical model describing the individual interactions of the wasps, we explain the functioning of the common stomach, an information center, which governs construction behavior and task change. Our central hypothesis is a symmetry between foragers who deposit water and foragers who withdraw water into and out of the common stomach. We combine this with a trade-off between acceptance and resistance to water transfer. We ultimately derive a mathematical function that relates the number of interactions that foragers complete with common stomach wasps during a foraging cycle. We use field data and additional model assumptions to calculate values of our model parameters, and we use these to explain why the fullness of the common stomach stabilizes just below 50 percent, why the average number of successful interactions between foragers and the wasps forming the common stomach is between 5 and 7, and why there is a variation in this number of interactions over time. Our explanation is that our proposed water exchange mechanism places natural bounds on the number of successful interactions possible, water exchange is set to optimize mediation of water through the common stomach, and the chance that foragers abort their task prematurely is very low.
Directory of Open Access Journals (Sweden)
Thiago S. Montagna
2012-06-01
Full Text Available First report of interspecific facultative social parasitism in the paper wasp genus Mischocyttarus Saussure (Hymenoptera, Vespidae. Parasitism of colonies of the social wasp Mischocyttarus cerberus Ducke, 1918 by females of Mischocyttarus consimilis Zikán, 1949 was observed in a rural area of Dourados, state of Mato Grosso do Sul, Brazil. In all monitored cases, the invasion occurred in the pre-emergence colony stage, generally by a single female of M. consimilis. The period of establishment of the foreign female in the host colony was marked by antagonistic behaviors between the host female and the invasive. In general, the architecture of the parasitized nest was modified from the typical architecture of the host species nest.
The role of non-fig-wasp insects on fig tree biology, with a proposal of the F phase (Fallen figs)
Palmieri, Luciano; Pereira, Rodrigo Augusto Santinelo
2018-07-01
The two seminal papers by Galil and Eisikowitch describing the development of Ficus flowers and their sycophilous wasps (i.e., phases A-E) have been adopted in several ecological and evolutionary studies on a wide range of fig tree-insect interactions. Their classification, however, is not inclusive enough to encompass all the diversity of insects associated with the fig development, and the impact of this fauna on the fig-fig wasp mutualism is still unexplored. Here we describe the life history of the non-fig-wasp insects and propose an additional phase to fig-development classification, the F phase (Fallen figs). These figs are not consumed by frugivores while still on the parent tree, fall to the ground and turn into a resource for a diverse range of animals. To support the relevance of the F phase, we summarized a 5-years-period of field observations made on different biomes in three continents. Additionally, we compiled data from the literature of non-fig-wasp insects including only insects associated with inflorescences of wild fig tree species. We report 129 species of non-fig-wasp insects feeding on figs; they colonize the figs in different phases of development and some groups rely on the fallen figs to complete their life cycles. Their range of interaction varies from specialists - that use exclusively fig pulp or fig seeds in their diets - to generalists, opportunists and parasitoids species. The formalization of this additional phase will encourage new studies on fig tree ecology and improve our knowledge on the processes that affect the diversification of insects. It will also help us to understand the implications this fauna may have had on the origin and maintenance of mutualistic interactions.
z'-BAND GROUND-BASED DETECTION OF THE SECONDARY ECLIPSE OF WASP-19b
Energy Technology Data Exchange (ETDEWEB)
Burton, J. R.; Watson, C. A.; Pollacco, D. [Astrophysics Research Centre, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Littlefair, S. P.; Dhillon, V. S. [Department of Physics and Astronomy, University of Sheffield, Sheffield S3 7RH (United Kingdom); Gibson, N. P. [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom); Marsh, T. R., E-mail: jburton04@qub.ac.uk [Department of Physics and Astronomy, University of Warwick, Coventry CV4 7AL (United Kingdom)
2012-08-01
We present the ground-based detection of the secondary eclipse of the transiting exoplanet WASP-19b. The observations were made in the Sloan z' band using the ULTRACAM triple-beam CCD camera mounted on the New Technology Telescope. The measurement shows a 0.088% {+-} 0.019% eclipse depth, matching previous predictions based on H- and K-band measurements. We discuss in detail our approach to the removal of errors arising due to systematics in the data set, in addition to fitting a model transit to our data. This fit returns an eclipse center, T{sub 0}, of 2455578.7676 HJD, consistent with a circular orbit. Our measurement of the secondary eclipse depth is also compared to model atmospheres of WASP-19b and is found to be consistent with previous measurements at longer wavelengths for the model atmospheres we investigated.
High bee and wasp diversity in a heterogeneous tropical farming system compared to protected forest.
Directory of Open Access Journals (Sweden)
Christof Schüepp
Full Text Available It is a globally important challenge to meet increasing demands for resources and, at the same time, protect biodiversity and ecosystem services. Farming is usually regarded as a major threat to biodiversity due to its expansion into natural areas. We compared biodiversity of bees and wasps between heterogeneous small-scale farming areas and protected forest in northern coastal Belize, Central America. Malaise traps operated for three months during the transition from wet to dry season. Farming areas consisted of a mosaic of mixed crop types, open habitat, secondary forest, and agroforestry. Mean species richness per site (alpha diversity, as well as spatial and temporal community variation (beta diversity of bees and wasps were equal or higher in farming areas compared to protected forest. The higher species richness and community variation in farmland was due to additional species that did not occur in the forest, whereas most species trapped in forest were also found in farming areas. The overall regional species richness (gamma diversity increased by 70% with the inclusion of farming areas. Our results suggest that small-scale farming systems adjacent to protected forest may not only conserve, but even favour, biodiversity of some taxonomic groups. We can, however, not exclude possible declines of bee and wasp diversity in more intensified farmland or in landscapes completely covered by heterogeneous farming systems.
Directory of Open Access Journals (Sweden)
Jean-Paul Lachaud
2012-01-01
Full Text Available Eucharitid wasps are specific, specialized parasitoids of ants. The genus Kapala Cameron is the most common in the Neotropics but few species are described, and information dealing with their biology, behavior and host associations is scarce. Numerous poneromorph ant colonies were inspected over 4 collection surveys in French Guiana. A diverse fauna of parasites and parasitoids was found, including mermithid nematodes, flies, eucharitids, and another gregarious endoparasitoid wasp. Five new host associations for Kapala are reported, all of them involving medium- to large-size poneromorph ant species from 4 genera: Ectatomma brunneum Fr. Smith, Gnamptogenys tortuolosa (Fr. Smith, Odontomachus haematodus (L., O. mayi Mann, and Pachycondyla verenae (Forel. Three other associations involving O. hastatus (Fabr., P. apicalis (Latreille, and P. stigma (Fabr., already reported for other countries but new for French Guiana, are confirmed. The data extend the number of hosts for Kapala to 24 ant species from 7 genera. The high diversity of the ant host genera associated with Kapala, combined with the fact that these ant genera are the most widely distributed among Neotropical poneromorph ants, could account for the dominant status of the genus Kapala among the eucharitine wasps of Central and South America.
A Model of the Pulsating Extremely Low-mass White Dwarf Precursor WASP 0247–25B
Energy Technology Data Exchange (ETDEWEB)
Istrate, A. G. [Center for Gravitation, Cosmology, and Astrophysics, Department of Physics, University of Wisconsin-Milwaukee, P.O. Box 413, Milwaukee, WI 53201 (United States); Fontaine, G. [Département de Physique, Université de Montréal, C.P. 6128, Succursale Centre-Ville, Montréal, QC H3C 3J7 (Canada); Heuser, C., E-mail: istrate@uwm.edu [Dr. Karl Remeis-Observatory and ECAP, Astronomical Institute, Friedrich-Alexander University Erlangen-Nürnberg, Sternwartstr. 7, D-96049 Bamberg (Germany)
2017-10-01
We present an analysis of the evolutionary and pulsation properties of the extremely low-mass white dwarf precursor (B) component of the double-lined eclipsing system WASP 0247−25. Given that the fundamental parameters of that star have been obtained previously at a unique level of precision, WASP 0247−25B represents the ideal case for testing evolutionary models of this newly found category of pulsators. Taking into account the known constraints on the mass, orbital period, effective temperature, surface gravity, and atmospheric composition, we present a model that is compatible with these constraints and show pulsation modes that have periods very close to the observed values. Importantly, these modes are predicted to be excited. Although the overall consistency remains perfectible, the observable properties of WASP 0247−25B are closely reproduced. A key ingredient of our binary evolutionary models is represented by rotational mixing as the main competitor against gravitational settling. Depending on assumptions made about the values of the degree index ℓ for the observed pulsation modes, we found three possible seismic solutions. We discuss two tests, rotational splitting and multicolor photometry, that should readily identify the modes and discriminate between these solutions. However, this will require improved temporal resolution and higher S/N observations, which are currently unavailable.
SPECTROSCOPIC EVIDENCE FOR A TEMPERATURE INVERSION IN THE DAYSIDE ATMOSPHERE OF HOT JUPITER WASP-33b
Energy Technology Data Exchange (ETDEWEB)
Haynes, Korey; Mandell, Avi M. [Solar System Exploration Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Madhusudhan, Nikku [Institute of Astronomy, University of Cambridge, Cambridge CB3 0HA (United Kingdom); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Knutson, Heather, E-mail: khaynes0112@gmail.com [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States)
2015-06-20
We present observations of two occultations of the extrasolar planet WASP-33b using the Wide Field Camera 3 (WFC3) on the Hubble Space Telescope, which allow us to constrain the temperature structure and composition of its dayside atmosphere. WASP-33b is the most highly irradiated hot Jupiter discovered to date, and the only exoplanet known to orbit a δ-Scuti star. We observed in spatial scan mode to decrease instrument systematic effects in the data, and removed fluctuations in the data due to stellar pulsations. The rms for our final, binned spectrum is 1.05 times the photon noise. We compare our final spectrum, along with previously published photometric data, to atmospheric models of WASP-33b spanning a wide range in temperature profiles and chemical compositions. We find that the data require models with an oxygen-rich chemical composition and a temperature profile that increases at high altitude. We find that our measured spectrum displays an excess in the measured flux toward short wavelengths that is best explained as emission from TiO. If confirmed by additional measurements at shorter wavelengths, this planet would become the first hot Jupiter with a thermal inversion that can be definitively attributed to the presence of TiO in its dayside atmosphere.
Health effects of predatory beneficial mites and wasps in greenhouses
DEFF Research Database (Denmark)
Bælum, Jesper; Enkegaard, Annie; Doekes, Gert
A three-year study of 579 greenhouse workers in 31 firms investigated the effect of four different beneficial arthropods. It was shown that the thrips mite Amblyseeius cucumeris and the spider mite predator Phytoseiulus persimilis may cause allergy measured by blood tests as well as eye and nose...... symptoms. No effect was seen by the predator wasp Aphidius colemani nor the predator mite Hypoaspis miles and no effect on lung diseases were seen....
High-precision photometry by telescope defocusing - I. The transiting planetary system WASP-5
DEFF Research Database (Denmark)
Southworth, J.; Hinse, T. C.; Jørgensen, U. G.
2009-01-01
We present high-precision photometry of two transit events of the extrasolar planetary system WASP-5, obtained with the Danish 1.54-m telescope at European Southern Obseratory La Silla. In order to minimize both random and flat-fielding errors, we defocused the telescope so its point spread...
Jandér, K Charlotte; Steidinger, Brian S
2017-07-01
Mutualisms between species are ecologically ubiquitous but evolutionarily puzzling. Host discrimination mechanisms that reduce the fitness of uncooperative symbionts can stabilise mutualism against collapse, but also present a paradox - if discrimination is effective, why do uncooperative symbionts persist? Here, we test whether mutations or fitness benefits of cheating best explain the prevalence of uncooperative wasps in the fig tree-fig wasp mutualism. By combining theory with field-collected data we demonstrate that the proportions of pollen-free wasps of strongly discriminating hosts are reached with reasonable mutation rates. In contrast, in weakly discriminating hosts, the required mutation rates, assuming a single locus, are untenably high, but the required cheater advantages fall within expected ranges. We propose that when discrimination is weak, uncooperative symbionts proliferate until they reach the equilibrium proportion that balances costs and benefits of cheating. Our results suggest that mechanisms that resolve the paradox of uncooperative symbionts differ among host species. © 2017 John Wiley & Sons Ltd/CNRS.
Oboyski, P.T.; Slotterback, J.W.; Banko, P.C.
2004-01-01
Alien parasitic wasps, including accidental introductions and purposefully released biological control agents, have been implicated in the decline of native Hawaiian Lepidoptera. Understanding the potential impacts of alien wasps requires knowledge of ecological parameters that influence parasitism rates for species in their new environment. Sophora seed-feeding Cydia spp. (Lepidoptera: Tortricidae) were surveyed for larval parasitoids to determine how native and alien wasps are partitioned over an elevation gradient (2200-2800 m) on Hawaii Island, Hawaii. Parasitism rate of native Euderus metallicus (Eulophidae) increased with increased elevation, while parasitism rate by immigrant Calliephialtes grapholithae (Ichneumonidae) decreased. Parasitism by Pristomerus hawaiiensis (Ichneumonidae), origins uncertain, also decreased with increased elevation. Two other species, Diadegma blackburni (Ichneumonidae), origins uncertain, and Brasema cushmani (Eupelmidae), a purposefully introduced biological control agent for pepper weevil, did not vary significantly with elevation. Results are contrasted with a previous study of this system with implications for the conservation of an endangered bird species that feed on Cydia larvae. Interpretation of results is hindered by lack of knowledge of autecology of moths and wasps, origins, phylogeny, systematics, competitive ability, and physiological limitations of each wasp species. These factors should be incorporated into risk analysis for biological control introductions and invasive species programs. ?? 2004 Kluwer Academic Publishers.
Life History of the Emerald Jewel Wasp Ampulex compressa
Directory of Open Access Journals (Sweden)
Ryan Arvidson
2018-04-01
Full Text Available The Emerald Jewel Wasp Ampulex compressa (Fabricius is an endoparasitoid of the American cockroach Periplaneta americana (Linnaeus. Its host subjugation strategy is unusual in that envenomation is directed into the host central nervous system, eliciting a long-term behavior modification termed hypokinesia, turning stung cockroaches into a lethargic and compliant, but not paralyzed, living food supply for wasp offspring. A. compressa manipulates hypokinesic cockroaches into a burrow, where it oviposits a single egg onto a mesothoracic leg, hatching three days later. Herein we describe the life history and developmental timing of A. compressa. Using head capsule measurements and observations of mandibular morphology, we found that the larvae develop through three instars, the first two ectoparasitoid, and the third exclusively endoparasitoid. The first two instars have mandibles sufficient for piercing and cutting the cuticle respectively, while the third instar has a larger and blunter mandibular structure. During ecdysis to the third instar, the larva enters the body cavity of the cockroach, consuming internal tissues selectively, including fat body and skeletal muscle, but sparing the gut and Malpighian tubules. The developmental timing to pupation is similar between males and females, but cocoon volume and mass, and pupation duration are sexually dimorphic. Further, we show that the difference in cocoon mass and volume can be used to predict sex before eclosion, which is valuable for studies in venom pharmacology, as only females produce venom.
M. Miller-Pierce; D. C. Shaw; A. Demarco; P. T. Oester
2015-01-01
The larch casebearer [Coleophora laricella (Hubner)], a non-native insect, continues to impact western larch (Larix occidentalis Nutt.) through defoliation events in the Pacific Northwest. Biological control programs starting in the 1960s released seven species of parasitoid wasps to control C. laricella...
Hoedjes, K.M.; Steidle, J.L.M.; Werren, J.H.; Vet, L.E.M.; Smid, H.M.
2012-01-01
Most of our knowledge on learning and memory formation results from extensive studies on a small number of animal species. Although features and cellular pathways of learning and memory are highly similar in this diverse group of species, there are also subtle differences. Closely related species of
Hoedjes, K.M.; Steidle, J.L.M.; Werren, J.H.; Vet, L.E.M.; Smid, H.M.
2012-01-01
Most of our knowledge on learning and memory formation results from extensive studies on a small number of animal species. Although features and cellular pathways of learning and memory are highly similar in this diverse group of species, there are also subtle differences. Closely related species of
Energy Technology Data Exchange (ETDEWEB)
Oreshenko, Maria; Lavie, Baptiste; Grimm, Simon L.; Tsai, Shang-Min; Malik, Matej; Demory, Brice-Olivier; Mordasini, Christoph; Alibert, Yann; Benz, Willy; Heng, Kevin [University of Bern, Center for Space and Habitability, Gesellschaftsstrasse 6, CH-3012 Bern (Switzerland); Quanz, Sascha P. [ETH Zürich, Department of Physics, Wolfgang-Pauli-Strasse 27, CH-8093 Zürich (Switzerland); Trotta, Roberto, E-mail: maria.oreshenko@csh.unibe.ch, E-mail: kevin.heng@csh.unibe.ch [Astrophysics Group, Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom)
2017-09-20
We analyze the emission spectrum of the hot Jupiter WASP-12b using our HELIOS-R retrieval code and HELIOS-K opacity calculator. When interpreting Hubble and Spitzer data, the retrieval outcomes are found to be prior-dominated. When the prior distributions of the molecular abundances are assumed to be log-uniform, the volume mixing ratio of HCN is found to be implausibly high. A VULCAN chemical kinetics model of WASP-12b suggests that chemical equilibrium is a reasonable assumption even when atmospheric mixing is implausibly rigorous. Guided by (exo)planet formation theory, we set Gaussian priors on the elemental abundances of carbon, oxygen, and nitrogen with the Gaussian peaks being centered on the measured C/H, O/H, and N/H values of the star. By enforcing chemical equilibrium, we find substellar O/H and stellar to slightly superstellar C/H for the dayside atmosphere of WASP-12b. The superstellar carbon-to-oxygen ratio is just above unity, regardless of whether clouds are included in the retrieval analysis, consistent with Madhusudhan et al. Furthermore, whether a temperature inversion exists in the atmosphere depends on one’s assumption for the Gaussian width of the priors. Our retrieved posterior distributions are consistent with the formation of WASP-12b in a solar-composition protoplanetary disk, beyond the water iceline, via gravitational instability or pebble accretion (without core erosion) and migration inward to its present orbital location via a disk-free mechanism, and are inconsistent with both in situ formation and core accretion with disk migration, as predicted by Madhusudhan et al. We predict that the interpretation of James Webb Space Telescope WASP-12b data will not be prior-dominated.
Wind resource assessment using the WAsP software (DTU Wind Energy E-0135)
DEFF Research Database (Denmark)
Mortensen, Niels Gylling
These course notes are intended for the three-week course 46200 Planning and Development of Wind Farms given each year at the Technical University of Denmark. The purpose of the course notes is to give an introduction to wind resource assessment and siting issues using the WAsP suite of programs....
Moreno, Miguel; Giralt, Ernest
2015-01-01
While knowledge of the composition and mode of action of bee and wasp venoms dates back 50 years, the therapeutic value of these toxins remains relatively unexploded. The properties of these venoms are now being studied with the aim to design and develop new therapeutic drugs. Far from evaluating the extensive number of monographs, journals and books related to bee and wasp venoms and the therapeutic effect of these toxins in numerous diseases, the following review focuses on the three most characterized peptides, namely melittin, apamin, and mastoparan. Here, we update information related to these compounds from the perspective of applied science and discuss their potential therapeutic and biotechnological applications in biomedicine. PMID:25835385
Abe, Jun; Pannebakker, Bart A.
2017-01-01
The parasitoid wasp Melittobia is an important insect for basic and applied biology. Specifically, their extremely female-biased sex ratios, which contrast to the prediction of pre-existing theories, are needed to be explained from the aspect of evolutionary biology. In this study, using
ON THE ORBIT OF EXOPLANET WASP-12b
International Nuclear Information System (INIS)
Campo, Christopher J.; Harrington, Joseph; Hardy, Ryan A.; Stevenson, Kevin B.; Nymeyer, Sarah; Lust, Nate B.; Blecic, Jasmina; Britt, Christopher B. T.; Bowman, William C.; Ragozzine, Darin; Anderson, David R.; Hellier, Coel; Maxted, Pierre F. L.; Collier-Cameron, Andrew; Wheatley, Peter J.; Loredo, Thomas J.; Deming, Drake; Hebb, Leslie; Pollaco, Don; West, Richard G.
