Colon cancer proliferating desulfosinigrin in wasabi (Wasabia japonica).
Weil, Marvin J; Zhang, Yanjun; Nair, Muraleedharan G
2004-01-01
A reduced incidence of different types of cancer has been linked to consumption of Brassica vegetables, and there is evidence that glucosinolates (GSLs) and their hydrolysis products play a role in reducing cancer risk. Wasabi (Wasabia japonica) and horseradish (Armoracia rusticana), both Brassica vegetables, are widely used condiments both in Japanese cuisine and in the United States. Desulfosinigrin (DSS) (1) was isolated from a commercially available wasabi powder and from fresh wasabi roots. Sinigrin (2) was isolated from horseradish roots. DSS and sinigrin were evaluated for their inhibitory effects on cyclooxygenase-1 (COX-1) and cyclooxygenase-2 (COX-2) enzymes, on lipid peroxidation, and on the proliferation of human colon (HCT-116), breast (MCF-7), lung (NCIH460), and central nervous system (CNS, SF-268) cancer cell lines. DSS did not inhibit COX enzymes or lipid peroxidation at 250 microg/ml. Sinigrin inhibited lipid peroxidation by 71% at 250 microg/ml. However, DSS promoted the growth of HCT-116 (colon) and NCI H460 (lung) human cancer cells as determined by the MTT assay in a concentration-dependent manner. At 3.72 microg/ml, a 27% increase in the number of viable human HCT-116 colon cancer cells was observed; the corresponding increases at 7.50 and 15 microg/ml were 42 and 69%, respectively. At 60 microg/ml, DSS doubled the number of HCT-16 colon cancer cells. For NCI H460 human lung cancer cells, DSS at 60 microg/ml increased the cell number by 20%. Sinigrin showed no proliferating effect on the tumor cells tested. This is the first report of the tumor cell-proliferating activity by a desulfoglucosinolate, the biosynthetic precursor of GSLs found in Brassica spp.
Weil, Marvin J; Zhang, Yanjun; Nair, Muraleedharan G
2005-03-09
Cyclooxygenase and human tumor cell growth inhibitory extracts of horseradish (Armoracia rusticana) and wasabi (Wasabia japonica) rhizomes upon purification yielded active compounds 1-3 from horseradish and 4 and 5 from wasabi rhizomes. Spectroscopic analyses confirmed the identities of these active compounds as plastoquinone-9 (1), 6-O-acyl-beta-d-glucosyl-beta-sitosterol (2), 1,2-dilinolenoyl-3-galactosylglycerol (3), linolenoyloleoyl-3-beta-galactosylglycerol (4), and 1,2-dipalmitoyl-3-beta-galactosylglycerol (5). 3-Acyl-sitosterols, sinigrin, gluconasturtiin, and phosphatidylcholines isolated from horseradish and alpha-tocopherol and ubiquinone-10 from wasabi rhizomes isolated were inactive in our assays. At a concentration of 60 microg/mL, compounds 1 and 2 selectively inhibited COX-1 enzyme by 28 and 32%, respectively. Compounds 3, 4, and 5 gave 75, 42, and 47% inhibition of COX-1 enzyme, respectively, at a concentration of 250 microg/mL. In a dose response study, compound 3 inhibited the proliferation of colon cancer cells (HCT-116) by 21.9, 42.9, 51.2, and 68.4% and lung cancer cells (NCI-H460) by 30, 39, 44, and 71% at concentrations of 7.5, 15, 30, and 60 microg/mL, respectively. At a concentration of 60 microg/mL, compound 4 inhibited the growth of colon, lung, and stomach cancer cells by 28, 17, and 44%, respectively. This is the first report of the COX-1 enzyme and cancer cell growth inhibitory monogalactosyl diacylglycerides from wasabi and horseradish rhizomes.
Fuke, Yoko; Shinoda, Shoko; Nagata, Ikuko; Sawaki, Saeko; Murata, Mituyoshi; Ryoyama, Kazuo; Koizumi, Keiichi; Saiki, Ikuo; Nomura, Takahiro
2006-01-01
Effect of oral administration of 6-(methylsulfinyl)hexyl isothiocyanate (6-MITC) or a 6-MITC-containing T-wasabi fraction from wasabi root (Wasabia japonica Matsum) to inhibit the macroscopic pulmonary metastasis was studied with a murine B16-BL6 melanoma model. Two administration routes, subcutaneous or intravenous, and two administration times, prior to or concomitant with tumor inoculation, of 6-MITC or T-wasabi against the metastatic foci formation in C57BL/6J mouse lungs were compared. The number of metastasized foci per lung in either subcutaneous or intravenous injection was significantly reduced by intake of 6-MITC or a T-wasabi fraction. The maximum reduction by a T-wasabi fraction reached to 82%. Fifty-six percent of foci formation was inhibited by a 2 week-prior administration of 6-MITC (200 microM), whereas only 27% inhibition was obtained by a concomitant administration with tumor inoculation. Neither 6-MITC nor T-wasabi at tested concentrations showed any toxic effects. Together with our previous results, a component of the Japanese pungent spice, wasabi appears to inhibit not only tumor cell growth but also tumor metastasis. Therefore, 6-MITC from wasabi is apparently a useful dietary candidate for controlling tumor progression.