2011-01-01
We observed two secondary eclipses of the exoplanet WASP-12b using the Infrared Array Camera on the Spitzer Space Telescope. The close proximity of WASP-12b to its G-type star results in extreme tidal forces capable of inducing apsidal precession with a period as short as a few decades. This precession would be measurable if the orbit had a significant eccentricity, leading to an estimate of the tidal Love number and an assessment of the degree of central concentration in the planetary interior. An initial ground-based secondary-eclipse phase reported by Lopez-Morales et al. (0.510 ± 0.002) implied eccentricity at the 4.5σ level. The spectroscopic orbit of Hebb et al. has eccentricity 0.049 ± 0.015, a 3σ result, implying an eclipse phase of 0.509 ± 0.007. However, there is a well-documented tendency of spectroscopic data to overestimate small eccentricities. Our eclipse phases are 0.5010 ± 0.0006 (3.6 and 5.8 μm) and 0.5006 ± 0.0007 (4.5 and 8.0 μm). An unlikely orbital precession scenario invoking an alignment of the orbit during the Spitzer observations could have explained this apparent discrepancy, but the final eclipse phase of Lopez-Morales et al. (0.510 ± +0.007 -0.006 ) is consistent with a circular orbit at better than 2σ. An orbit fit to all the available transit, eclipse, and radial-velocity data indicates precession at <1σ; a non-precessing solution fits better. We also comment on analysis and reporting for Spitzer exoplanet data in light of recent re-analyses.
Directory of Open Access Journals (Sweden)
Paria Soltaninejad
2017-03-01
Full Text Available Introduction: Parasitoid wasp, Trichogramma brassicae (Bezdenko (Hym.: Trichogrammatidae has excellent position in mass production technology, scope of application, wide geographical distribution and unmatched talent to adapt to different climatic conditions that can be easily reared on Mediterranean flour moth (MFM, Ephestia kuehniella Zeller (Lep.: Pyralidae. The parasitoid use is in order to control Chilo suppressalis (Walker (Lep.: Pyralidae, Helicoverpa armigera (Lep.: Noctuidae, Ostrinia nubilalis (Hübner (Lep.: Pyralidae, Ectomyelois ceratoniae (Zeller (Lep.: Phycitidae and Cydia pomonella (Lep.: Tortricidae (38. The studies have been shown that the quantity and quality of the host diet affect growth period, size of adults, adult longevity, fecundity and sex ratio of the parasitoid. The objective of current research was to evaluate the effect of four different MFM diets on the fitness of second and forth generations of the parasitoid wasp, T. brassicae. Materials and Methods: The four diets ((I wheat flour, wheat bran, corn flour, bread yeast and glycerin; (II wheat flour, wheat bran, barley flour, bread yeast and glycerin; (III barley flour, bread yeast and glycerin and (IV wheat flour, barley flour and corn flour were sterilized at 51 °C for 24 hours. After cooling at ambient temperature, the diets were contaminated with the eggs of MFM and then were maintained at 25±1° C, 60±5 % RH and a photoperiod of 14 L: 10 D. The MFM adults emerged after 35 to 40 days and their eggs were collected daily to use for investigation of the parasitoid biology. For rearing the parasitoid wasps on the MFM eggs obtained from each diet, some cards containing the parasitoid pre-pupae were put inside cages (25 × 25 × 25 cm and reared for one generation. The adults were fed honey (20% for one day and then were provided with one-day-old sterile MFM eggs. To prevent egg hatching and sterile them, they were kept at 15°C for four h. The tests were
Management of pest mole crickets in Florida and Puerto Rico with a nematode and parasitic wasp
International Nuclear Information System (INIS)
Leppla, N.C.; Frank, J.H.; Adjei, M.B.; Vicente, N.E.
2007-01-01
Non-indigenous invasive mole crickets, Scapteriscus vicinus Scudder (Orthoptera: Gryllotalpidae) in Florida and S. didactylus (Latreille) (the 'changa') in Puerto Rico, are being managed with an entomopathogenic nematode, Steinernema scapterisci (Nguyen and Smart) (Rhabditida: Steinernematidae), and a parasitic wasp, Larra bicolor L. (Hymenoptera: Sphecidae). Pest mole cricket populations have declined by 95% in north central Florida since these specialist natural enemies were released and established in the 1980s. Commercial production of the nematode was initiated, nearly 70 billion were applied in 34 Florida counties, and their establishment, spread, and impact on mole crickets were monitored. The infected mole crickets dispersed the nematode rapidly, so that within 6 months these parasites were present in most of the insects trapped in experimental pastures. Three years later, mole cricket populations were reduced to acceptable levels and the bahiagrass had recovered. The nematode was released for the first time in Puerto Rico during 2001 and has persisted; the wasp was introduced in the late 1930s. The geographical distribution of the wasp is being expanded in Florida and Puerto Rico by planting plots of Spermacoce verticillata (L.), a wildflower indigenous to Puerto Rico and widely distributed in southern Florida. Pastures, sod farms, golf courses, landscapes, and vegetable farms in Florida and Puerto Rico are benefiting from biological control of invasive mole crickets. (author) [es
Observations and modeling of the transiting exoplanets XO-2b, HAT-P-18b, and WASP-80b
Directory of Open Access Journals (Sweden)
Kjurkchieva Diana P.
2017-01-01
Full Text Available We present photometric observations and transit solutions of the exoplanets XO-2b, HAT-P-18b and WASP 80b. Our solution of the XO-2b transit gave system parameters whose values are close to those of the previous studies. The solutions of the new transits of HAT-P-18b and WASP 80b differ from the previous ones by bigger stellar and planet radii. We obtained new values of the target initial epochs corresponding to slightly different periods. Our investigation reaffirmed that small telescopes can be used successfully for the study of exoplanets orbiting stars brighter than 13 mag.
LiDAR error estimation with WAsP engineering
DEFF Research Database (Denmark)
Bingöl, Ferhat; Mann, Jakob; Foussekis, D.
2008-01-01
The LiDAR measurements, vertical wind profile in any height between 10 to 150m, are based on assumption that the measured wind is a product of a homogenous wind. In reality there are many factors affecting the wind on each measurement point which the terrain plays the main role. To model Li......DAR measurements and predict possible error in different wind directions for a certain terrain we have analyzed two experiment data sets from Greece. In both sites LiDAR and met. mast data have been collected and the same conditions are simulated with Riso/DTU software, WAsP Engineering 2.0. Finally measurement...
The blue gum gall wasp, Selitrichodes globulus La Salle & Gates (Hymenoptera: Eulophidae: Tetrastichinae), is described as an invasive gall inducer on blue gum, Eucalyptus globulus (Myrtaceae), in California....
Energy Technology Data Exchange (ETDEWEB)
Horn, S.; Hanula, J., L.
2004-03-10
Horn, Scott, and James L. Hanula. 2004. A survey of cavity-nesting bees and wasps in loblolly pine stands of the Savannah River Site, Aiken County, South Carolina. 39(3): 464-469. Abstract: In recent years concern over widespread losses in biodiversity has grown to include a possible decline of many native pollinators, primarily bees. Factors such as habitat fragmentation, agricultural practices, use of pesticides, the introduction of invasive species, or changes in land use may negatively impact these vital organisims. Most reported studies show that human impacts on pollinators are overwhelmingly negative. Reductions in pollinator populations may profoundly impact plant population dynamics and ecosystem function. Little baseline data exists on the diversity and relative abundance of bees and wasps in southern forests. The objective of this study was to develop a simple, effective method of surveying cavity-nesting bees and wasps and to determine species diversity in mature forests of loblolly pine, the most widely planted tree species in the southern United States.
Partial avoidance of female inflorescences of a dioecious fig by their mutualistic pollinating wasps
Anstett, M. C.; Gibernau, M.; Hossaert-McKey, M.
1998-01-01
Every dioecious species of fig is pollinated by a specific wasp that only reproduces within the inflorescences of male trees. Pollinators usually die within the closed urn-shaped inflorescence (fig or syconium) they visit. Thus pollinators that enter female syconia allow seed production but die without reproducing. In a previous study, pollinators of one dioecious fig where male and female trees flower synchronously, Ficus hispida, did not exhibit differential attraction or choice between inflorescences of the two sexes. Here we show that Blastophaga psenes, the pollinator of another dioecious species of different lineage, the common fig (F. carica), significantly avoided female syconia, when we experimentally induce a situation of choice. Paradoxically, choosiness can be demonstrated in F. carica where usually wasps do not face a choice because male and female trees do not flower synchronously. We discuss how the mutualism may be stable despite this discrimination and hypothesize why the two species of fig-pollinators exhibit different behaviour on dioecious figs.
Tsutsui, Y; Maeto, K; Hamaguchi, K; Isaki, Y; Takami, Y; Naito, T; Miura, K
2014-06-01
Although apomixis is the most common form of parthenogenesis in diplodiploid arthropods, it is uncommon in the haplodiploid insect order Hymenoptera. We found a new type of spontaneous apomixis in the Hymenoptera, completely lacking meiosis and the expulsion of polar bodies in egg maturation division, on the thelytokous strain of a parasitoid wasp Meteorus pulchricornis (Wesmael) (Braconidae, Euphorinae) on pest lepidopteran larvae Spodoptera litura (Fabricius) (Noctuidae). The absence of the meiotic process was consistent with a non-segregation pattern in the offspring of heterozygous females, and no positive evidence was obtained for the induction of thelytoky by any bacterial symbionts. We discuss the conditions that enable the occurrence of such rare cases of apomictic thelytoky in the Hymenoptera, suggesting the significance of fixed heterosis caused by hybridization or polyploidization, symbiosis with bacterial agents, and occasional sex. Our finding will encourage further genetic studies on parasitoid wasps to use asexual lines more wisely for biological control.
Magdaraog, P.M.; Harvey, J.A.; Tanaka, T.; Gols, R.
2012-01-01
1. Intrinsic competition was compared in three species of braconid wasps, the solitary Meteorus pulchricornis Wesmael, and the gregarious Cotesia kariyai (Watanabe) and Cotesia ruficrus Haliday in caterpillars of their common host, the armyworm Mythimna separata Walker. Competition was determined in
Plants attract parasitic wasps to defend themselves against insect pests by releasing hexenol.
Directory of Open Access Journals (Sweden)
Jianing Wei
2007-09-01
Full Text Available Plant volatiles play an important role in defending plants against insect attacks by attracting their natural enemies. For example, green leaf volatiles (GLVs and terpenoids emitted from herbivore-damaged plants were found to be important in the host location of parasitic wasps. However, evidence of the functional roles and mechanisms of these semio-chemicals from a system of multiple plants in prey location by the parasitoid is limited. Little is known about the potential evolutionary trends between herbivore-induced host plant volatiles and the host location of their parasitoids.The present study includes hierarchical cluster analyses of plant volatile profiles from seven families of host and non-host plants of pea leafminer, Liriomyza huidobrensis, and behavioral responses of a naive parasitic wasp, Opius dissitus, to some principal volatile compounds. Here we show that plants can effectively pull wasps, O. dissitus, towards them by releasing a universally induced compound, (Z-3-hexenol, and potentially keep these plants safe from parasitic assaults by leafminer pests, L. huidobrensis. Specifically, we found that volatile profiles from healthy plants revealed a partly phylogenetic signal, while the inducible compounds of the infested-plants did not result from the fact that the induced plant volatiles dominate most of the volatile blends of the host and non-host plants of the leafminer pests. We further show that the parasitoids are capable of distinguishing the damaged host plant from the non-host plant of the leafminers.Our results suggest that, as the most passive scenario of plant involvement, leafminers and mechanical damages evoke similar semio-chemicals. Using ubiquitous compounds, such as hexenol, for host location by general parasitoids could be an adaptation of the most conservative evolution of tritrophic interaction. Although for this, other compounds may be used to improve the precision of the host location by the parasitoids.
Gastral drumming: a nest-based food-recruitment signal in a social wasp
Taylor, Benjamin J.; Jeanne, Robert L.
2018-04-01
Many social insect species produce signals that either recruit foragers to a specific food source or simply activate more nestmates to become foragers. Both are means of enhancing resource exploitation by increasing the number of individuals devoted to gathering profitable resources. Gastral drumming (GD) has been documented in several species of yellowjackets and hornets (Vespidae: Vespinae). It has been hypothesized that it is a hunger signal, but there is little empirical evidence to support this claim. An alternative hypothesis is that GD recruits workers to forage for food. Here, we report the results of a test between the hunger-signal and food-recruitment hypotheses in the German yellowjacket wasp, Vespula germanica. We show that the rate of performance of GD decreased when colonies were deprived of food and increased when supplemental food was provided. Playback of GD caused increased rates of (1) movement in the nest, (2) trophallaxis, and (3) worker departures from the nest. Together, these results support the conclusion that GD is not a hunger signal as previously asserted but instead is a nest-based food-recruitment signal, the first to be reported for a social wasp.
Control experiments with yellow jacket wasps (Hymenoptera: Vespidae) injuring cattle in Israel.
Braverman, Y; Chizov-Ginzburg, A; Yeruham, I; Kolsky, O; Saran, A
1998-04-01
Injuries caused by the German yellow jacket Vespula germanica F. to dry and lactating dairy cows (Bos tourus) in 5 herds in Israel were monitored and adversely affected < or = 65% of the cows. Elimination of large alternative protein sources (placentas, sewage containing milk from the milking parlor), and prebaiting with high-quality minced meat (or fish) in adequate numbers of baiting cages around the dairy farm for several days, are necessary for successful control. Significant control was achieved after a shorter period of time when the dairy farm was surrounded by a smaller area of uncultivated land than by a larger area. At some dairy farms there were significant differences among numbers of wasps visiting the various cage sites and significant variability between baiting days. Efficient and significant control was achieved by minced meat bait containing 1.5% acephate (orthene) and 2% microencapsulated diazinon (Antikan). Wasps were totally repelled by minced meat bait containing 2.25% of a plant-derived bioinsecticide derived from Meliaceae (Ag1000). The potential of using Ag 1000 for repelling yellow jackets from teats and udders of dairy cows is discussed.
International Nuclear Information System (INIS)
Hernandez-Fuentes, Luis M.; Urias-Lopez, Mario A.; Bautista-Martinez, Nestor
2010-01-01
The sour sop Annona muricata is an important fruit for national market, and for exportation, but the crop is affected by pests and diseases. The seed borer wasp Bephratelloides cubensis Ashmead is the pest that produces the highest damage to the crop in Mexico. Sixty percent of damaged fruits and 5-50 seeds per fruit have been registered, with 25% reduction in yield. In Nayarit, Mexico, 100% of damaged fruits were recorded. In this State, an experiment with sour sop was conducted to study the life cycle under fi eld conditions and to determine diurnal behavior of the female of B. cubensis. The highest activity of the wasp was observed between 12:00 h and 13:00 h (35 degree C, 54% RH and 409.34 luxes). Females oviposited in fruits with a diameter of 3.1-7.6 cm. Larvae of B. cubensis developed five instars, adults survived no longer than 22 days, and female survived longer than males; they lived 22 and 15 days, respectively. Life cycle of B. cubensis varied from 69 to 122 days. (author)
Activity cycle of the pollen wasp, Trimeria howardi (Hymenoptera: Vespidae in Southeastern Brasil
Directory of Open Access Journals (Sweden)
Maria Rita Mech
1999-12-01
Full Text Available Among the wasps, the Masarinae are a peculiar subfamily. It is the only group of wasps that provisions brood cells with pollen and nectar. The studied species Trimeria howardi Bertoni, 1911, was until recently abundant in Ribeirão Preto, São Paulo, southeastern Brazil. This paper deals with plant species visited by T. howardi, in relation to the species’ annual cycle of activity, based on periods of nest foundation, flight activity, and development stages of immatures present in the cells. During the study period (five years T. howardi visited four species of plants in two botanical families: Bidens pilosa L.(Asteraceae; Xanthium spinosum L. (Asteraceae; Stylosanthes guianensis (Aulb. Sw. (Leguminosae, and Zornia diphylla (L. Pers. (Leguminosae. Based on the number of visited families, T. howardi can be considered a narrow polylectic species. In general, the species annual activity cycle consists of three phases: Active phase: January to July; Inactive phase: August - September; Active phase: October to December. The annual cycle is bivoltine or multivoltine and the diapause is facultative, because it occurs in a single generation during the year.
WASP-ASSOCIATED FACTORS ACT IN INTERSPECIES COMPETITION DURING MULTIPARASITISM.
Magdaraog, Peter M; Tanaka, Toshiharu; Harvey, Jeffrey A
2016-06-01
Coexistence or displacement of parasitoids in hosts during intrinsic competitive interactions between different parasitoid species (multiparasitism) may depend on their life history traits and behavior. Intense competition for possession of hosts may lead to the elimination of the inferior competitor through physical attack and/or physiological suppression. However, the mechanisms of physiological suppression during multiparasitism remain unclear. Previous work has shown that first instar larvae of the solitary endoparasitoid Meteorus pulchricornis possess well-developed mandibles that are used to kill competitors. Two gregarious endoparasitoids, Cotesia kariyai and C. rufricus, share host resources especially when the time gap of oviposition is short. Here, we investigated the physiological influence of wasp-regulatory factors of the three endoparasitoids, M. pulchricornis, C. kariyai, and C. ruficrus, in their common host Mythimna separata. We found that MpVLP alone (or with venom) deleteriously affected the development of the two gregarious species. Similarly, CkPDV plus venom had toxic effect on M. pulchricornis eggs and immature larvae, although they were not harmful to immature stages of C. ruficrus. Cotesia kariyai and C. ruficrus were able to coexist mainly through the expression of regulatory factors and both could successfully emerge from a multiparasitized host. The injection of CkPDV plus venom after oviposition in L5 host larvae facilitated C. ruficrus development and increased the rate of successful parasitism from 9% to 62%. This suggests that the two gregarious parasitoid wasps exhibit strong phylogenetic affinity, favoring their coexistence and success in multiparasitized hosts. © 2016 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Héctor A. Vargas
2014-06-01
Full Text Available Prey identification in nests of the potter wasp Hypodynerus andeus (Packard (Hymenoptera, Vespidae, Eumeninae using DNA barcodes. Geometrid larvae are the only prey known for larvae of the Neotropical potter wasp Hypodynerus andeus (Packard, 1869 (Hymenoptera, Vespidae, Eumeninae in the coastal valleys of the northern Chilean Atacama Desert. A fragment of the mitochondrial gene cytochrome oxidase c subunit 1 was amplified from geometrid larvae collected from cells of H. andeus in the Azapa Valley, Arica Province, and used to provide taxonomic identifications. Two species, Iridopsis hausmanni Vargas, 2007 and Macaria mirthae Vargas, Parra & Hausmann, 2005 were identified, while three others could be identified only at higher taxonomic levels, because the barcode reference library of geometrid moths is still incomplete for northern Chile.
Energy Technology Data Exchange (ETDEWEB)
Stabentheiner, Anton, E-mail: anton.stabentheiner@uni-graz.at [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria); Kovac, Helmut, E-mail: he.kovac@uni-graz.at [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria); Hetz, Stefan K. [Department of Animal Physiology/Systems Neurobiology and Neural Computation, Philippstrasse 13-Leonor Michaelis Haus, Humboldt-Universitaet zu Berlin, 10115 Berlin (Germany); Kaefer, Helmut; Stabentheiner, Gabriel [Institut fuer Zoologie, Karl-Franzens-Universitaet Graz, Universitaetsplatz 2, A-8010 Graz (Austria)
2012-04-20
Highlights: Black-Right-Pointing-Pointer We demonstrate the benefits of a combined use of infrared thermography with respiratory measurements in insect ecophysiological research. Black-Right-Pointing-Pointer Infrared thermography enables repeated investigation of behaviour and thermoregulation without behavioural impairment. Black-Right-Pointing-Pointer Comparison with respirometry brings new insights into the mechanisms of energetic optimisation of bee and wasp foraging. Black-Right-Pointing-Pointer Combination of methods improves interpretation of respiratory traces in determinations of insect critical thermal limits. - Abstract: Endothermic insects like honeybees and some wasps have to cope with an enormous heat loss during foraging because of their small body size in comparison to endotherms like mammals and birds. The enormous costs of thermoregulation call for optimisation. Honeybees and wasps differ in their critical thermal maximum, which enables the bees to kill the wasps by heat. We here demonstrate the benefits of a combined use of body temperature measurement with infrared thermography, and respiratory measurements of energy turnover (O{sub 2} consumption or CO{sub 2} production via flow-through respirometry) to answer questions of insect ecophysiological research, and we describe calibrations to receive accurate results. To assess the question of what foraging honeybees optimise, their body temperature was compared with their energy turnover. Honeybees foraging from an artificial flower with unlimited sucrose flow increased body surface temperature and energy turnover with profitability of foraging (sucrose content of the food; 0.5 or 1.5 mol/L). Costs of thermoregulation, however, were rather independent of ambient temperature (13-30 Degree-Sign C). External heat gain by solar radiation was used to increase body temperature. This optimised foraging energetics by increasing suction speed. In determinations of insect respiratory critical thermal limits
A Comparison of BLISS and PLD on Low-SNR WASP-29b Spitzer Observations
Challener, Ryan; Harrington, Joseph; Cubillos, Patricio E.; Blecic, Jasmina; Deming, Drake; Hellier, Coel
2018-01-01
We present an analysis of Spitzer secondary eclipse observations of exoplanet WASP-29b. WASP-29b is a Saturn-sized, short-period exoplanet with mass 0.24 ± 0.02 Jupiter masses and radius 0.84 ± 0.06 Jupiter radii (Hellier et al., 2010). We measure eclipse depths and midpoints using our Photometry for Orbits, Eclipses, and Transits (POET) code, which does photometry and light-curve modeling with a BiLinearly Interpolated Subpixel Sensitivity (BLISS) map, and our Zen Eliminates Noise (ZEN) code, which takes POET photometry and applies Pixel-Level Decorrelation (PLD). BLISS creates a physical map of pixel gain variations, and is thereby independent of any astrophysical effects. PLD takes a mathematical approach, using relative variations in pixel values near the target to eliminate position-correlated noise. The results are consistent between the methods, except in one outlier observation where neither model could effectively remove correlated noise in the light curve. Using the eclipse timings, along with previous transit observations and radial velocity data, we further refine the orbit of WASP-29b, and, when excluding the outlier, determine an eccentricity between 0.037 and 0.056. We performed atmospheric retrieval with our Bayesian Atmospheric Radiative Transfer (BART) code but find that, when the outlier is discarded, the planet is consistent with a blackbody, and molecular abundances cannot be constrained. This work is based on observations made with the Spitzer Space Telescope, which is operated by the Jet Propulsion Laboratory, California Institute of Technology under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NNX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.
Directory of Open Access Journals (Sweden)
Lucyna Twerd
Full Text Available Published sources document a loss of biodiversity at an extreme rate, mainly because natural and semi-natural ecosystems are becoming fragmented and isolated, thus losing their biological functions. These changes significantly influence biological diversity, which is a complex phenomenon that changes over time. Contemporary ecologists must therefore draw attention to anthropogenic replacement habitats and increase their conservation status. In our studies we show the positive role of soda ash dumping grounds as an alternative habitat for digger wasps, especially the thermophilic species.In the years 2007-2010 we carried out investigations in postindustrial soda ash dumping grounds located in Central Poland. We demonstrated that these areas serve as replacement habitats for thermophilic species of Spheciformes and, indirectly, for their potential prey. The studies were conducted in three microhabitat types, varying in soil moisture, salinity and alkalinity, that were changing in the course of ecological succession. We trapped 2571 specimens belonging to 64 species of digger wasps. Species typical of open sunny spaces comprised 73% of the whole inventory. The obtained results suggest that the stage of succession determines the richness, abundance and diversity of Spheciformes. The most favorable conditions for digger wasps were observed in habitats at late successional stages.Our results clearly showed that these habitats were replacement habitats for thermophilous Spheciformes, including rare taxa that require genetic, species and ecosystem protection, according to the Biodiversity Convention. We showed that some types of industry might play a positive role in the preservation of taxa in the landscape, and that even degraded industrial wasteland can replace habitats under anthropopressure, serving as refugia of biological diversity, especially for disturbance-dependent species.
Colony stage and not facultative policing explains pattern of worker reproduction in the Saxon wasp
DEFF Research Database (Denmark)
Bonckaert, W.; van Zweden, Jelle Stijn; D'Ettorre, Patrizia
2011-01-01
Inclusive fitness theory predicts that in colonies of social Hymenoptera headed by a multiple-mated queen, workers should benefit from policing eggs laid by other workers. Foster & Ratnieks provided evidence that in the vespine wasp Dolichovespula saxonica, workers police other workers’ eggs only...
Mattiacci, L.; Dicke, M.; Posthumus, M.A.
1995-01-01
Cabbage plants respond to caterpillar (Pieris brassicae) herbivory by releasing a mixture of volatiles that makes them highly attractive to parasitic wasps (Cotesia glomerata) that attack the herbivores. Cabbage leaves that are artificially damaged and subsequently treated with gut regurgitant of P.
Physical properties of the WASP-67 planetary system from multi-colour photometry
Mancini, L.; Southworth, J.; Ciceri, S.; Calchi Novati, S.; Dominik, M.; Henning, Th.; Jørgensen, U. G.; Korhonen, H.; Nikolov, N.; Alsubai, K. A.; Bozza, V.; Bramich, D. M.; D'Ago, G.; Figuera Jaimes, R.; Galianni, P.; Gu, S.-H.; Harpsøe, K.; Hinse, T. C.; Hundertmark, M.; Juncher, D.; Kains, N.; Popovas, A.; Rabus, M.; Rahvar, S.; Skottfelt, J.; Snodgrass, C.; Street, R.; Surdej, J.; Tsapras, Y.; Vilela, C.; Wang, X.-B.; Wertz, O.
2014-08-01
Context. The extrasolar planet WASP-67 b is the first hot Jupiter definitively known to undergo only partial eclipses. The lack of the second and third contact points in this planetary system makes it difficult to obtain accurate measurements of its physical parameters. Aims: By using new high-precision photometric data, we confirm that WASP-67 b shows grazing eclipses and compute accurate estimates of the physical properties of the planet and its parent star. Methods: We present high-quality, multi-colour, broad-band photometric observations comprising five light curves covering two transit events, obtained using two medium-class telescopes and the telescope-defocusing technique. One transit was observed through a Bessel-R filter and the other simultaneously through filters similar to Sloan g'r'i'z'. We modelled these data using jktebop. The physical parameters of the system were obtained from the analysis of these light curves and from published spectroscopic measurements. Results: All five of our light curves satisfy the criterion for being grazing eclipses. We revise the physical parameters of the whole WASP-67 system and, in particular, significantly improve the measurements of the planet's radius (Rb = 1.091 ± 0.046 RJup) and density (ρb = 0.292 ± 0.036 ρJup), as compared to the values in the discovery paper (Rb = 1.4 -0.2+0.3 RJup and ρb = 0.16 ± 0.08 ρJup). The transit ephemeris was also substantially refined. We investigated the variation of the planet's radius as a function of the wavelength, using the simultaneous multi-band data, finding that our measurements are consistent with a flat spectrum to within the experimental uncertainties. Based on data collected with GROND at the MPG 2.2 m telescope and DFOSC at the Danish 1.54 m telescope.Full Table 2 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/568/A127
Energy Technology Data Exchange (ETDEWEB)
O' Rourke, Joseph G.; Knutson, Heather A.; Désert, Jean-Michel [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Zhao, Ming [Department of Astronomy and Astrophysics, 525 Davey Laboratory, The Pennsylvania State University, University Park, PA 16802 (United States); Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 05844 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Howard, Andrew W. [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Lewis, Nikole K. [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Todorov, Kamen O. [Institute for Astronomy, ETH Zürich, Wolfgang-Pauli-Strasse 27, 8093 Zürich (Switzerland)
2014-02-01
We report secondary eclipse photometry of two hot Jupiters, WASP-48b and HAT-P-23b, at 3.6 and 4.5 μm taken with the InfraRed Array Camera aboard the Spitzer Space Telescope during the warm Spitzer mission and in the H and K{sub S} bands with the Wide Field IR Camera at the Palomar 200 inch Hale Telescope. WASP-48b and HAT-P-23b are Jupiter-mass and twice Jupiter-mass objects orbiting an old, slightly evolved F star and an early G dwarf star, respectively. In the H, K{sub S} , 3.6 μm, and 4.5 μm bands, respectively, we measure secondary eclipse depths of 0.047% ± 0.016%, 0.109% ± 0.027%, 0.176% ± 0.013%, and 0.214% ± 0.020% for WASP-48b. In the K{sub S} , 3.6 μm, and 4.5 μm bands, respectively, we measure secondary eclipse depths of 0.234% ± 0.046%, 0.248% ± 0.019%, and 0.309% ± 0.026% for HAT-P-23b. For WASP-48b and HAT-P-23b, respectively, we measure delays of 2.6 ± 3.9 minutes and 4.0 ± 2.4 minutes relative to the predicted times of secondary eclipse for circular orbits, placing 2σ upper limits on |ecos ω| of 0.0053 and 0.0080, both of which are consistent with circular orbits. The dayside emission spectra of these planets are well-described by blackbodies with effective temperatures of 2158 ± 100 K (WASP-48b) and 2154 ± 90 K (HAT-P-23b), corresponding to moderate recirculation in the zero albedo case. Our measured eclipse depths are also consistent with one-dimensional radiative transfer models featuring varying degrees of recirculation and weak thermal inversions or no inversions at all. We discuss how the absence of strong temperature inversions on these planets may be related to the activity levels and metallicities of their host stars.
Mendes, Maria Anita; Palma, Mario Sergio
2006-11-01
Two bradykinin-related peptides (Protopolybiakinin-I and Protopolybiakinin-II) were isolated from the venom of the social wasp Protopolybia exigua by RP-HPLC, and sequenced by Edman degradation method. Peptide sequences of Protopolybiakinin-I and Protopolybiakinin-II were DKNKKPIRVGGRRPPGFTR-OH and DKNKKPIWMAGFPGFTPIR-OH, respectively. Synthetic peptides with identical sequences to the bradykinin-related peptides and their biological functions were characterized. Protopolybiakinin-I caused less potent constriction of the isolated rat ileum muscles than bradykinin (BK). In addition, it caused degranulation of mast cells which was seven times more potent than BK. This peptide causes algesic effects due to the direct activation of B(2)-receptors. Protopolybiakinin-II is not an agonist of rat ileum muscle and had no algesic effects. However, Protopolybiakinin-II was found to be 10 times more potent as a mast cell degranulator than BK. The amino acid sequence of Protopolybiakinin-I is the longest among the known wasp kinins.
Bengochea, Paloma; Christiaens, Olivier; Amor, Fermín; Viñuela, Elisa; Rougé, Pierre; Medina, Pilar; Smagghe, Guy
2012-07-01
The moulting accelerating compounds (MACs) or ecdysteroid agonists represent a selective group of insecticides acting upon binding to the ecdysteroid receptor (EcR) and leading to lethal premature moulting in larval stages and aborted reproduction in adults. Psyttalia concolor Szèpl. is a useful parasitic wasp attacking important tephritid pests such as the medfly and olive fruit fly. Contact and oral exposure in the laboratory of female parasitic wasps to the dibenzoylhydrazine-based methoxyfenozide, tebufenozide and RH-5849 did not provoke negative effects. No mortality and no reduction in beneficial capacity were observed. The ligand-binding domain (LBD) of the EcR of P. concolor was sequenced, and a homology protein model was constructed which confirmed a cavity structure with 12 α-helices, harbouring the natural insect moulting hormone 20-hydroxyecdysone. However, a steric clash occurred for the MAC insecticides owing to a restricted extent of the ligand-binding cavity of the PcLBD-EcR, while they did dock well in that of susceptible insects. The insect toxicity assays demonstrated that MACs are selective for P. concolor. The modelling/docking experiments are indications that these insecticides do not bind with the LBD-EcR of P. concolor and support the theory that they show no biological effects in the parasitic wasp. These data may help in explaining the compatible use of MACs together with parasitic wasps in IPM programmes. Copyright © 2012 Society of Chemical Industry.
Reproduction and recruitment in perennial colonies of the introduced wasp Vespula germanica.
Goodisman, M A; Matthews, R W; Spradbery, J P; Carew, M E; Crozier, R H
2001-01-01
We investigated the genetic structure of perennial colonies of the yellowjacket wasp (Vespula germanica) in its introduced range in Australia and New Zealand. The nuclear genotypes of 712 gynes from 21 colonies, 147 workers from 5 colonies, and 81 males from 4 colonies were assayed at three polymorphic microsatellite loci. The mitochondrial haplotypes of all wasps also were determined for a 450-bp region of the mtDNA using double-stranded conformational polymorphism (DSCP) analysis. We found that multiple reproductives were needed to explain the genotypes of gynes, workers, and males in 7 of 21, 2 of 5, and 2 of 4 colonies, respectively, and that nestmate relatedness of these three castes equaled 0.42, 0.16, and 0.22, respectively. The mitochondrial data revealed that all individuals shared the same mtDNA haplotype in 20 of the 21 colonies. However, in one colony, gynes and workers displayed multiple mtDNA haplotypes, indicating that nonnestmate recruitment had occurred. Overall the genetic structure within the majority of perennial colonies conformed to expectations based on the biology of V. germanica and kin selection theory for polygyne colonies; multiple reproductives successfully produced offspring and were recruited into their natal nests, thereby maintaining relatively high relatedness between interacting individuals.
The nest as fortress: Defensive behavior of Polybia emaciata, a mud-nesting eusocial wasp
Directory of Open Access Journals (Sweden)
Sean O'Donnell
2002-02-01
Full Text Available The swarm-founding wasp Polybia emaciata is unusual among eusocial Vespidae because it uses mud, rather than wood pulp, as its primary nest construction material. Polybia emaciata nests are more durable than similarly sized paper nests. We tested the hypothesis that the defensive behavior of this wasp may have been modified to take advantage of their strong nests in defense against vertebrate attacks. We simulated vertebrate disturbances by tapping on, and breathing in, P. emaciata. nests and similarly sized P. occidentalis paper nests in the same location at the same time. Polybia emaciata. responses to disturbance were qualitatively different from those of P. occidentalis. The latter exit the nest and attack, while P. emaciata. workers typically fled or entered the nest, attacking only after repeated and extended disturbances. We conclude that durable nest material may permit predator avoidance behavior in P. emaciata.. We compare the defensive responses of P. emaciata. workers with those of other swarm-founding Vespidae, and discuss several selective forces that could cause the evolution of species variation in nest defense behavior.
Jia, Da; Gomez, Timothy S; Metlagel, Zoltan; Umetani, Junko; Otwinowski, Zbyszek; Rosen, Michael K; Billadeau, Daniel D
2010-06-08
We recently showed that the Wiskott-Aldrich syndrome protein (WASP) family member, WASH, localizes to endosomal subdomains and regulates endocytic vesicle scission in an Arp2/3-dependent manner. Mechanisms regulating WASH activity are unknown. Here we show that WASH functions in cells within a 500 kDa core complex containing Strumpellin, FAM21, KIAA1033 (SWIP), and CCDC53. Although recombinant WASH is constitutively active toward the Arp2/3 complex, the reconstituted core assembly is inhibited, suggesting that it functions in cells to regulate actin dynamics through WASH. FAM21 interacts directly with CAPZ and inhibits its actin-capping activity. Four of the five core components show distant (approximately 15% amino acid sequence identify) but significant structural homology to components of a complex that negatively regulates the WASP family member, WAVE. Moreover, biochemical and electron microscopic analyses show that the WASH and WAVE complexes are structurally similar. Thus, these two distantly related WASP family members are controlled by analogous structurally related mechanisms. Strumpellin is mutated in the human disease hereditary spastic paraplegia, and its link to WASH suggests that misregulation of actin dynamics on endosomes may play a role in this disorder.
Tokusumi, Yumiko; Tokusumi, Tsuyoshi; Schulz, Robert A
2017-05-13
In vertebrates, interaction between the nervous system and immune system is important to protect a challenged host from stress inputs from external sources. In this study, we demonstrate that sensory neurons are involved in the cellular immune response elicited by wasp infestation of Drosophila larvae. Multidendritic class IV neurons sense contacts from external stimuli and induce avoidance behaviors for host defense. Our findings show that inactivation of these sensory neurons impairs the cellular response against wasp parasitization. We also demonstrate that the nociception genes encoding the mechanosensory receptors Painless and Piezo, both expressed in class IV neurons, are essential for the normal cellular immune response to parasite challenge. Copyright © 2017. Published by Elsevier Inc.
Vugt, van J.J.F.A.; Hoedjes, K.M.; Geest, van de H.C.; Schijlen, E.G.W.M.; Vet, L.E.M.; Smid, H.M.
2015-01-01
Even though learning and memory are universal traits in the Animal Kingdom, closely related species reveal substantial variation in learning rate and memory dynamics. To determine the genetic background of this natural variation, we studied two congeneric parasitic wasp species, Cotesia glomerata
Van Vugt, Joke J. F. A.; Hoedjes, Katja M.; Van de Geest, Henri C.; Schijlen, Elio W. G. M.; Vet, Louise E. M.; Smid, Hans M.
2015-01-01
BACKGROUND: Even though learning and memory are universal traits in the Animal Kingdom, closely related species reveal substantial variation in learning rate and memory dynamics. To determine the genetic background of this natural variation, we studied two congeneric parasitic wasp species, Cotesia
Putting your sons in the right place: the spatial distribution of fig wasp offspring inside figs
Zavodna, M.; Compton, S.G.; Biere, A.; Gilmartin, P.M.; Van Damme, J.M.M.
2005-01-01
1. Pollinating fig wasps (Hymenoptera, Agaonidae) display sex ratio adjustment, producing less female-biased combined sex ratios as the number of ovipositing females (foundresses) inside a fig increases. Because males have low mobility, the oviposition sites (galled ovules) chosen by each foundress
High-precision multiwavelength eclipse photometry of the ultra-hot gas giant exoplanet WASP-103 b
Delrez, L.; Madhusudhan, N.; Lendl, M.; Gillon, M.; Anderson, D. R.; Neveu-VanMalle, M.; Bouchy, F.; Burdanov, A.; Collier-Cameron, A.; Demory, B.-O.; Hellier, C.; Jehin, E.; Magain, P.; Maxted, P. F. L.; Queloz, D.; Smalley, B.; Triaud, A. H. M. J.
2018-02-01
We present 16 occultation and three transit light curves for the ultra-short period hot Jupiter WASP-103b, in addition to five new radial velocity measurements. We combine these observations with archival data and perform a global analysis of the resulting extensive data set, accounting for the contamination from a nearby star. We detect the thermal emission of the planet in both the z΄ and KS bands, the measured occultation depths being 699±110 ppm (6.4σ) and 3567_{-350}^{+400} ppm (10.2σ), respectively. We use these two measurements, together with recently published HST/WFC3 data, to derive joint constraints on the properties of WASP-103b's dayside atmosphere. On one hand, we find that the z΄ band and WFC3 data are best fit by an isothermal atmosphere at 2900 K or an atmosphere with a low H2O abundance. On the other hand, we find an unexpected excess in the KS band measured flux compared to these models, which requires confirmation with additional observations before any interpretation can be given. From our global data analysis, we also derive a broad-band optical transmission spectrum that shows a minimum around 700 nm and increasing values towards both shorter and longer wavelengths. This is in agreement with a previous study based on a large fraction of the archival transit light curves used in our analysis. The unusual profile of this transmission spectrum is poorly matched by theoretical spectra and is not confirmed by more recent observations at higher spectral resolution. Additional data, in both emission and transmission, are required to better constrain the atmospheric properties of WASP-103b.
Directory of Open Access Journals (Sweden)
Carlos Restrepo-Giraldo
2012-01-01
Full Text Available We studied the temporal activity pattern of the spider wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae in a disturbed lower montane rainforest, which is located in the city of Manizales, Colombia, at an altitude of 2,150 m. Females of this species are diurnal with two peaks of activity: one in the morning and the other in the afternoon. During the morning, nectar foraging occurred at Baccharis latifolia. During the afternoon, females hunted for tarantulas of the genus Pamphobeteus (Araneae: Theraphosidae, which were dragged backwards to the nest by the wasp. The nest was excavated before hunting. This is the first description of the behavior of Pepsis montezuma.
Czech Academy of Sciences Publication Activity Database
Čeřovský, Václav; Pohl, J.; Yang, Z.; Alam, N.; Attygalle, A. B.
2007-01-01
Roč. 13, č. 7 (2007), s. 445-450 ISSN 1075-2617 Institutional research plan: CEZ:AV0Z40550506 Keywords : mastoparans * wasp kinins * chemotactic peptides Subject RIV: CC - Organic Chemistry Impact factor: 1.768, year: 2007
Stabentheiner, Anton; Kovac, Helmut; Hetz, Stefan K; Käfer, Helmut; Stabentheiner, Gabriel
2012-04-20
Endothermic insects like honeybees and some wasps have to cope with an enormous heat loss during foraging because of their small body size in comparison to endotherms like mammals and birds. The enormous costs of thermoregulation call for optimisation. Honeybees and wasps differ in their critical thermal maximum, which enables the bees to kill the wasps by heat. We here demonstrate the benefits of a combined use of body temperature measurement with infrared thermography, and respiratory measurements of energy turnover (O(2) consumption or CO(2) production via flow-through respirometry) to answer questions of insect ecophysiological research, and we describe calibrations to receive accurate results.To assess the question of what foraging honeybees optimise, their body temperature was compared with their energy turnover. Honeybees foraging from an artificial flower with unlimited sucrose flow increased body surface temperature and energy turnover with profitability of foraging (sucrose content of the food; 0.5 or 1.5 mol/L). Costs of thermoregulation, however, were rather independent of ambient temperature (13-30 °C). External heat gain by solar radiation was used to increase body temperature. This optimised foraging energetics by increasing suction speed.In determinations of insect respiratory critical thermal limits, the combined use of respiratory measurements and thermography made possible a more conclusive interpretation of respiratory traces.
46200 Planning and Development of Wind Farms: Wind resource assessment using the WAsP software
DEFF Research Database (Denmark)
Mortensen, Niels Gylling
These course notes are intended for the three-week course 46200 Planning and Development of Wind Farms given each year at the Technical University of Denmark. The purpose of the course notes is to give an introduction to wind resource assessment and siting issues using the WAsP suite of programs....
Gols, R.; Dam, van N.M.; Raaijmakers, C.E.; Dicke, M.; Harvey, J.A.
2009-01-01
In recent years, increasing attention has been paid in exploring the role of direct plant defence, through the production of allelochemicals, on the performance of parasitoid wasps and their hosts. However, few studies have determined if parasitoids can detect differences in plant quality and thus
OBSERVATIONS OF THE WASP-2 SYSTEM BY THE APOSTLE PROGRAM
Energy Technology Data Exchange (ETDEWEB)
Becker, Andrew C.; Kundurthy, Praveen; Agol, Eric; Barnes, Rory; Williams, Benjamin F.; Rose, Amy E. [Astronomy Department, University of Washington, Seattle, WA 98195 (United States)
2013-02-10
We present transit observations of the WASP-2 exoplanet system by the Apache Point Survey of Transit Lightcurves of Exoplanets (APOSTLE) program. Model fitting to these data allows us to improve measurements of the hot-Jupiter exoplanet WASP-2b and its orbital parameters by a factor of {approx}2 over prior studies; we do not find evidence for transit depth variations. We do find reduced {chi}{sup 2} values greater than 1.0 in the observed minus computed transit times. A sinusoidal fit to the residuals yields a timing semi-amplitude of 32 s and a period of 389 days. However, random rearrangements of the data provide similar quality fits, and we cannot with certainty ascribe the timing variations to mutual exoplanet interactions. This inconclusive result is consistent with the lack of incontrovertible transit timing variations (TTVs) observed in other hot-Jupiter systems. This outcome emphasizes that unique recognition of TTVs requires dense sampling of the libration cycle (e.g., continuous observations from space-based platforms). However, even in systems observed with the Kepler spacecraft, there is a noted lack of transiting companions and TTVs in hot-Jupiter systems. This result is more meaningful, and indicates that hot-Jupiter systems, while they are easily observable from the ground, do not appear to be currently configured in a manner favorable to the detection of TTVs. The future of ground-based TTV studies may reside in resolving secular trends, and/or implementation at extreme quality observing sites to minimize atmospheric red noise.
Unravelling reward value: the effect of host value on memory retention in Nasonia parasitic wasps
Hoedjes, K.M.; Kralemann, L.E.M.; Vugt, van J.J.F.A.; Vet, L.E.M.; Smid, H.M.
2014-01-01
Learning can be instrumental in acquiring new skills or optimizing behaviour, but it is also costly in terms of energy and when maladaptive associations are formed: the balance between costs and benefits affects memory dynamics. Numerous studies have demonstrated that memory dynamics of animal
WASP (Write a Scientific Paper) using Excel - 3: Plotting data.
Grech, Victor
2018-02-01
The plotting of data into graphs should be a mandatory step in all data analysis as part of a descriptive statistics exercise, since it gives the researcher an overview of the shape and nature of the data. Moreover, outlier values may be identified, which may be incorrect data, or true outliers, from which important findings (and publications) may arise. This exercise should always precede inferential statistics, when possible, and this paper in the Early Human Development WASP series provides some pointers for doing so in Microsoft Excel™. Copyright © 2018 Elsevier B.V. All rights reserved.
Optimal development path for the Slovenian electrical power system using the WASP and ELBIVIM models
Energy Technology Data Exchange (ETDEWEB)
Bregar, Z; Kosnjek, Z; Potecnik, F [Milan Vidmar Electric Power Research Inst., Ljubljana (Slovenia)
1997-09-01
The paper summarizes the results of the WASP study conducted for Slovenia. A thorough analysis shows that the model is applicable to the Slovenian power system. Parallel operation with the domestic ELBIVIM model is nevertheless recommended in order to extract the maximum benefits from both models. (author). 4 refs, 5 figs, 4 tabs.
Xu, J.; Huigens, M.E.; Orr, D.; Groot, A.T.
2014-01-01
1. Chemical espionage in nature may occur when predators or parasitoids home in on animal or plant communication signals. Parasitoid wasps are known to use pheromones emitted by adults hosts to locate host eggs, larvae or pupae. The response of Trichogramma egg parasitoids to a synthetic sex
Vugt, van J.J.F.A.; Hulst, van der R.G.M.; Pruijssers, A.; Verbaarschot, P.G.H.; Stouthamer, R.; Jong, de H.
2009-01-01
The parasitoid wasp Trichogramma kaykai with a haplo-diploid sex determination has a B chromosome called the paternal sex ratio (PSR) chromosome that confers paternal genome loss during early embryogenesis, resulting in male offspring. So far, it is not well known whether the PSR chromosome has
Directory of Open Access Journals (Sweden)
Marta S. Loiácono
2013-01-01
Full Text Available We provide an overview of diapriid wasps associated with ants in Argentina and the diversity of interactions they have developed with their hosts. As a result, we report 16 species of nine genera of Diapriinae, two new geographic distributions, three new association records, illustrations, and photographs. We highlight myrmecophile symphylic species, with a high degree of integration with the host ants, adaptation being morphological and behavioral. A table with diapriid species and ant hosts is given.
Artificial covering on trap nests improves the colonization of trap-nesting wasps
Taki, Hisatomo; Kevan, Peter G.; Viana, Blandina Felipe; Silva, Fabiana O.; Buck, Matthias
2008-01-01
Acesso restrito: Texto completo. p. 225-229 To evaluate the role that a trap-nest cover might have on sampling methodologies, the abundance of each species of trap-nesting Hymenoptera and the parasitism rate in a Canadian forest were compared between artificially covered and uncovered traps. Of trap tubes exposed at eight forest sites in six trap-nest boxes, 531 trap tubes were occupied and 1216 individuals of 12 wasp species of four predatory families, Vespidae (Eumeninae), Crabronidae...
Stacey, Peter; Butler, Owen
2008-06-01
This paper emphasizes the need for occupational hygiene professionals to require evidence of the quality of welding fume data from analytical laboratories. The measurement of metals in welding fume using atomic spectrometric techniques is a complex analysis often requiring specialist digestion procedures. The results from a trial programme testing the proficiency of laboratories in the Workplace Analysis Scheme for Proficiency (WASP) to measure potentially harmful metals in several different types of welding fume showed that most laboratories underestimated the mass of analyte on the filters. The average recovery was 70-80% of the target value and >20% of reported recoveries for some of the more difficult welding fume matrices were welding fume trial filter samples. Consistent rather than erratic error predominated, suggesting that the main analytical factor contributing to the differences between the target values and results was the effectiveness of the sample preparation procedures used by participating laboratories. It is concluded that, with practice and regular participation in WASP, performance can improve over time.
The function of dart behavior in the paper wasp, Polistes fuscatus.
Sumana, A; Starks, Philip T
2004-05-01
Dominance behavior in Polistes wasps is a composite trait consisting of various discrete behaviors such as darts, lunges, bites, and mounts. The majority of these behaviors are considered "aggressive", and these aggressive behaviors are considered to form a continuum from mild (e.g., darts) to severe (e.g., falling fights). In this paper we focus on darts, the most common of the dominance behaviors, and investigate their function in un-manipulated post-emergent colonies of the primitively eusocial wasp P. fuscatus. Here we show that darts are correlated with the more severe dominance behaviors, and that dominance ranks do not change with the addition or exclusion of darts. We find no correlation, however, between receiving darts and receiving more severe dominance behaviors. This result suggests that darts are not indicative of aggressive reinforcement of dominance, but rather may serve a different function. Our data suggest that the function of darts is to regulate activity on nests. Both foundresses and workers dart inactive workers significantly more often than by chance, and workers respond to a foundress's (but not a worker's) dart by becoming less inactive. We also found that active workers who receive a dart from either a foundress or worker respond mostly by switching from one activity to another. Thus, our data suggest that darts are not aggressive behaviors, that foundresses use this signal to initiate activity, and that foundresses and workers both use the signal to regulate worker activity.
Directory of Open Access Journals (Sweden)
Orlando Tobias Silveira
2015-09-01
Full Text Available ABSTRACTA revision of the taxonomic status and an identification key for wasp species of the genus Mischocyttarus related to M. punctatus (Ducke, 1904 are presented here. Six new species are proposed (M. tayrona Silveira sp. nov.; M. anchicaya Silveira sp. nov.; M. caxiuana Silveira sp. nov.; M. verissimoi Silveira sp. nov.; M. rodriguesi Silveira sp. nov.; M. ryani Silveira sp. nov., raising to nine the number of species in the M. punctatus group. The highest diversity of the group concentrates in northern South America, in Andean areas and Amazonia. New information concerning the very peculiar nests of these wasps is also given.
Energy Technology Data Exchange (ETDEWEB)
Sanchis-Ojeda, Roberto; Isaacson, Howard; Marcy, Geoffrey W.; Weiss, Lauren [Department of Astronomy, University of California, Berkeley, CA 94720 (United States); Winn, Joshua N.; Dai, Fei [Department of Physics, and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Howard, Andrew W.; Sinukoff, Evan [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Petigura, Erik; Rogers, Leslie [Department of Astronomy and Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Albrecht, Simon [Stellar Astrophysics Centre, Department of Physics and Astronomy, Aarhus University, Ny Munkegade 120, DK-8000 Aarhus C (Denmark); Hirano, Teruyuki, E-mail: sanchisojeda@berkeley.edu [Department of Earth and Planetary Sciences, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan)
2015-10-10
We have detected the Rossiter–Mclaughlin effect during a transit of WASP-47b, the only known hot Jupiter with close planetary companions. By combining our spectroscopic observations with Kepler photometry, we show that the projected stellar obliquity is λ = 0° ± 24°. We can firmly exclude a retrograde orbit for WASP-47b, and rule out strongly misaligned prograde orbits. Low obliquities have also been found for most of the other compact multiplanet systems that have been investigated. The Kepler-56 system, with two close-in gas giants transiting their subgiant host star with an obliquity of at least 45{sup ◦}, remains the only clear counterexample.
Energy Technology Data Exchange (ETDEWEB)
Stevenson, Kevin B.; Bean, Jacob L. [Department of Astronomy and Astrophysics, University of Chicago, 5640 South Ellis Avenue, Chicago, IL 60637 (United States); Madhusudhan, Nikku [Institute of Astronomy, University of Cambridge, Madingley Road, Cambridge CB3 0HA (United Kingdom); Harrington, Joseph, E-mail: kbs@uchicago.edu [Planetary Sciences Group, Department of Physics, University of Central Florida, Orlando, FL 32816-2385 (United States)
2014-08-10
WASP-12b was the first planet reported to have a carbon-to-oxygen ratio (C/O) greater than one in its dayside atmosphere. However, recent work to further characterize its atmosphere and confirm its composition has led to incompatible measurements and divergent conclusions. Additionally, the recent discovery of stellar binary companions ∼1'' from WASP-12 further complicates the analyses and subsequent interpretations. We present a uniform analysis of all available Hubble and Spitzer Space Telescope secondary-eclipse data, including previously unpublished Spitzer measurements at 3.6 and 4.5 μm. The primary controversy in the literature has centered on the value and interpretation of the eclipse depth at 4.5 μm. Our new measurements and analyses confirm the shallow eclipse depth in this channel, as first reported by Campo and collaborators and used by Madhusudhan and collaborators to infer a carbon-rich composition. To explain WASP-12b's observed dayside emission spectrum, we implemented several recent retrieval approaches. We find that when we exclude absorption due to C{sub 2}H{sub 2} and HCN, which are not universally considered in the literature, our models require implausibly large atmospheric CO{sub 2} abundances, regardless of the C/O. By including C{sub 2}H{sub 2} and HCN in our models, we find that a physically plausible carbon-rich solution achieves the best fit to the available photometric and spectroscopic data. In comparison, the best-fit oxygen-rich models have abundances that are inconsistent with the chemical equilibrium expectations for hydrogen-dominated atmospheres and are 670 times less probable. Our best-fit solution is also 7.3 × 10{sup 6} times more probable than an isothermal blackbody model.
Directory of Open Access Journals (Sweden)
Pauline O. Lawrence
2002-05-01
Full Text Available An insect poxvirus [entomopoxvirus (EPV] occurs in the poison gland apparatus of female Diachasmimorpha longicaudata , a parasitic wasp of the Caribbean fruit fly, Anastrepha suspensa and other tephritid fruit flies. The DlEPV virion is 250-300 nm in diameter, has a "bumpy" appearance and a unipartite double stranded DNA genome of 290-300 kb. DlEPV DNA restriction fragment profiles differed from those reported for Amsacta moorei EPV (AmEPV and Melanoplus sanguinipes EPV (MsEPV, the only two EPVs whose genomes have been sequenced, and from those reported for vaccinia (Vac, a vertebrate poxvirus (chordopoxvirus, ChPV. Blast search and ClustalW alignment of the amino acids deduced from the 2316 nucleotides of a DlEPV DNA fragment cloned from an EcoR1 genomic library revealed 75-78% homology with the putative DNA-directed RNA polymerases of AmEPV, MsEPV, and two ChPV homologs of the Vac J6R gene. Of the deduced 772 amino acids in the DlEPV sequence, 28.4% are conserved/substituted among the four poxviruses aligned, 12.9% occur in at least one EPV, 6.5% in at least one ChPV, 3.1 % in at least one EPV and one ChPV, and 49.1% occur only in DlEPV. Although the RI-36-1 fragment represents a portion of the gene, it contains nucleotides that encode the NADFDGDE consensus sequence of known DNA-directed RNA polymerases. Western blots using a mouse polyclonal anti-DlEPV serum recognized six major protein bands in combined fractions of sucrose-purified DlEPV, at least one band in homogenates of male and female wasps, and at least two bands in host hemolymph that contained DlEPV virions. A digoxigenin-labeled DlEPV genomic DNA probe recognized DNA in dot-blots of male and female wasps. These results confirm that DlEPV is a true EPV and probably a member of the Group C EPVs. Unlike other EPVs, DlEPV does not express the spheroidin protein. Since it also replicates in both the wasp and fly, members of two different insect Orders, DlEPV may represent a new EPV
Geerdink, Danny; Buter, Jeffrey; van Beek, Teris A.; Minnaard, Adriaan J.
2014-01-01
Virgin females of the parasitoid wasp Trichogramma turkestanica produce minute amounts of a sex pheromone, the identity of which has not been fully established. The enantioselective synthesis of a putative component of this pheromone, (6S,8S,10S)-4,6,8,10-tetramethyltrideca-2E,4E-dien-1-ol (2), is
VizieR Online Data Catalog: WASP-31b:HST/Spitzer transmission spectral survey (Sing+, 2015)
Sing, D. K.; Wakeford, H. R.; Showman, A. P.; Nikolov, N.; Fortney, J. J.; Burrows, A. S.; Ballester, G. E.; Deming, D.; Aigrain, S.; Desert, J.-M.; Gibson, N. P.; Henry, G. W.; Knutson, H.; Lecavelier Des Etangs, A.; Pont, F.; Vidal-Madjar, A.; Williamson, M. W.; Wilson, P. A.
2017-11-01
We observed two transits of WASP-31b with the HST STIS G430L grating during 2012 June 13 and 26, as well as one transit with the STIS G750L during 2012 July 10. In addition to the STIS data, observations of WASP-31b were also conducted in the infrared with WFC3 on the HST. Observations began on 2012 May 13 at 12:53 using the IR G141 grism in forward spatial scan mode over five HST orbits. We analyse two transit observations obtained using the Infrared Array Camera (IRAC) instrument (Programme 90092 with P.I. Desert) on the Spitzer space telescope in the 3.6 μm and 4.5 μm channels in subarray mode (32x32 pixel, or 39 centred on the planets host). The 3.6 μm observation was performed on UT 2013 March 9 (between 06:59 and 11:37) and the 4.5 observation was performed on UT 2013 March 19 (between 12:19 and 16:58). (1 data file).
Directory of Open Access Journals (Sweden)
Michael Ohl
Full Text Available Taxonomy, the science of describing and naming of the living world, is recognized as an important and relevant field in modern biological science. While there is wide agreement on the importance of a complete inventory of all organisms on Earth, the public is partly unaware of the amount of known and unknown biodiversity. Out of the enormous number of undescribed (but already recognized species in natural history museum collections, we selected an attractive example of a wasp, which was presented to museum visitors at a special museum event. We asked 300 visitors to vote on a name for the new species and out of four preselected options, Ampulex dementor Ohl n. sp. was selected. The name, derived from the 'soul sucking' dementors from the popular Harry Potter books is an allusion to the wasps' behavior to selectively paralyze its cockroach prey. In this example, public voting on a scientific name has been shown to be an appropriate way to link museum visitors emotionally to biodiversity and its discovery.
Ohl, Michael; Lohrmann, Volker; Breitkreuz, Laura; Kirschey, Lukas; Krause, Stefanie
2014-01-01
Taxonomy, the science of describing and naming of the living world, is recognized as an important and relevant field in modern biological science. While there is wide agreement on the importance of a complete inventory of all organisms on Earth, the public is partly unaware of the amount of known and unknown biodiversity. Out of the enormous number of undescribed (but already recognized) species in natural history museum collections, we selected an attractive example of a wasp, which was presented to museum visitors at a special museum event. We asked 300 visitors to vote on a name for the new species and out of four preselected options, Ampulex dementor Ohl n. sp. was selected. The name, derived from the 'soul sucking' dementors from the popular Harry Potter books is an allusion to the wasps' behavior to selectively paralyze its cockroach prey. In this example, public voting on a scientific name has been shown to be an appropriate way to link museum visitors emotionally to biodiversity and its discovery.
Directory of Open Access Journals (Sweden)
Batchuluun Buyanjargal
2018-06-01
Full Text Available Ikh Nart Nature Reserve remains poorly studied for invertebrates, especially for vespid wasps. A total of 14 vespid species belonging to seven genera of the subfamily Eumeninae were recorded from diff erent habitats (rocky outcrops, springs, tall vegetation habitats, shrub-lands and short grass steppes in the nature reserve during three-year studies (2015-2017. These species represent 27 percent of the vespid fauna of the desert-steppe zone of Mongolia. We found the highest species richness in areas where water was available (near springs and wells, and the lowest richness in habitats with tall vegetation. Among the diff erent habitat types, vespid species composition was most similar (91% shared species between rocky outcrops and spring habitats. Six vespid species range from Kazakhstan to Mongolian, and one species is sub-endemic to Mongolia. Availability of water sources and nesting sites were possibly the main factors infl uencing the distribution of vespid wasps. It is necessary to conduct comprehensive research into the insect community of Ikh Nart Nature Reserve.
Compositional changes in bee and wasp communities along Neotropical mountain altitudinal gradient.
Directory of Open Access Journals (Sweden)
Lucas Neves Perillo
Full Text Available Climate conditions tend to differ along an altitudinal gradient, resulting in some species groups' patterns of lower species richness with increasing altitude. While this pattern is well understood for tropical mountains, studies investigating possible determinants of variation in beta-diversity at its different altitudes are scarce. We sampled bee and wasp communities (Hymenoptera: Aculeata along an altitudinal gradient (1,000-2,000 m.a.s.l. in a tropical mountainous region of Brazil. Trap nests and Moericke traps were established at six sampling points, with 200 m difference in altitude between each point. We obtained average climate data (1970-2000 from Worldclim v2 for altitudes at each sampling site. Nest traps captured 17 bee and wasp species from six families, and Moericke traps captured 124 morphospecies from 13 families. We found a negative correlation between altitude and species richness and abundance. Temperature, precipitation, water vapor pressure, and wind speed influenced species richness and abundance, and were correlated with altitude. β-diversity was primarily determined by species turnover as opposed to nestedness, and Aculeate community similarity was higher for more similar altitudinal ranges. Moericke traps seem to be more efficient for altitudinal surveys compared to nest traps. We found high occurrence of singleton and doubleton species at all altitudes, highlighting the need for long-term studies to efficiently assess hymenopteran diversity in these environments.
Madden, Anne A; Grassetti, Andrew; Soriano, Jonathan-Andrew N; Starks, Philip T
2013-08-01
Actinomycetes-a group of antimicrobial producing bacteria-have been successfully cultured and characterized from the nest material of diverse arthropods. Some are symbionts that produce antimicrobial chemicals found to protect nest brood and resources from pathogenic microbes. Others have no known fitness relationship with their associated insects, but have been found to produce antimicrobials in vitro. Consequently, insect nest material is being investigated as a new source of novel antimicrobial producing actinomycetes, which could be harnessed for therapeutic potential. To extend studies of actinomycete-insect associations beyond soil-substrate dwelling insects and wood boring excavators, we conducted a preliminary assessment of the actinomycetes within the nests of the paper wasp, Polistes dominulus (Christ). We found that actinomycetes were readily cultured from nest material across multiple invasive P. dominulus populations-including members of the genera Streptomyces, Micromonospora, and Actinoplanes. Thirty of these isolates were assayed for antimicrobial activity against the challenge bacteria Pseudomonas aeruginosa, Escherichia coli, Staphylococcus aureus, Serratia marcescens, and Bacillus subtilis. Sixty percent of isolates inhibited the growth of at least one challenge strain. This study provides the first assessment of bacteria associated with nests of P. dominulus, and the first record of antimicrobial producing actinomycetes isolated from social wasps. We provide a new system to explore nest associated actinomycetes from a ubiquitous and cosmopolitan group of insects.
DEFF Research Database (Denmark)
Lefever, Tine; Pedersen, Esben; Basse, Astrid
2010-01-01
alopecia and prolonged catagen and telogen phases. The delayed anagen onset correlated with an increased expression of the cell-cycle inhibitor p21CIP, and increased activity of the TGFbeta pathway, a known inducer of p21CIP expression. Primary N-WASP-null keratinocytes showed reduced growth compared...
Krugner, Rodrigo; Groves, Russell L; Johnson, Marshall W; Flores, Arnel P; Hagler, James R; Morse, Joseph G
2009-06-01
A 2-yr study was conducted in a citrus orchard (Citrus sinensis L. Osbeck cultivar Valencia) to determine the influence of plant water stress on the population dynamics of glassy-winged sharpshooter, Homalodisca vitripennis (Germar). Experimental treatments included irrigation at 100% of the crop evapotranspiration rate (ET(c)) and continuous deficit-irrigation regimens at 80 and 60% ET(c). Microclimate and plant conditions monitored included temperature and humidity in the tree canopy, leaf surface temperature, water potential, and fruit quality and yield. Glassy-winged sharpshooter population densities and activity were monitored weekly by a combination of visual inspections, beat net sampling, and trapping. Glassy-winged sharpshooter populations were negatively affected by severe plant water stress; however, population densities were not linearly related to decreasing water availability in plants. Citrus trees irrigated at 60% ET(c) had significantly warmer leaves, lower xylem water potential, and consequently hosted fewer glassy-winged sharpshooter eggs, nymphs, and adults than trees irrigated at 80% ET(c). Citrus trees irrigated at 100% ET(c) hosted similar numbers of glassy-winged sharpshooter stages as trees irrigated at 60% ET(c) and a lower number of glassy-winged sharpshooter nymphs than the 80% ET(c) treatment, specifically during the nymphal density peak in mid-April to early July. Irrigation treatments did not affect populations of monitored natural enemies. Although the adult glassy-winged sharpshooter population was reduced, on average, by 50% in trees under severe water stress, the total number of fruit and number of fruit across several fruit grade categories were significantly lower in the 60% ET(c) than in the 80 and 100% ET(c) irrigation treatments.
Gualtieri, Liberata; Nugnes, Francesco; Nappo, Anna G; Gebiola, Marco; Bernardo, Umberto
2017-07-01
The incidence of horizontal transmission as a route for spreading symbiont infections is still being debated, but a common view is that horizontal transfers require intimate between-species relationships. Here we study a system that meets ideal requirements for horizontal transmission: the gall wasp Leptocybe invasa and its parasitoid Quadrastichus mendeli (Hymenoptera: Eulophidae). These wasps belong to the same subfamily, spend most of their lives inside the same minute gall and are both infected by Rickettsia, a maternally inherited endosymbiotic bacteria that infects several arthropods, sometimes manipulating their reproduction, like inducing thelytokous parthenogenesis in L. invasa. Despite intimate contact, close phylogenetic relationship and the parasitoid's host specificity, we show that host and parasitoid do not share the same Rickettsia. We provide indirect evidence that Rickettsia infecting Q. mendeli may be inducing thelytokous parthenogenesis, as the symbiont is densely present in the reproductive apparatus and is vertically transmitted. Phylogenetic analyses based on 16S and gltA placed this symbiont in the leech group. The confirmed and presumed parthenogenesis-inducing Rickettsia discovered so far only infect eulophid wasps, and belong to three different groups, suggesting multiple independent evolution of the parthenogenesis inducing phenotype. We also show some degree of cospeciation between Rickettsia and their eulophid hosts. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Van den Berg, M.; Duivenvoorde, L.; Wang, G.; Tribuhl, S.; Bukovinszky, T.; Vet, L.E.M.; Dicke, M.; Smid, H.M.
2011-01-01
Animals form memory types that differ in duration and stability. The initial anaesthesia-sensitive memory (ASM) can be replaced by anaesthesia-resistant memory (ARM), and/or by protein synthesis-dependent, long-term memory (LTM). We previously showed that two closely related parasitic wasp species
Vugt, van J.J.F.A.; Jong, de J.H.S.G.M.; Stouthamer, R.
2009-01-01
This study uses molecular and cytogenetic methods to determine the origin of a B chromosome in some males of the wasp Trichogramma kaykai. This so-called paternal sex ratio (PSR) chromosome transmits only through sperm and shortly after fertilization triggers degeneration of the paternal genome,
Directory of Open Access Journals (Sweden)
Marcel G. Hermes
2006-06-01
Full Text Available The flower-visiting social wasps (Hymenoptera, Vespidae, Polistinae in two areas of Rio Grande do Sul State, southern Brazil. The structure of flower-visiting social wasps' assemblages in the CPCN Pró-Mata of São Francisco de Paula and in the Green Belt of Santa Cruz do Sul, Rio Grande do Sul, are characterized. A total of 879 polistine wasps were collected, of which 475 (11 spp. in the CPCN and 404 (21 spp. in the Green Belt, from September 1997 to April 2001 and from September 2001 to April 2004, respectively. Foraging social wasps were observed on flowers of 36 species of angiosperms (20 families in the Green Belt, and on flowers of 54 species of angiosperms (21 families in the CPCN. Asteraceae was the most visited plant family on both studied localities. A list of pant species visited by the polistines is provided.Vespas sociais (Hymenoptera, Vespidae, Polistinae visitantes de flores em duas áreas no Rio Grande do Sul, Brasil. A estrutura da assembléia de vespas sociais que visitam flores no CPCN Pró-Mata de São Francisco de Paula e no Cinturão Verde de Santa Cruz do Sul, Rio Grande do Sul, são caracterizadas. Do total de 879 polistíneos, 475 (11 spp. foram coletados no CPCN, e 404 (21 spp. no Cinturão Verde entre Setembro de 1997 a Abril de 2000 e Setembro de 2001 a Abril de 2004, respectivamente. Vespas sociais foram observadas em flores de 36 espécies de angiospermas (20 famílias no Cinturão Verde, e em flores de 54 espécies de angiospermas (21 famílias no CPCN. Asteraceae foi a família de planta que mais recebeu visitas por parte das vespas nas duas localidades estudadas. Uma lista com as espécies de plantas visitadas pelos polistíneos é apresentada.
VizieR Online Data Catalog: Transiting planet WASP-6b (Tregloan-Reed+, 2015)
Tregloan-Reed, J.; Southworth, J.; Burgdorf, M.; Calchi Novati, S.; Dominik, M.; Finet, F.; Jorgensen, U. G.; Maier, G.; Mancini, L.; Prof, S.; Ricci, D.; Snodgrass, C.; Bozza, V.; Browne, P.; Dodds, P.; Gerner, T.; Harpsoe, K.; Hinse, T. C.; Hundertmark, M.; Kains, N.; Kerins, E.; Liebig, C.; Penny, M. T.; Rahvar, S.; Sahu, K.; Scarpetta, G.; Schafer, S.; Schonebeck, F.; Skottfelt, J.; Surdej, J.
2018-05-01
Four light curves of transits of the extrasolar planetary system WASP-6 are presented. They were obtained using the Danish 1.54m telescope at ESO La Silla, Chile, in the Bessell R passband. The errorbars for each transit have been scaled so the best-fitting model (obtained using the JKTEBOP code and without accounting for the presence of starspots) has a reduced chi-squared value of 1.0. (1 data file).
Doccola, J.J.; Smith, S.L.; Strom, B.L.; Medeiros, A.C.; Von Allmen, E.
2009-01-01
Abstract The erythrina gall wasp (EGW), believed native to Africa, is a recently described species and now serious invasive pest of Erythrina (coral trees) in tropical and subtropical locales. Erythrina are favored ornamental and landscape trees, as well as native members of threatened ecosystems. The EGW is a tiny, highly mobile, highly invasive wasp that deforms (galls) host trees causing severe defoliation and tree death. The first detection of EGW in the United States was in O'ahu, Hawai'i in April 2005. It quickly spread through the Hawai'ian island chain (U.S.) killing ornamental and native Erythrina in as little as two years. At risk are endemic populations of Erythrinaas well as ornamental landscape species in the same genus, the latter of which have already been killed and removed from O'ahu at a cost of more than USD $1 million. Because EGW are so small and spread so quickly, host injury is usually detected before adult wasps are observed, making prophylactic treatments less likely than therapeutic ones. This study evaluates two stem-injected insecticides, imidacloprid (IMA-jet??) and emamectin benzoate, delivered through Arborjet Tree I.V.?? equipment, for their ability to affect E. sandwicensis (wiliwili) canopy demise under severe EGW exposure. IMA-jet, applied at a rate of 0.16 g AI/cm basal diameter (0.4 g AI/in. dia.), was the only effective treatment for maintaining canopy condition of wiliwili trees. Emamectin benzoate, applied at a rate of -0.1 g AI/cm basal diameter (-0.25 g AI/in. dia.), was not effective in this application, although it was intermediate in effect between IMA-jet and untreated trees. The relatively high concentrations of imidacloprid in leaves, and its durability for at least 13 months in native wiliwili growing on a natural, dryland site, suggest that treatment applications against EGW can impact canopy recovery even under suboptimal site and tree conditions. ?? 2009 International Society of Arboriculture.
Reeson, A F; Jankovic, T; Kasper, M L; Rogers, S; Austin, A D
2003-02-01
Invertebrates host numerous bacteria, with interactions ranging from pathogenesis to symbiosis. While certain symbiotic relationships have been well studied, little is known about the dynamics of these bacterial communities. Denaturing gradient gel electrophoresis (DGGE) was used to examine the bacterial microflora associated with the eusocial wasp Vespula germanica. DGGE profiles of larval guts revealed a variable microflora, suggesting that V. germanica is not dependent on a particular suite of mutualists. The variation in profiles was not related to season, nest size or macrohabitat. Sequences corresponding to Lactococcus, Lactobacillus, a novel Leuconostoc and two Rickettsiella grylli strains were obtained. DGGE proved to be a useful technique for characterizing the wasp microflora. Given the importance of microbial communities to invertebrates, there is much to be gained from the application of such techniques.
Silva, Juliana; Monge-Fuentes, Victoria; Gomes, Flávia; Lopes, Kamila; dos Anjos, Lilian; Campos, Gabriel; Arenas, Claudia; Biolchi, Andréia; Gonçalves, Jacqueline; Galante, Priscilla; Campos, Leandro; Mortari, Márcia
2015-08-18
Neurodegenerative diseases are relentlessly progressive, severely impacting affected patients, families and society as a whole. Increased life expectancy has made these diseases more common worldwide. Unfortunately, available drugs have insufficient therapeutic effects on many subtypes of these intractable diseases, and adverse effects hamper continued treatment. Wasp and bee venoms and their components are potential means of managing or reducing these effects and provide new alternatives for the control of neurodegenerative diseases. These venoms and their components are well-known and irrefutable sources of neuroprotectors or neuromodulators. In this respect, the present study reviews our current understanding of the mechanisms of action and future prospects regarding the use of new drugs derived from wasp and bee venom in the treatment of major neurodegenerative disorders, including Alzheimer's Disease, Parkinson's Disease, Epilepsy, Multiple Sclerosis and Amyotrophic Lateral Sclerosis.
Cruz, Patricia; Barrado, David; Lillo-Box, Jorge; Diaz, Marcos; López-Morales, Mercedes; Birkby, Jayne; Fortney, Jonathan J.; Hodgkin, Simon
2017-10-01
The Calar Alto Secondary Eclipse study was a program dedicated to observe secondary eclipses in the near-IR of two known close-orbiting exoplanets around K-dwarfs: WASP-10b and Qatar-1b. Such observations reveal hints on the orbital configuration of the system and on the thermal emission of the exoplanet, which allows the study of the brightness temperature of its atmosphere. The observations were performed at the Calar Alto Observatory (Spain). We used the OMEGA2000 instrument (Ks band) at the 3.5m telescope. The data was acquired with the telescope strongly defocused. The differential light curve was corrected from systematic effects using the Principal Component Analysis (PCA) technique. The final light curve was fitted using an occultation model to find the eclipse depth and a possible phase shift by performing a MCMC analysis. The observations have revealed a secondary eclipse of WASP-10b with depth of 0.137%, and a depth of 0.196% for Qatar-1b. The observed phase offset from expected mid-eclipse was of -0.0028 for WASP-10b, and of -0.0079 for Qatar-1b. These measured offsets led to a value for |ecosω| of 0.0044 for the WASP-10b system, leading to a derived eccentricity which was too small to be of any significance. For Qatar-1b, we have derived a |ecosω| of 0.0123, however, this last result needs to be confirmed with more data. The estimated Ks-band brightness temperatures are of 1647 K and 1885 K for WASP-10b and Qatar-1b, respectively. We also found an empirical correlation between the (R'HK) activity index of planet hosts and the Ks-band brightness temperature of exoplanets, considering a small number of systems.
Harvey, J.A.; Wagenaar, R.; Bezemer, T.M.
2009-01-01
1. Parasitoid wasps are highly efficient organisms at utilizing and assimilating limited resources from their hosts. This study explores interactions over three trophic levels, from the third (primary parasitoid) to the fourth (secondary parasitoid) and terminating in the fifth (tertiary
Czech Academy of Sciences Publication Activity Database
Petrović, A.; Tomanović, Ž.; Kavallieratos, N. G.; Mitrovski Bogdanović, A.; Starý, Petr; Ivanović, A.
2014-01-01
Roč. 107, č. 5 (2014), s. 1027-1032 ISSN 0013-8746 Grant - others:The Ministry of Education, Science and Technological Development of the Republic of Serbia(RS) 43001 Institutional support: RVO:60077344 Keywords : geometric morphometric * parasitoid wasp * sexual size dimorphism Subject RIV: EA - Cell Biology Impact factor: 1.190, year: 2014
Harvey, J.A.; Gols, R.; Tanaka, T.
2011-01-01
During their larval development, endoparasitoids are known to dispose of host resources in several different ways. Some parasitoid wasps consume most or all tissues of the host, whereas others consume a small fraction of host resources and either ensure that the host moves away from the pupation
Harvey, J.A.; Gols, R.; Tanaka, T.
2011-01-01
During their larval development, endoparasitoids are known to dispose of host resources in several different ways. Some parasitoid wasps consume most or all tissues of the host, whereas others consume a small fraction of host resources and either ensure that the host moves away from the pupation
Nicholls, James A; Melika, George; Stone, Graham N
2017-01-01
Many herbivores employ reward-based mutualisms with ants to gain protection from natural enemies. We examine the evolutionary dynamics of a tetra-trophic interaction in which gall wasp herbivores induce their host oaks to produce nectar-secreting galls, which attract ants that provide protection from parasitoids. We show that, consistent with other gall defensive traits, nectar secretion has evolved repeatedly across the oak gall wasp tribe and also within a single genus (Disholcaspis) that includes many nectar-inducing species. Once evolved, nectar secretion is never lost in Disholcaspis, consistent with high defensive value of this trait. We also show that evolution of nectar secretion is correlated with a transition from solitary to aggregated oviposition, resulting in clustered nectar-secreting galls, which produce a resource that ants can more easily monopolize. Such clustering is commonly seen in ant guard mutualisms. We suggest that correlated evolution between maternal oviposition and larval nectar induction traits has enhanced the effectiveness of this gall defense strategy.
Faedi, F.; West, R. G.; Burleigh, M. R.; Goad, M. R.; Hebb, L.
2010-01-01
We have performed extensive simulations to explore the possibility of detecting eclipses and transits of close, sub-stellar and planetary companions to white dwarfs in WASP light-curves. Our simulations cover companions $\\sim0.3\\Re
Han, Y.; Bouchard, D.; Chang, X.; Hsieh, H. S.; Knightes, C. D.; Spear, J.; Zepp, R. G.
2017-12-01
The production of graphene-family nanoparticles (GFNs) appreciably increased in recent years. Among GFNs, graphene oxide (GO) is one of the most highly studied members due to its inexpensive synthesis cost compared to graphene, its stability in aqueous media and its broad application. However, GO also has been found to be the most toxic among GFNs. Lab studies showed that GO undergoes phototransformation in surface waters, resulting in products that include reduced GO (rGO) and polycyclic aromatic hydrocarbons (PAHs). Due to technical and analytical limitations, it is still difficult to conduct in-situ measurement of GO and rGO concentrations released in the environment, and it is of utmost importance to establish a model that can predict their environmental exposure concentrations in the environment. In this study, we develop a fate and transport model to predict time-dependent environmental exposure concentrations of GO for the Brier Creek Watershed in the GA coastal plain. We investigate the influence of sunlight radiation on the distribution of GO and its phototransformation products in the watershed over a 20-year period using the most updated Water Quality Analysis Simulation Program (WASP8). Flow rate, sediment transport data and sunlight radiation data are input into WASP8, and WASP8 is used to internally calculate a GO phototransformation rate and productions of rGO and PAHs. Heteroaggregation coefficients of GO and rGO with suspended solids were measured in an EPA laboratory, and then input into WASP8. GO and rGO concentrations in the watershed are calculated by WASP8. Mass fraction results show that GO is the predominant species among GO derived species, which account for 99% of the mass throughout the whole watershed of interest, while rGO species, including free rGO and rGO heteroaggregated to suspended solids, only account for 1%. We also found that almost all free GO and rGO are present in water column due to their extremely low settling velocity. r
Implementation of large-scale average geostrophic wind shear in WAsP12.1
DEFF Research Database (Denmark)
Floors, Rogier Ralph; Troen, Ib; Kelly, Mark C.
The vertical extrapolation model described in the European Wind Atlas Troen and Petersen (1989) is modified to take into account large-scale average geostrophic wind shear to describe the effect of horizontal temperature gradients on the geostrophic wind. The method is implemented by extracting...... the average geostrophic wind shear from Climate Forecast System Reanalysis (CFSR) data and the values of nearest grid point are automatically used in the WAsP 12.1 user interface to provide better AEP predictions....
Directory of Open Access Journals (Sweden)
Katharina Weiss
Full Text Available Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R-(--mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of deployment of antimicrobials during the development from egg to adult as well as their physico-chemical properties to assess how these aspects may contribute to the success of the antimicrobial strategy. Using gas chromatography/mass spectrometry (GC/MS we show that larvae start sanitizing their food as soon as they have entered their host to feed on its tissue. Subsequently, they impregnate the cockroach carcass with antimicrobials to create a hygienic substrate for cocoon spinning inside the host. Finally, the antimicrobials are incorporated into the cocoon. The antimicrobial profiles on cockroach and wasp cocoon differed markedly. While micromolide persisted on the cockroaches until emergence of the wasps, solid-phase microextraction sampling and GC/MS analysis revealed that (R-(--mellein vaporized from the cockroaches and accumulated in the enclosed nest. In microbial challenge assays (R-(--mellein in the headspace of parasitized cockroaches inhibited growth of entomopathogenic and opportunistic microbes (Serratia marcescens, Aspergillus sydowii, Metarhizium brunneum. We conclude that, in addition to food sanitation, A. compressa larvae enclose themselves in two defensive walls by impregnating the cocoon and the cockroach cuticle with antimicrobials. On top of that, they use vaporous (R-(--mellein to sanitize the nest by fumigation. This multifaceted antimicrobial defense strategy involving the spatially and temporally coordinated deployment of several
WAsP engineering flow model for wind over land and sea
DEFF Research Database (Denmark)
Astrup, P.; Larsen, Søren Ejling
1999-01-01
This report presents the basic wind flow model of WAsP Engineering. The model consists in principle of three parts: the LINCOM model for neutrally stable flow over terrain with hills and varying surface roughness, a sea surface roughness model, and anobstacle model. To better predict flow over...... of literature data for the Charnock parameter as function of the so called wave age, the ratio between wave velocity and friction velocity, plus a correlation ofwave age to the geometrically obtainable water fetch. A model for the influence on the wind of multiple, finite size, interacting obstacles with any...
VizieR Online Data Catalog: Times of transits and occultations of WASP-12b (Patra+, 2017)
Patra, K. C.; Winn, J. N.; Holman, M. J.; Yu, L.; Deming, D.; Dai, F.
2017-08-01
Between 2016 October and 2017 February, we observed seven transits of WASP-12 with the 1.2m telescope at the Fred Lawrence Whipple Observatory on Mt. Hopkins, Arizona. Images were obtained with the KeplerCam detector through a Sloan r'-band filter. The typical exposure time was 15s, chosen to give a signal-to-noise ratio of about 200 for WASP-12. The field of view of this camera is 23.1' on a side. We used 2*2 binning, giving a pixel scale of 0.68''. We measured two new occultation times based on hitherto unpublished Spitzer observations in 2013 December (program 90186, P.I. Todorov). Two different transits were observed, one at 3.6μm and one at 4.5μm. The data take the form of a time series of 32*32-pixel subarray images, with an exposure time of 2.0s per image. The data were acquired over a wide range of orbital phases, but for our purpose, we analyzed only the ~14000 images within 4hr of each occultation. (1 data file).
Social dominance molds cuticular and egg chemical blends in a paper wasp.
Dapporto, Leonardo; Romana Dani, Francesca; Turillazzi, Stefano
2007-07-03
Hamilton's theory [1] for the evolution of social behaviour predicts that helpers may renounce direct reproduction to help their more fertile kin. Intra-colony recognition among queens and helpers (subordinate queens or workers) is consequently a central issue in insect sociobiology. In social insects, cuticular hydrocarbons (CHCs) are involved in recognition, and egg-laying and non-egg-laying individuals often differ in CHC composition. These differences are assumed to be directly determined by fertility status [2,3]. In several ants and in Polistes wasps, when egg-layers disappear they are substituted by helpers, which develop their ovaries and become chemically similar to their former queens [2,3]. Sometimes helpers lay eggs in the presence of queens, which recognize and destroy the subordinates' eggs [4]. In ponerine ants, eggs often have the same chemical signature as the maternal cuticle [2]. If chemical signatures depend on fertility, egg-laying subordinates should match the queen's signature even when she is present, making egg recognition and differential oophagy impossible. In the study reported here, we experimentally separated fertility from dominance and analyzed the dynamics of hydrocarbon profiles of the cuticle of Polistes dominulus foundresses and the shell surface of their eggs. We have demonstrated that, contrary to the widely accepted view, dominance, rather than fertility, determines chemical signatures in Polistes wasps. This explains why queens can recognize their own eggs and police reproduction by subordinates if they become fertile and lay eggs.
Pusceddu, Michelina; Floris, Ignazio; Buffa, Franco; Salaris, Emanuele; Satta, Alberto
2017-01-01
Predator-prey relationships between sympatric species allow the evolution of defense behaviors, such as honeybee colonies defending their nests against predatory wasps. We investigated the predator-prey relationship between the honeybee (Apis mellifera ligustica) and the European wasp (Vespula germanica) by evaluating the effectiveness of attack and defense behaviors, which have coevolved in these sympatric species, as well as the actual damage and disturbance caused to the colonies under attack. Attack and defense behaviors were recorded in front of the hive to observe attacks at the hive entrance (68 attacks in 279 h) and at ground level on isolated and weakened honeybees close to the hive (465 attacks in 32 h). We found that V. germanica attacked the hive entrance infrequently due to the low success rate of this strategy and instead preferred a specialized attack method targeting adult honeybees at ground level, demonstrating opportunistic scavenger behavior. Individual honeybees usually responded effectively to an attack by recruiting an average of two nestmates, causing the wasp to flee, whereas collective balling behavior was only observed on four occasions. V. germanica does not appear to disrupt the foraging activity of the colonies under attack. We found that agonistic events supported by other nestmates were typically the most intense ones, involving physical combat and prolonged attacks at the entrance to the hive. These observations support the hypothesis that A. mellifera ligustica can adapt its behavior to match the severity of the threat and the context of the attack.
Energy Technology Data Exchange (ETDEWEB)
Nikolov, Nikolay; Sing, David K.; Evans, Thomas M. [Physics and Astronomy, University of Exeter, EX4 4QL Exeter (United Kingdom); Gibson, Neale P. [Astrophysics Research Centre, School of Mathematics and Physics, Queens University Belfast, Belfast BT7 1NN (United Kingdom); Fortney, Jonathan J. [Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Barstow, Joanna K. [Physics and Astronomy, University College London, London (United Kingdom); Kataria, Tiffany [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Drive, Pasadena, CA (United States); Wilson, Paul A., E-mail: nikolay@astro.ex.ac.uk [Institut d’Astrophysique de Paris, UMR7095 CNRS, Université Pierre and Marie Curie, 98bis Boulevard Arago, 75014 Paris (France)
2016-12-01
We present transmission spectroscopy of the warm Saturn-mass exoplanet WASP-39b made with the Very Large Telescope FOcal Reducer and Spectrograph (FORS2) across the wavelength range 411–810 nm. The transit depth is measured with a typical precision of 240 parts per million (ppm) in wavelength bins of 10 nm on a V = 12.1 mag star. We detect the sodium absorption feature (3.2 σ ) and find evidence of potassium. The ground-based transmission spectrum is consistent with Hubble Space Telescope ( HST ) optical spectroscopy, supporting the interpretation that WASP-39b has a largely clear atmosphere. Our results demonstrate the great potential of the recently upgraded FORS2 spectrograph for optical transmission spectroscopy, with which we obtained HST -quality light curves from the ground.
Directory of Open Access Journals (Sweden)
Yanni Zhao
Full Text Available Chouioia cunea Yang is an endoparasitic wasp that attacks pupae of Hyphantria cunea (Drury, an invasive moth species that severely damages forests in China. Chemosensory systems of insects are used to detect volatile chemical odors such as female sex pheromones and host plant volatiles. The antennae of parasite wasps are important for host detection and other sensory-mediated behaviors. We identified and documented differential expression profiles of chemoreception genes in C. cunea antennae. A total of 25 OBPs, 80 ORs, 10 IRs, 11 CSP, 1 SNMPs, and 17 GRs were annotated from adult male and female C. cunea antennal transcriptomes. The expression profiles of 25 OBPs, 16 ORs, and 17 GRs, 5 CSP, 5 IRs and 1 SNMP were determined by RT-PCR and RT-qPCR for the antenna, head, thorax, and abdomen of male and female C. cunea. A total of 8 OBPs, 14 ORs, and 8 GRs, 1 CSP, 4 IRs and 1 SNMPs were exclusively or primarily expressed in female antennae. These female antennal-specific or dominant expression profiles may assist in locating suitable host and oviposition sites. These genes will provide useful targets for advanced study of their biological functions.
Amat, Isabelle; van Alphen, Jacques J M; Kacelnik, Alex; Desouhant, Emmanuel; Bernstein, Carlos
2017-01-01
Coexistence of sexual and asexual populations remains a key question in evolutionary ecology. We address the question how an asexual and a sexual form of the parasitoid Venturia canescens can coexist in southern Europe. We test the hypothesis that both forms are adapted to different habitats within their area of distribution. Sexuals inhabit natural environments that are highly unpredictable, and where density of wasps and their hosts is low and patchily distributed. Asexuals instead are common in anthropic environments (e.g., grain stores) where host outbreaks offer periods when egg-load is the main constraint on reproductive output. We present a meta-analysis of known adaptations to these habitats. Differences in behavior, physiology and life-history traits between sexual and asexual wasps were standardized in term of effect size (Cohen's d value; Cohen, 1988). Seeking consilience from the differences between multiple traits, we found that sexuals invest more in longevity at the expense of egg-load, are more mobile, and display higher plasticity in response to thermal variability than asexual counterparts. Thus, each form has consistent multiple adaptations to the ecological circumstances in the contrasting environments.
Directory of Open Access Journals (Sweden)
Isabelle Amat
2017-09-01
Full Text Available Background Coexistence of sexual and asexual populations remains a key question in evolutionary ecology. We address the question how an asexual and a sexual form of the parasitoid Venturia canescens can coexist in southern Europe. We test the hypothesis that both forms are adapted to different habitats within their area of distribution. Sexuals inhabit natural environments that are highly unpredictable, and where density of wasps and their hosts is low and patchily distributed. Asexuals instead are common in anthropic environments (e.g., grain stores where host outbreaks offer periods when egg-load is the main constraint on reproductive output. Methods We present a meta-analysis of known adaptations to these habitats. Differences in behavior, physiology and life-history traits between sexual and asexual wasps were standardized in term of effect size (Cohen’s d value; Cohen, 1988. Results Seeking consilience from the differences between multiple traits, we found that sexuals invest more in longevity at the expense of egg-load, are more mobile, and display higher plasticity in response to thermal variability than asexual counterparts. Discussion Thus, each form has consistent multiple adaptations to the ecological circumstances in the contrasting environments.
PHYSICAL PROPERTIES OF THE 0.94-DAY PERIOD TRANSITING PLANETARY SYSTEM WASP-18
International Nuclear Information System (INIS)
Southworth, John; Anderson, D. R.; Maxted, P. F. L.; Hinse, T. C.; Dominik, M.; Mathiasen, M.; Browne, P.; Glitrup, M.; Joergensen, U. G.; Harpsoee, K.; Liebig, C.; Maier, G.; Bozza, V.; Calchi Novati, S.; Mancini, L.; Burgdorf, M.; Dreizler, S.; Hessman, F.; Hundertmark, M.; Finet, F.
2009-01-01
We present high-precision photometry of five consecutive transits of WASP-18, an extrasolar planetary system with one of the shortest orbital periods known. Through the use of telescope defocusing we achieve a photometric precision of 0.47-0.83 mmag per observation over complete transit events. The data are analyzed using the JKTEBOP code and three different sets of stellar evolutionary models. We find the mass and radius of the planet to be M b = 10.43 ± 0.30 ± 0.24 M Jup and R b = 1.165 ± 0.055 ± 0.014 R Jup (statistical and systematic errors), respectively. The systematic errors in the orbital separation and the stellar and planetary masses, arising from the use of theoretical predictions, are of a similar size to the statistical errors and set a limit on our understanding of the WASP-18 system. We point out that seven of the nine known massive transiting planets (M b > 3 M Jup ) have eccentric orbits, whereas significant orbital eccentricity has been detected for only four of the 46 less-massive planets. This may indicate that there are two different populations of transiting planets, but could also be explained by observational biases. Further radial velocity observations of low-mass planets will make it possible to choose between these two scenarios.
A search for transit timing variations and orbital decay in WASP-46b
Petrucci, R.; Jofré, E.; Ferrero, L. V.; Cúneo, V.; Saker, L.; Lovos, F.; Gómez, M.; Mauas, P.
2018-02-01
We present 12 new transit observations of the exoplanet WASP-46b obtained with the 1.54-m telescope at Estación Astrofísica de Bosque Alegre (EABA, Argentina) and the 0.40-m Horacio Ghielmetti and 2.15-m Jorge Sahade telescopes at Complejo Astronómico El Leoncito (CASLEO, Argentina). We analyse them together with 37 light curves from the literature to re-determine the physical parameters and search for additional planets via transit timing variations (TTVs). We consider the 31 transits with uncertainties in their mid-transit times (e_T0) activity could be affecting the measured mid-transit times. This value of dispersion allows us to rule out the presence of additional bodies with masses larger than 2.3, 4.6, 7 and 9.3 M_{\\oplus} at the first-order mean-motion resonances 2:1, 3:2, 4:3 and 5:4 with the transiting planet, respectively. Despite the 6 yr baseline and a typical light-curve precision of 2 × 10-3, we find that we cannot significantly demonstrate a slow decrease of the orbital period of WASP-46b. We place a lower limit of Q⋆ > 7 × 103 on the tidal quality factor and determine that an additional 6 yr baseline is required to rule out Q⋆ < 105.
Knightes, C. D.; Bouchard, D.; Zepp, R. G.; Henderson, W. M.; Han, Y.; Hsieh, H. S.; Avant, B. K.; Acrey, B.; Spear, J.
2017-12-01
The unique properties of engineered nanomaterials led to their increased production and potential release into the environment. Currently available environmental fate models developed for traditional contaminants are limited in their ability to simulate nanomaterials' environmental behavior. This is due to an incomplete understanding and representation of the processes governing nanomaterial distribution in the environment and by scarce empirical data quantifying the interaction of nanomaterials with environmental surfaces. The well-known Water Quality Analysis Simulation Program (WASP) was updated to incorporate nanomaterial-specific processes, specifically hetero-aggregation with particulate matter. In parallel with this effort, laboratory studies were used to quantify parameter values parameters necessary for governing processes in surface waters. This presentation will discuss the recent developments in the new architecture for WASP8 and the newly constructed Advanced Toxicant Module. The module includes advanced algorithms for increased numbers of state variables: chemicals, solids, dissolved organic matter, pathogens, temperature, and salinity. This presentation will focus specifically on the incorporation of nanomaterials, with the applications of the fate and transport of hypothetical releases of Multi-Walled Carbon Nanotubes (MWCNT) and Graphene Oxide (GO) into the headwaters of a southeastern US coastal plains river. While this presentation focuses on nanomaterials, the advanced toxicant module can also simulate metals and organic contaminants.
FIRST RECORDS OF THE INVASIVE AMERICAN WASP ISODONTIA MEXICANA (HYMENOPTERA: SPHECIDAE) IN SERBIA
Ćetković, Aleksandar; Čubrilović, Branka; Plećaš, Milan; Popović, Anđelka; Savić, Dragiša; Stanisavljević, Ljubiša
2012-01-01
The first verified occurrences of the invasive American sphecid wasp, Isodontia mexicana (Saussure, 1867), in Serbia are reported. It was first collected from a trap-nest sample in the northern surroundings of Belgrade in 2010. During 2012, we recorded well-established, abundant populations in the central city area of Belgrade, its surroundings, and also at a single site on the Fruška Gora Mt. We briefly review the circumstances and course of its recent eastward and northeastward spreading in...
Zheng, Bo-Ying; Cao, Li-Jun; Tang, Pu; van Achterberg, Kees; Hoffmann, Ary A; Chen, Hua-Yan; Chen, Xue-Xin; Wei, Shu-Jun
2018-07-01
The Apoidea represent a large and common superfamily of the Hymenoptera including the bees and sphecid wasps. A robust phylogenetic tree is essential to understanding the diversity, taxonomy and evolution of the Apoidea. In this study, features of apoid mitochondrial genomes were used to reconstruct phylogenetic relationships. Twelve apoid mitochondrial genomes were newly sequenced, representing six families and nine subfamilies. Gene rearrangement events have occurred in all apoid mitochondrial genomes sequenced to date. Sphecid wasps have both tRNA and protein-coding gene rearrangements in 5 of 8 species. In bees, the only rearranged genes are tRNAs; long-tongued bees (Apidae + Megachilidae) are characterized by movement of trnA to the trnI-trnQ-trnM tRNA cluster. Phylogenetic analyses of mitochondrial gene sequences support the known paraphyly of sphecid wasps, with bees nested within this clade. The Ampulicidae is sister to the remaining Apoidea. Crabronidae is paraphyletic, split into Crabronidae s.s. and Philanthidae, with the latter group a sister clade to bees. The monophyletic bees are either classified into two clades, long-tongued bees (Apidae + Megachilidae) and short-tongued bees (Andrenidae + Halictidae + Colletidae + Melitidae), or three groups with the Melitidae sister to the other bees. Our study showed that both gene sequences and arrangements provide information on the phylogeny of apoid families. Copyright © 2018 Elsevier Inc. All rights reserved.
Louradour, Isabelle; Sharma, Anurag; Morin-Poulard, Ismael; Letourneau, Manon; Vincent, Alain; Crozatier, Michèle; Vanzo, Nathalie
2017-11-01
Hematopoietic stem/progenitor cells in the adult mammalian bone marrow ensure blood cell renewal. Their cellular microenvironment, called 'niche', regulates hematopoiesis both under homeostatic and immune stress conditions. In the Drosophila hematopoietic organ, the lymph gland, the posterior signaling center (PSC) acts as a niche to regulate the hematopoietic response to immune stress such as wasp parasitism. This response relies on the differentiation of lamellocytes, a cryptic cell type, dedicated to pathogen encapsulation and killing. Here, we establish that Toll/NF-κB pathway activation in the PSC in response to wasp parasitism non-cell autonomously induces the lymph gland immune response. Our data further establish a regulatory network where co-activation of Toll/NF-κB and EGFR signaling by ROS levels in the PSC/niche controls lymph gland hematopoiesis under parasitism. Whether a similar regulatory network operates in mammals to control emergency hematopoiesis is an open question.
da Silva, Marjorie; Noll, Fernando Barbosa; E Castro, Adriana C Morales-Corrêa
2018-01-01
Swarm-founding wasps are endemic and common representatives of neotropical fauna and compose an interesting social tribe of vespids, presenting both complex social characteristics and uncommon traits for a eusocial group, such as the absence of castes with distinct morphology. The paper wasp Protonectarina sylveirae (Saussure) presents a broad distribution from Brazil, Argentina and Paraguay, occurring widespread in the Atlantic rainforest and arboreal Caatinga, being absent in the Amazon region. Given the peculiar distribution among swarm-founding wasps, an integrative approach to reconstruct the evolutionary history of P. sylveirae in a spatial-temporal framework was performed to investigate: the presence of genetic structure and its relationship with the geography, the evolution of distinct morphologic lineages and the possible historical event(s) in Neotropical region, which could explain the observed phylogeographic pattern. Individuals of P. sylveirae were obtained from populations of 16 areas throughout its distribution for DNA extraction and amplification of mitochondrial genes 12S, 16S and COI. Analysis of genetic diversity, construction of haplotype net, analysis of population structure and dating analysis of divergence time were performed. A morphometric analysis was also performed using 8 measures of the body of the adult (workers) to test if there are morphological distinction among populations. Thirty-five haplotypes were identified, most of them exclusively of a group and a high population structure was found. The possibility of genetic divergence because of isolation by distance was rejected. Morphological analysis pointed to a great uniformity in phenotypes, with only a small degree of differentiation between populations of south and the remaining. Divergence time analysis showed a Middle/Late Miocene origin, a period where an extensive marine ingression occurred in South America. Divergence of haplogroups began from the Plio/Pleistocene boundary
Directory of Open Access Journals (Sweden)
Michelina Pusceddu
Full Text Available Predator-prey relationships between sympatric species allow the evolution of defense behaviors, such as honeybee colonies defending their nests against predatory wasps. We investigated the predator-prey relationship between the honeybee (Apis mellifera ligustica and the European wasp (Vespula germanica by evaluating the effectiveness of attack and defense behaviors, which have coevolved in these sympatric species, as well as the actual damage and disturbance caused to the colonies under attack. Attack and defense behaviors were recorded in front of the hive to observe attacks at the hive entrance (68 attacks in 279 h and at ground level on isolated and weakened honeybees close to the hive (465 attacks in 32 h. We found that V. germanica attacked the hive entrance infrequently due to the low success rate of this strategy and instead preferred a specialized attack method targeting adult honeybees at ground level, demonstrating opportunistic scavenger behavior. Individual honeybees usually responded effectively to an attack by recruiting an average of two nestmates, causing the wasp to flee, whereas collective balling behavior was only observed on four occasions. V. germanica does not appear to disrupt the foraging activity of the colonies under attack. We found that agonistic events supported by other nestmates were typically the most intense ones, involving physical combat and prolonged attacks at the entrance to the hive. These observations support the hypothesis that A. mellifera ligustica can adapt its behavior to match the severity of the threat and the context of the attack.
Social Complexity and Nesting Habits Are Factors in the Evolution of Antimicrobial Defences in Wasps
Hoggard, Stephen J.; Wilson, Peter D.; Beattie, Andrew J.; Stow, Adam J.
2011-01-01
Microbial diseases are important selective agents in social insects and one major defense mechanism is the secretion of cuticular antimicrobial compounds. We hypothesized that given differences in group size, social complexity, and nest type the secretions of these antimicrobials will be under different selective pressures. To test this we extracted secretions from nine wasp species of varying social complexity and nesting habits and assayed their antimicrobial compounds against cultures of S...
Sexy faces in a male paper wasp.
de Souza, André Rodrigues; Alberto Mourão Júnior, Carlos; do Nascimento, Fabio Santos; Lino-Neto, José
2014-01-01
Sexually selected signals are common in many animals, though little reported in social insects. We investigated the occurrence of male visual signals mediating the dominance relationships among males and female choice of sexual partner in the paper wasp Polistes simillimus. Males have three conspicuous, variable and sexually dimorphic traits: black pigmentation on the head, a pair of yellow abdominal spots and body size differences. By conducting behavioral assays, we found that none of the three visual traits are associated with male-male dominance relationship. However, males with higher proportion of black facial pigmentation and bigger yellow abdominal spots are more likely chosen as sexual partners. Also, after experimentally manipulating the proportion of black pigment on males' face, we found that females may evaluate male facial coloration during the choice of a sexual partner. Thus, the black pigmentation on P. simillimus male's head appears to play a role as a sexually selected visual signal. We suggest that sexual selection is a common force in Polistes and we highlight the importance of this group as a model for the study of visual communication in insects.
Directory of Open Access Journals (Sweden)
Ricardo Pablo Klein
2015-07-01
Full Text Available Wasps, important agents for the control of insect population, have been scantily studied in the Brazilian State of Rio Grande do Sul. Current study investigates monthly variations of social wasps in microhabitats within a forest-agriculture mosaic. Samples were collected between February 2013 and February 2014, through active search and baited traps made from 2 L transparent PET bottles, in five microhabitats, namely, forest, monoculture, polyculture and the edges between the forest fragment and monoculture and polyculture, in the municipality of Doutor Maurício Cardoso. Statistical tests, similarity indices, dominance and constancy as well as PCoA were used for data analysis to group the collection. A total of 953 specimens were collected, distributed across 15 species and seven genera. Abundance differed between microhabitats and the monoculture cultivation was least similar to the other microhabitats. PCoA identified three different groups. Abundance was positively correlated with temperature, negatively correlated with air humidity and was not correlated with wind velocity. Social wasps are able to utilize resources outside the forest fragments, but monocultures may create barriers for their dispersal.
The effect of juvenile hormone on Polistes wasp fertility varies with cooperative behavior.
Tibbetts, Elizabeth A; Sheehan, Michael J
2012-04-01
Social insects provide good models for studying how and why the mechanisms that underlie reproduction vary, as there is dramatic reproductive plasticity within and between species. Here, we test how the effect of juvenile hormone (JH) on fertility covaries with cooperative behavior in workers and nest-founding queens in the primitively eusocial wasp Polistes metricus. P. metricus foundresses and workers appear morphologically similar and both are capable of reproduction, though there is variation in the extent of social cooperation and the probability of reproduction across castes. Do the endocrine mechanisms that mediate reproduction co-vary with cooperative behavior? We found dramatic differences in the effect of JH on fertility across castes. In non-cooperative nest-founding queens, all individuals responded to JH by increasing their fertility. However, in cooperative workers, the effect of JH on fertility varies with body weight; large workers increase their fertility in response to JH while small workers do not. The variation in JH response may be an adaptation to facilitate resource allocation based on the probability of independent reproduction. This work contrasts with previous studies in closely related Polistes dominulus paper wasps, in which both foundresses and workers form cooperative associations and both castes show similar, condition-dependent JH response. The variation in JH responsiveness within and between species suggests that endocrine responsiveness and the factors influencing caste differentiation are surprisingly evolutionarily labile. Copyright © 2012 Elsevier Inc. All rights reserved.
Molecular components and toxicity of the venom of the solitary wasp, Anoplius samariensis
International Nuclear Information System (INIS)
Hisada, Miki; Satake, Honoo; Masuda, Katsuyoshi; Aoyama, Masato; Murata, Kazuya; Shinada, Testuro; Iwashita, Takashi; Ohfune, Yasufumi; Nakajima, Terumi
2005-01-01
The solitary spider wasp, Anoplius samariensis, is known to exhibit a unique long-term, non-lethal paralysis in spiders that it uses as a food source for its larvae. However, neither detailed venom components nor paralytic compounds have ever been characterized. In this study, we examined the components in the low molecular weight fraction of the venom and the paralytic activity of the high molecular weight fraction. The major low molecular weight components of the venom were identified as γ-aminobutyric acid and glutamic acid by micro-liquid chromatography/electrospray ionization mass spectrometry and nuclear magnetic resonance spectrometry analysis. The sodium dodecyl sulfate-polyacrylamide gel electrophoresis and mass analysis revealed that the A. samariensis venom contained the various proteins with weights of 4-100 kDa. A biological assay using Joro spiders (Nephila clavata) clearly showed that the high molecular weight fraction of the venom prepared by ultrafiltration exerted as potent non-lethal long-term paralysis as the whole venom, whereas the low molecular weight fraction was devoid of any paralytic activity. These results indicated that several venomous proteins in the high molecular weight fraction are responsible for the paralytic activity. Furthermore, we determined the primary structure of one component designated As-fr-19, which was a novel multiple-cysteine peptide with high sequence similarity to several sea anemone and snake toxins including dendrotoxins, rather than any insect toxic peptides identified so far. Taken together, our data showed the unprecedented molecular and toxicological profiles of wasp venoms
Safety of specific immunotherapy using an ultra-rush induction regimen in bee and wasp allergy.
Bożek, Andrzej; Kołodziejczyk, Krzysztof
2018-02-01
Specific allergen immunotherapy to Hymenoptera venom (VIT) is a basic treatment for patients allergic to Hymenoptera venom. The aim of the study was to evaluate the safety of an ultra-rush regimen compared with the rush and conventional protocols. In 31 patients with an allergy to bee venom and 82 with an allergy to wasp venom, the allergic adverse reactions during VIT were monitored. Patients were selected based on the criteria established by EAACI (European Academy of Allergy and Clinical Immunology) recommendations. Adverse reactions during the ultra-rush immunotherapy were measured, documented and classified according to the criteria of Mueller. Ultra-rush, rush or conventional protocols of the initial phase VIT using the Venomenhal vaccine (Hal Allergy, Leiden, Netherlands) were conducted. Six (13.7%) patients on the ultra-rush regimen, 5 (14.3%) patients on the rush regimen and 9 (26.5%) on conventional VIT experienced an allergic reaction. There were no associations between the adverse allergic reactions and the following factors: gender, total IgE and allergen-specific IgE to wasp or bee venom before the VIT and cardiological drugs that were used. We found that the ultra-rush protocol (similar to the rush protocol) using the Venomenhal vaccine is safer than the conventional protocol.
Ancient conservation of trinucleotide microsatellite loci in polistine wasps
DEFF Research Database (Denmark)
Ezenwa, V O; Peters, J M; Zhu, Y
1998-01-01
Microsatellites have proven to be very useful genetic markers for studies of kinship, parentage, and gene mapping. If microsatellites are conserved among species, then those developed for one species can be used on related species, which would save the time and effort of developing new loci. We...... evaluated conservation of 27 trinucleotide loci that were derived from 2 species of Polistes wasps in cross-species applications on 27 species chosen from the major lineages of the Vespidae, which diverged as much as 144 million years ago. We further investigated cross-species polymorphism levels for 18...... of the loci. There was a clear relationship between cladistic distance and both conservation of the priming sites and heterozygosity. However the loci derived from P. bellicosus were much more widely conserved and polymorphic than were those derived from P. annularis. The disparity in cross-species utility...
Van den Berg, M.; Verbaarschot, P.; Hontelez, S.; Vet, L.E.M.; Dicke, M.; Smid, H.M.
2010-01-01
The cAMP/PKA signalling pathway and transcription factor cAMP response element-binding protein (CREB) play key roles in long-term memory (LTM) formation. We used two closely related parasitic wasp species, Cotesia glomerata and Cotesia rubecula, which were previously shown to be different in LTM
Steidle, Johannes L. M.; Collatz, Jana; Muller, Caroline
2006-01-01
Protein synthesis-dependent long-term memory in Apis mellifera and Drosophila melanogaster is formed after multiple trainings that are spaced in time. The parasitic wasp Lariophagus distinguendus remarkably differs from these species. It significantly responds to the artificial odor furfurylheptanoate (FFH) in olfactometer experiments, when this…
Amat, I; Kacelnik, A; van Alphen, JJM; Desouhant, E; Bernstein, C
2017-01-01
Background Coexistence of sexual and asexual populations remains a key question in evolutionary ecology. We address the question how an asexual and a sexual form of the parasitoid Venturia canescens can coexist in southern Europe. We test the hypothesis that both forms are adapted to different habitats within their area of distribution. Sexuals inhabit natural environments that are highly unpredictable, and where density of wasps and their hosts is low and patchily distributed. Asexuals in...
Directory of Open Access Journals (Sweden)
Armin Tröger
2014-04-01
Full Text Available Females of the parasitoid wasp Trichogramma turkestanica produce the putative polydeoxypropionates (2E,4E,6S,8S,10S-4,6,8,10-tetramethyltrideca-2,4-diene and (2E,4E,6S,8S,10S-4,6,8,10-tetramethyltrideca-2,4-dien-1-ol or their enantiomers as sex specific volatiles. The structures were assigned on the basis of GC–MS investigations using synthetic reference compounds.
Energy Technology Data Exchange (ETDEWEB)
Kim, Young Joo; Chang, Choong Koo [KEPCO International Nuclear Graduate School, Ulsan (Korea, Republic of)
2014-10-15
It is noteworthy that North Korean government itself has demanded other parties' cooperation in the field of power sector as the top priority to deal with North Korean own economic issues. In this light, the researcher consider that how to build power capacity in North Korean area after reunification needs to be studied with priority. A scenario-based approach is being adopted, and three scenarios are proposed: Scenario increasing capacity at 2.4% annual rate, Imitating South Korean electricity expansion history, and reaching 80% of South Korean Annual Peak Load in 35 years. In order to carry out the research, WASP-IV (Wien Automation System Planning-IV) code developed by IAEA is, with reasonable assumptions, being executed. Annual Peak Load prediction for each scenario, load duration curve, and existing power generating facilities in North Korea are presented herein. This research is being conducted as a preparatory work for the further study. IAEA's WASP-IV is adopted for a scenario-based electricity expansion plan for North Korea after hypothetical reunification between Koreas. Input data including Annual Peak Load, load duration curve, and existing facilities are built and presented. Additional future research includes inputting candidate plants data, cost data such as construction period, operation and maintenance costs, and fuel costs, as well as decommissioning of aged power plants in North Korea to complete WASP-IV execution. Assuming reunification, electricity expansion plan would need to integrate North and South Koreas demands and facilities. However, this research narrows down its scope to North Korean demand and facilities only. Such integrated simulation could be the topic for the later research. This work was supported by the 2014 Research Fund of the KINGS.
International Nuclear Information System (INIS)
Kim, Young Joo; Chang, Choong Koo
2014-01-01
It is noteworthy that North Korean government itself has demanded other parties' cooperation in the field of power sector as the top priority to deal with North Korean own economic issues. In this light, the researcher consider that how to build power capacity in North Korean area after reunification needs to be studied with priority. A scenario-based approach is being adopted, and three scenarios are proposed: Scenario increasing capacity at 2.4% annual rate, Imitating South Korean electricity expansion history, and reaching 80% of South Korean Annual Peak Load in 35 years. In order to carry out the research, WASP-IV (Wien Automation System Planning-IV) code developed by IAEA is, with reasonable assumptions, being executed. Annual Peak Load prediction for each scenario, load duration curve, and existing power generating facilities in North Korea are presented herein. This research is being conducted as a preparatory work for the further study. IAEA's WASP-IV is adopted for a scenario-based electricity expansion plan for North Korea after hypothetical reunification between Koreas. Input data including Annual Peak Load, load duration curve, and existing facilities are built and presented. Additional future research includes inputting candidate plants data, cost data such as construction period, operation and maintenance costs, and fuel costs, as well as decommissioning of aged power plants in North Korea to complete WASP-IV execution. Assuming reunification, electricity expansion plan would need to integrate North and South Koreas demands and facilities. However, this research narrows down its scope to North Korean demand and facilities only. Such integrated simulation could be the topic for the later research. This work was supported by the 2014 Research Fund of the KINGS
Ferreira-Filho, Pedro J; Piña-Rodrigues, Fátima C M; Silva, José M S; Guerreiro, Julio C; Ghiotto, Thaís C; Piotrowski, Ivonir; Dias, Luiz P; Wilcken, Carlos F; Zanuncio, José C
2015-01-01
This paper records the first report of Megastigmus transvaalensis Hussey (Hymenoptera: Torymidae) in Brazilian peppertree, Schinus terebinthifolius Raddi (Anacardiaceae) drupes in Sorocaba, state of São Paulo, Brazil. This wasp is an invasive species and was found damaging S. terebinthifolius drupes in urban areas (35.0 ± 15.8%), natural forests (21.5 ± 10.2%) and restoration areas (15.8 ± 8.4%). The bio-ecology and damage caused by M. transvaalensis in the S. terebinthifolius drupes warrants further study focused upon the management of this phytophagous wasp. Megastigmus transvaalensis has a potential to be disseminated throughout Brazil and is posing a threat to the natural regeneration of S. terebinthifolius in the native forests and restoration areas and ecological regions of this country.
Justin O. Schmidt
2013-01-01
A large artificial sand dune composed of finely crushed mine tailings was produced by deep mining operations at Ruby, Arizona. Today, the ghost town of Ruby is an important historical location and biodiversity refuge, with the newly formed dune forming the core of the refuge. The dune provides ideal nesting habitat for at least 13 species of sand-loving wasps,...
Kurczewski, Frank E.; Coville, Rollin E.; Schal, Coby
2010-01-01
The nesting behaviors of 10 females of Tachysphex inconspicuus (Kirby) (Hymenoptera: Crabronidae) were studied on a sandy, mowed lawn at the La Selva Biological Station in northeastern Costa Rica on 27–29 April 1980. Twenty-four completed nests were observed, excavated, and measured. The nests had oblique, short burrows leading to one or two shallow cells. Prey cockroaches belonging to 11 species of Chorisoneura and Riatia fulgida (Saussure) (Blattaria: Blattellidae), all tropical wet forest canopy indicator species, were removed from the cells, weighed, and identified. The cockroaches consisted mainly of adult females, selectively preyed upon over adult males and nymphs due to their larger sizes. The aggregate prey mass in cells was separable into prospective larger (heavier) female and smaller (lighter) male cells. Wasps usually oviposited on the heaviest cockroach in a cell, in most cases an adult female. Atypical genus behavior included (1) prey being carried to one side of the wasp and perhaps grasped by a hindleg during removal of the temporary entrance closure and nest entry and (2) wasp's egg being laid affixed to a forecoxal corium and extending backward in a longitudinally posteriad position across the prey's ventral thorax. A comparison with the nesting behavior of other species in the Tachysphex obscuripennis species group is made. PMID:21062142
WASP (Write a Scientific Paper) using Excel - 2: Pivot tables.
Grech, Victor
2018-02-01
Data analysis at the descriptive stage and the eventual presentation of results requires the tabulation and summarisation of data. This exercise should always precede inferential statistics. Pivot tables and pivot charts are one of Excel's most powerful and underutilised features, with tabulation functions that immensely facilitate descriptive statistics. Pivot tables permit users to dynamically summarise and cross-tabulate data, create tables in several dimensions, offer a range of summary statistics and can be modified interactively with instant outputs. Large and detailed datasets are thereby easily manipulated making pivot tables arguably the best way to explore, summarise and present data from many different angles. This second paper in the WASP series in Early Human Development provides pointers for pivot table manipulation in Excel™. Copyright © 2018 Elsevier B.V. All rights reserved.
Zchori-Fein, E; Gottlieb, Y; Kelly, S E; Brown, J K; Wilson, J M; Karr, T L; Hunter, M S
2001-10-23
The symbiotic bacterium Wolbachia pipientis has been considered unique in its ability to cause multiple reproductive anomalies in its arthropod hosts. Here we report that an undescribed bacterium is vertically transmitted and associated with thelytokous parthenogenetic reproduction in Encarsia, a genus of parasitoid wasps. Although Wolbachia was found in only one of seven parthenogenetic Encarsia populations examined, the "Encarsia bacterium" (EB) was found in the other six. Among seven sexually reproducing populations screened, EB was present in one, and none harbored Wolbachia. Antibiotic treatment did not induce male production in Encarsia pergandiella but changed the oviposition behavior of females. Cured females accepted one host type at the same rate as control females but parasitized significantly fewer of the other host type. Phylogenetic analysis based on the 16S rDNA gene sequence places the EB in a unique clade within the Cytophaga-Flexibacter-Bacteroid group and shows EB is unrelated to the Proteobacteria, where Wolbachia and most other insect symbionts are found. These results imply evolution of the induction of parthenogenesis in a lineage other than Wolbachia. Importantly, these results also suggest that EB may modify the behavior of its wasp carrier in a way that enhances its transmission.
Sexy faces in a male paper wasp.
Directory of Open Access Journals (Sweden)
André Rodrigues de Souza
Full Text Available Sexually selected signals are common in many animals, though little reported in social insects. We investigated the occurrence of male visual signals mediating the dominance relationships among males and female choice of sexual partner in the paper wasp Polistes simillimus. Males have three conspicuous, variable and sexually dimorphic traits: black pigmentation on the head, a pair of yellow abdominal spots and body size differences. By conducting behavioral assays, we found that none of the three visual traits are associated with male-male dominance relationship. However, males with higher proportion of black facial pigmentation and bigger yellow abdominal spots are more likely chosen as sexual partners. Also, after experimentally manipulating the proportion of black pigment on males' face, we found that females may evaluate male facial coloration during the choice of a sexual partner. Thus, the black pigmentation on P. simillimus male's head appears to play a role as a sexually selected visual signal. We suggest that sexual selection is a common force in Polistes and we highlight the importance of this group as a model for the study of visual communication in insects.
Directory of Open Access Journals (Sweden)
Antonio C.B. Bergamaschi
2015-01-01
Full Text Available Abstract Trypoxylon is a genus of solitary crabronid wasps whose population genetics is poorly known. The purpose of the present study was to investigate the genetic variation and differentiation among five populations of Trypoxylon albitarse, a species widely distributed throughout the Neotropics, with records from Panama to northern Argentina. Eight species-specific microsatellite loci were used for genotyping 96 adult wasps (one female per nest sampled at five sites in Brazil. The analysis of allelic richness and private alleles indicated high genetic diversity in the populations sampled. Pairwise comparisons using the Fst and Dest indices revealed significant differentiation for all, but one pair of populations. Fst, Dest, AMOVA and assignment test values pointed to inter-population differentiation. Additionally, the analysis of population structure using Bayesian and PCA methods characterized two alternative genetic groups. The Mantel test indicated no correlation between genetic and geographic distances. Despite evidence of considerable dispersal capacity for T. albitarse, the data indicate low to moderate population structuring in this species.
Evidence for a Dayside Thermal Inversion and High Metallicity for the Hot Jupiter WASP-18b
Sheppard, Kyle; Mandell, Avi M.; Tamburo, Patrick; Gandhi, Siddarth; Pinhas, Arazi; Madhusudhan, Nikku; Deming, Drake
2018-01-01
Hot Jupiters have been vital in revealing the structural and atmospheric diversity of gas-rich planets. Since they are exposed to extreme conditions and relatively easy to observe through transit and eclipse spectroscopy, hot Jupiters provide a window into a unique part of parameter space, allowing us to better understand both atmospheric physics and planetary structure. Additionally, constraints on the structure and composition of exoplanetary atmospheres allow us to test and generalize planetary formation models. We find evidence for a strong thermal inversion in the dayside atmosphere of the highly irradiated hot Jupiter WASP-18b (Teq=2400K, M=10MJ) based on Hubble Space Telescope secondary eclipse observations and Spitzer eclipse photometry. We report a 4.7σ detection of CO, and a non-detection of water vapor as well as all other relevant species (e.g., TiO, VO). The most probable atmospheric retrieval solution indicates a C/O ratio of 1 and an extremely high metallicity (C/H=~283x solar). If confirmed with future observations, WASP-18b would be the first example of a planet with a non-oxide driven thermal inversion and an atmospheric metallicity inconsistent with that predicted for Jupiter-mass planets.
Ramos, Rodrigo S; de Araújo, Vitor C R; Pereira, Renata R; Martins, Júlio C; Queiroz, Obiratanea S; Silva, Ricardo S; Picanço, Marcelo C
2018-01-01
Copidosoma truncatellum (Hymenoptera: Encyrtidae) is an important parasitoid wasp of the soybean looper, Chrysodeixis includens, but its effectiveness can be severely curtailed by the application of certain insecticides. Therefore, to identify insecticides that are potentially compatible with C. truncatellum, the lethal and behavioral effects of nine chemicals used to control the soybean looper were evaluated for their toxicity to the wasp. Chlorantraniliprole, chlorfenapyr, flubendiamide, and indoxacarb were the least toxic insecticides to the parasitoid, resulting in mortalities of less than 25%. In contrast, cartap, deltamethrin, and methomyl caused 100% mortality, and acephate and spinosad caused 76% and 78% mortality, respectively. At least one of the detoxifying enzymes (monooxygenase, glutathione S-transferase, and/or esterases) may be involved in the mechanisms underlying the selectivity of chlorantraniliprole, chlorfenapyr, flubendiamide, and indoxacarb for the parasitoid based on the results for the insecticide plus synergist treatment. Changes in the behavioral patterns (walking time and resting time) of the parasitoid were found with exposure to acephate, flubendiamide, indoxacarb and methomyl, but behavioral avoidance was not observed. Our results indicate that the insecticides chlorantraniliprole and chlorfenapyr are the most suitable for inclusion in integrated pest management strategies for the control of C. includens. Copyright © 2017 Elsevier Ltd. All rights reserved.
Atmospheric Retrievals of HAT-P-16b and WASP-11b/HAT-P-10b
McIntyre, Kathleen; Harrington, Joseph; Challener, Ryan; Lenius, Maria; Hartman, Joel D.; Bakos, Gaspar A.; Blecic, Jasmina; Cubillos, Patricio E.; Cameron, Andrew
2018-01-01
We report Bayesian atmospheric retrievals performed on the exoplanets HAT-P-16b and WASP-11b/HAT-P-10b. HAT-P-16b is a hot (equilibrium temperature 1626 ± 40 K, assuming zero Bond albedo and efficient energy redistribution), 4.19 ± 0.09 Jupiter-mass exoplanet orbiting an F8 star every 2.775960 ± 0.000003 days (Buchhave et al 2010). WASP-11b/HAT-P-10b is a cooler (1020 ± 17 K), 0.487 ± 0.018 Jupiter-mass exoplanet orbiting a K3 star every 3.7224747 ± 0.0000065 days (Bakos et al. 2009, co-discovered by West et al. 2008). We observed secondary eclipses of both planets using the 3.6 μm and 4.5 μm channels of the Spitzer Space Telescope's Infrared Array Camera (program ID 60003). We applied our Photometry for Orbits, Eclipses, and Transits (POET) code to produce normalized eclipse light curves, and our Bayesian Atmospheric Radiative Transfer (BART) code to constrain the temperature-pressure profiles and atmospheric molecular abundances of the two planets. Spitzer is operated by the Jet Propulsion Laboratory, California Institute of Technology, under a contract with NASA. This work was supported by NASA Planetary Atmospheres grant NNX12AI69G and NASA Astrophysics Data Analysis Program grant NNX13AF38G.
High-precision photometry by telescope defocusing - VII. The ultrashort period planet WASP-103
DEFF Research Database (Denmark)
Southworth, John; Mancini, L.; Ciceri, S.
2015-01-01
for these calculations. The planet has a Roche lobe filling factor of 0.58, leading to a significant asphericity; we correct its measured mass and mean density for this phenomenon. A high-resolution Lucky Imaging observation shows no evidence for faint stars close enough to contaminate the point spread function of WASP......-103. Our data were obtained in the Bessell $RI$ and the SDSS $griz$ passbands and yield a larger planet radius at bluer optical wavelengths, to a confidence level of 7.3 sigma. Interpreting this as an effect of Rayleigh scattering in the planetary atmosphere leads to a measurement of the planetary...
VizieR Online Data Catalog: Transiting extrasolar planet WASP-33b (Kovacs+, 2013)
Kovacs, G.; Kovacs, T.; Hartman, J. D.; Bakos, G. A.; Bieryla, A.; Latham, D.; Noyes, R. W.; Regaly, Zs.; Esquerdo, G. A.
2013-03-01
Light curves (LCs) used in the time series analysis of WASP-33 are presented. All LCs are on magnitude scale. The material constitutes of: (1) the TFA-filtered/reconstructed (see Kovacs, Bakos & Noyes, 2005MNRAS.356..557K) HATNet LC in approximate Ic (Cousins) color; (2) LCs given in Table 1: except for the FLWO data (lc02) all LCs are corrected for linear trends, shifted to zero magnitude at the out-of-transit level. Time is in Heliocentric Julian Date, colors are given in Table 1. (3) Grand-averaged LC, as shown in Fig. 10 of the paper. (4 data files).
Protolytic properties of polyamine wasp toxin analogues studied by 13C NMR spectroscopy
DEFF Research Database (Denmark)
Strømgaard, Kristian; Piazzi, Lorna; Olsen, Christian A
2006-01-01
Acid-base properties of the natural polyamine wasp toxin PhTX-433 (1) and seven synthetic analogues [PhTX-343 (2), PhTX-334 (3), PhTX-443 (4), PhTX-434 (5), PhTX-344 (6), PhTX-444 (7), and PhTX-333 (8)], each having four protolytic sites, were characterized by 13C NMR spectroscopy. Nonlinear......, multiparameter, simultaneous fit of all chemical shift data obtained from the NMR titration curves yielded macroscopic pKa values as well as intrinsic chemical shift data of all differently protonated macrospecies. Analyses of the chemical shift data demonstrated strong interactions between all four sites...
International Nuclear Information System (INIS)
Urbancic, A.
1997-01-01
Integrated resource planning (IRP) for the regional use of energy in Slovenia is presented in this paper. The main objective of the analysis is the improvement of the overall energy efficiency in Slovenia. Emphasis of the IRP analysis is given on: 1) comparison of demand and supply options and 2) embedding of the planning procedure into a structured analysis procedure to make the planning process more transparent. The Wien Automatic System Planning package (WASP) will be sued in the modeling framework for determining the optimal expansion plan for different demand patterns. This paper provides an overview of the IRP project for Slovenia. The paper consists of three sections. The first section aims at giving an insight on the motivations for the analysis; the second section describes the case studies in structured analysis steps. The role of WASP is discussed in the third part. (author). 9 refs, 2 figs, 1 tab
Energy Technology Data Exchange (ETDEWEB)
Urbancic, A [Energy Efficiency Centre, Jozef Stefan Inst., Ljubjana (Slovenia)
1997-09-01
Integrated resource planning (IRP) for the regional use of energy in Slovenia is presented in this paper. The main objective of the analysis is the improvement of the overall energy efficiency in Slovenia. Emphasis of the IRP analysis is given on: 1) comparison of demand and supply options and 2) embedding of the planning procedure into a structured analysis procedure to make the planning process more transparent. The Wien Automatic System Planning package (WASP) will be sued in the modeling framework for determining the optimal expansion plan for different demand patterns. This paper provides an overview of the IRP project for Slovenia. The paper consists of three sections. The first section aims at giving an insight on the motivations for the analysis; the second section describes the case studies in structured analysis steps. The role of WASP is discussed in the third part. (author). 9 refs, 2 figs, 1 tab.
2018-01-01
Swarm-founding wasps are endemic and common representatives of neotropical fauna and compose an interesting social tribe of vespids, presenting both complex social characteristics and uncommon traits for a eusocial group, such as the absence of castes with distinct morphology. The paper wasp Protonectarina sylveirae (Saussure) presents a broad distribution from Brazil, Argentina and Paraguay, occurring widespread in the Atlantic rainforest and arboreal Caatinga, being absent in the Amazon region. Given the peculiar distribution among swarm-founding wasps, an integrative approach to reconstruct the evolutionary history of P. sylveirae in a spatial-temporal framework was performed to investigate: the presence of genetic structure and its relationship with the geography, the evolution of distinct morphologic lineages and the possible historical event(s) in Neotropical region, which could explain the observed phylogeographic pattern. Individuals of P. sylveirae were obtained from populations of 16 areas throughout its distribution for DNA extraction and amplification of mitochondrial genes 12S, 16S and COI. Analysis of genetic diversity, construction of haplotype net, analysis of population structure and dating analysis of divergence time were performed. A morphometric analysis was also performed using 8 measures of the body of the adult (workers) to test if there are morphological distinction among populations. Thirty-five haplotypes were identified, most of them exclusively of a group and a high population structure was found. The possibility of genetic divergence because of isolation by distance was rejected. Morphological analysis pointed to a great uniformity in phenotypes, with only a small degree of differentiation between populations of south and the remaining. Divergence time analysis showed a Middle/Late Miocene origin, a period where an extensive marine ingression occurred in South America. Divergence of haplogroups began from the Plio/Pleistocene boundary
Nugnes, Francesco; Gebiola, Marco; Monti, Maurilia Maria; Gualtieri, Liberata; Giorgini, Massimo; Wang, Jianguo; Bernardo, Umberto
2015-01-01
The blue-gum chalcid Leptocybe invasa Fisher & LaSalle (Hymenoptera: Eulophidae) is a gall wasp pest of Eucalyptus species, likely native to Australia. Over the past 15 years it has invaded 39 countries on all continents where eucalypts are grown. The worldwide invasion of the blue gum chalcid was attributed to a single thelytokous morphospecies formally described in 2004. Subsequently, however, males have been recorded in several countries and the sex ratio of field populations has been found to be highly variable in different areas. In order to find an explanation for such sex ratio differences, populations of L. invasa from a broad geographical area were screened for the symbionts currently known as reproductive manipulators, and both wasps and symbionts were genetically characterized using multiple genes. Molecular analyses suggested that L. invasa is in fact a complex of two cryptic species involved in the rapid and efficient spread of the wasp, the first recovered from the Mediterranean region and South America, the latter from China. All screened specimens were infected by endosymbiotic bacteria belonging to the genus Rickettsia. Two closely related Rickettsia strains were found, each infecting one of the two putative cryptic species of L. invasa and associated with different average sex ratios. Rickettsia were found to be localized in the female reproductive tissues and transovarially transmitted, suggesting a possible role of Rickettsia as the causal agent of thelytokous parthenogenesis in L. invasa. Implications for the variation of sex ratio and for the management of L. invasa are discussed. PMID:25970681
Directory of Open Access Journals (Sweden)
Francesco Nugnes
Full Text Available The blue-gum chalcid Leptocybe invasa Fisher & LaSalle (Hymenoptera: Eulophidae is a gall wasp pest of Eucalyptus species, likely native to Australia. Over the past 15 years it has invaded 39 countries on all continents where eucalypts are grown. The worldwide invasion of the blue gum chalcid was attributed to a single thelytokous morphospecies formally described in 2004. Subsequently, however, males have been recorded in several countries and the sex ratio of field populations has been found to be highly variable in different areas. In order to find an explanation for such sex ratio differences, populations of L. invasa from a broad geographical area were screened for the symbionts currently known as reproductive manipulators, and both wasps and symbionts were genetically characterized using multiple genes. Molecular analyses suggested that L. invasa is in fact a complex of two cryptic species involved in the rapid and efficient spread of the wasp, the first recovered from the Mediterranean region and South America, the latter from China. All screened specimens were infected by endosymbiotic bacteria belonging to the genus Rickettsia. Two closely related Rickettsia strains were found, each infecting one of the two putative cryptic species of L. invasa and associated with different average sex ratios. Rickettsia were found to be localized in the female reproductive tissues and transovarially transmitted, suggesting a possible role of Rickettsia as the causal agent of thelytokous parthenogenesis in L. invasa. Implications for the variation of sex ratio and for the management of L. invasa are discussed.
A new optical transmission spectrum of WASP-43b from ACCESS
Weaver, Ian; University of Arizona, Católica, Carnegie
2018-01-01
We present a new ground-based optical transmission spectrum of the Hot Jupiter WASP--43b obtained with the Inamori-Magellan Areal Camera and Spectrograph (IMACS) on the Baade Telescope at Las Campanas Observatory. These observations were made as part of the Arizona-CfA-Catolica+Carnegie Exoplanet Spectroscopy Survey (ACCESS), which aims at providing a uniform, large sample of visible transmission spectra of gaseous exoplanets that will become key in the era of JWST and comparative exoplanetology. Using multi-object differential spectrophotometry, we produce a high precision spectrum of this planet between 400 and 900 nm, combining three different transit epochs. In this analysis, we search for signals of Na I, H-alpha, and K I, as well as for the presence of hazes/clouds.
Mohammed, Muhamad Azmi; Zuki, Ameyra Aman; Yusof, Suhana; Othman, Nurul Wahida; Zain, Badrul Munir Md; Yaakop, Salmah
2018-04-01
Endosymbiont Wolbachia has always been a hot topic of discussion among entomologists and microbiologists as it can manipulate the reproductive system of their arthropod hosts. In this study, a total of 10 sequences which consist of concatenate data from three genetic markers of Wolbachia (groEL, gltA, and wsp) were obtained from opiine wasps from five localities in Peninsular Malaysia. Among the 10 sequences, six were isolated from Fopius arisanus, one from F. vandenboschi, and three from Psyttalia sp. SY2013. Based on Neighbour-Joining (NJ) analysis of the concatenate data and genetic distances, four variants of Wolbachia have been successfully identified. Our data thus provide an insight on Wolbachia infections in oriental insects as Wolbachia research is still considered as in early stage in Malaysia.
Directory of Open Access Journals (Sweden)
Hui Yu
Full Text Available Figs are the inflorescences of fig trees (Ficus spp., Moraceae. They are shaped like a hollow ball, lined on their inner surface by numerous tiny female flowers. Pollination is carried out by host-specific fig wasps (Agaonidae. Female pollinators enter the figs through a narrow entrance gate and once inside can walk around on a platform generated by the stigmas of the flowers. They lay their eggs into the ovules, via the stigmas and styles, and also gall the flowers, causing the ovules to expand and their pedicels to elongate. A single pollinator larva develops in each galled ovule. Numerous species of non-pollinating fig wasps (NPFW, belonging to other families of Chalcidoidea also make use of galled ovules in the figs. Some initiate galls, others make use of pollinator-generated galls, killing pollinator larvae. Most NPFW oviposit from the outside of figs, making peripherally-located pollinator larvae more prone to attack. Style length variation is high among monoecious Ficus spp. and pollinators mainly oviposit into more centrally-located ovules, with shorter styles. Style length variation is lower in male (wasp-producing figs of dioecious Ficus spp., making ovules equally vulnerable to attack by NPFW at the time that pollinators oviposit. We recorded the spatial distributions of galled ovules in mature male figs of the dioecious Ficus hirta in Southern China. The galls contained pollinators and three NPFW that kill them. Pollinators were concentrated in galls located towards the centre of the figs, NPFW towards the periphery. Due to greater pedicel elongation by male galls, male pollinators became located in more central galls than their females, and so were less likely to be attacked. This helps ensure that sufficient males survive, despite strongly female-biased sex ratios, and may be a consequence of the pollinator females laying mostly male eggs at the start of oviposition sequences.
3.6 AND 4.5 μm PHASE CURVES OF THE HIGHLY IRRADIATED ECCENTRIC HOT JUPITER WASP-14b
Energy Technology Data Exchange (ETDEWEB)
Wong, Ian; Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Lewis, Nikole K. [Space Telescope Science Institute, Baltimore, MD 21218 (United States); Kataria, Tiffany [Astrophysics Group, School of Physics, University of Exeter, Stocker Road, Exeter EX4 4QL (United Kingdom); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95604 (United States); Schwartz, Joel [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Seattle, WA 98195 (United States); Cowan, Nicolas B. [Department of Physics and Astronomy, Amherst College, Amherst, MA 01002 (United States); Deming, Drake [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Désert, Jean-Michel [Department of Astrophysical and Planetary Science, University of Colorado, Boulder, CO 80309 (United States); Fulton, Benjamin J.; Howard, Andrew W. [Institute for Astronomy, University of Hawaii, Honolulu, HI 96822 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States); Todorov, Kamen, E-mail: iwong@caltech.edu [Institute for Astronomy, ETH Zürich, 8093 Zürich (Switzerland)
2015-10-01
We present full-orbit phase curve observations of the eccentric (e ∼ 0.08) transiting hot Jupiter WASP-14b obtained in the 3.6 and 4.5 μm bands using the Spitzer Space Telescope. We use two different methods for removing the intrapixel sensitivity effect and compare their efficacy in decoupling the instrumental noise. Our measured secondary eclipse depths of 0.1882% ± 0.0048% and 0.2247% ± 0.0086% at 3.6 and 4.5 μm, respectively, are both consistent with a blackbody temperature of 2402 ± 35 K. We place a 2σ upper limit on the nightside flux at 3.6 μm and find it to be 9% ± 1% of the dayside flux, corresponding to a brightness temperature of 1079 K. At 4.5 μm, the minimum planet flux is 30% ± 5% of the maximum flux, corresponding to a brightness temperature of 1380 ± 65 K. We compare our measured phase curves to the predictions of one-dimensional radiative transfer and three-dimensional general circulation models. We find that WASP-14b’s measured dayside emission is consistent with a model atmosphere with equilibrium chemistry and a moderate temperature inversion. These same models tend to overpredict the nightside emission at 3.6 μm, while underpredicting the nightside emission at 4.5 μm. We propose that this discrepancy might be explained by an enhanced global C/O ratio. In addition, we find that the phase curves of WASP-14b (7.8 M{sub Jup}) are consistent with a much lower albedo than those of other Jovian mass planets with thermal phase curve measurements, suggesting that it may be emitting detectable heat from the deep atmosphere or interior processes.