Li, G J; Dong, Q E; Ma, L; Huang, Y; Zhu, M L; Ji, Y P; Wang, Q H; Mo, M H; Zhang, K Q
2014-10-01
To characterize the nematicidal endophytic bacteria (NEB) of Wasabia japonica (wasabi) and evaluated the control efficacies of promising NEB as well as fresh wasabi residue (FWR) against Meloidogyne incognita on tomato. By in vitro bioassay, 53 NEB strains showing nematicidal efficacies of >50% against J2 of M. incognita were isolated from wasabi. Basing on 16S rRNA gene sequences, these NEB were identified into 18 species of 11 genera. In greenhouse, incorporation of selected NEB culture or FWR into potted soil significantly reduced infection of M. incognita on tomato. Treating tomatoes with either FWR or NEB of Raoultella terrigena RN16 and Pseudomonas reinekei SN21 in the field yielded excellent control efficacies against M. incognita, especially the combinations of FWR with either R. terrigena RN16 or Ps. reinekei SN21 at doses of 50 g plus 100 ml per plant or more. The results established that R. terrigena RN16 and Ps. reinekei SN21 applied separately or combined with FWR have the potential to provide bioprotection agents against M. incognita. This study provides novel way for disease management using combination of endophyte and host residue. © 2014 The Society for Applied Microbiology.
Kang, Ju-Hee; Choi, Seungho; Jang, Jeong-Eun; Ramalingam, Prakash; Ko, Young Tag; Kim, Sun Yeou; Oh, Seung Hyun
2017-08-01
Inflammatory bowel diseases (IBDs), including Crohn's disease (CD) and ulcerative colitis (UC), are prevalent and debilitating health problems worldwide. Many types of drugs are used to treat IBDs, but they exhibit adverse effects such as vomiting, nausea, abdominal pain, diarrhea, etc. In order to overcome the limitations of current therapeutic drugs, scientists have searched for functional foods from natural resources. In this study, we investigated the anti-colitic effects of Wasabia japonica extract in a DSS-induced colitis model. Wasabi japonica is a plant of the Brassicaceae family that has recently been reported to exhibit properties of detoxification, anti-inflammation, and induction of apoptosis in cancer cells. In this study, we generated wasabi ethanol extract (WK) and assessed its anti-colitic effect. In addition, in order to improve delivery of the extract to the colon, WK was coated with 5% Eudragit S100 (WKE), after which the anti-colitic effects of WKE were assessed. In conclusion, WK prevented development of colitis through inhibition of the NF-kB signaling pathway and recovery of epithelial tight junctions. In addition, the anti-colitic effect of WK was enhanced by improving its delivery to the colon by coating the WK with Eudragit S100. Therefore, we suggest that wasabi can be used as a new functional food to prevent IBDs due to its anti-colitic effect.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Wasabia japonica 名詞 一般 * * * * ワサ...ビ ワサビ ワサビ Thesaurus2015 200906097830728309 C LS06/LS72 UNKNOWN_2 Wasabia japonica
Directory of Open Access Journals (Sweden)
Yu-Jen Chen
2014-01-01
Full Text Available The naturally occurring compound 6-(methylsulfinylhexyl isothiocyanate (6-MITC was isolated from Wasabia japonica (Wasabi, a pungent spice used in Japanese food worldwide. The synthetic derivatives 6-(methylsulfenylhexyl isothiocyanate (I7447 and 6-(methylsulfonylhexyl isothiocyanate (I7557 are small molecule compounds derived from 6-MITC. This study aimed to evaluate the effect of these compounds on human pancreatic cancer cells. Human pancreatic cancer cell lines PANC-1 and BxPC-3 were used to perform an MTT assay for cell viability and Liu’s stain for morphological observation. The cell cycle was analyzed by DNA histogram. Aldehyde dehydrogenase (ALDH activity was used as a marker for cancer stem cells (CSC. Western blotting was performed for the expression of proteins related to CSC signaling. The results showed that compounds 6-MITC and I7557, but not I7447, inhibited viability of both PANC-1 and BxPC-3 cells. Morphological observation showed mitotic arrest and apoptosis in 6-MITC- and I7557-treated cells. These two compounds induced G2/M phase arrest and hypoploid population. Percentages of ALDH-positive PANC-1 cells were markedly reduced by 6-MITC and I7557 treatment. The expression of CSC signaling molecule SOX2, but not NOTCH1, ABCG2, Sonic hedgehog, or OCT4, was inhibited by 6-MITC and I7557. In conclusion, wasabi compounds 6-MITC and I7557 may possess activity against the growth and CSC phenotypes of human pancreatic cancer cells.
Valente, Rita S; Nadal-Jimenez, Pol; Carvalho, André F P; Vieira, Filipe J D; Xavier, Karina B
2017-05-23
Bacterial communities can sense their neighbors, regulating group behaviors in response to cell density and environmental changes. The diversity of signaling networks in a single species has been postulated to allow custom responses to different stimuli; however, little is known about how multiple signals are integrated and the implications of this integration in different ecological contexts. In the plant pathogen Pectobacterium wasabiae (formerly Erwinia carotovora ), two signaling networks-the N-acyl homoserine lactone (AHL) quorum-sensing system and the Gac/Rsm signal transduction pathway-control the expression of secreted plant cell wall-degrading enzymes, its major virulence determinants. We show that the AHL system controls the Gac/Rsm system by affecting the expression of the regulatory RNA RsmB. This regulation is mediated by ExpR2, the quorum-sensing receptor that responds to the P. wasabiae cognate AHL but also to AHLs produced by other bacterial species. As a consequence, this level of regulation allows P. wasabiae to bypass the Gac-dependent regulation of RsmB in the presence of exogenous AHLs or AHL-producing bacteria. We provide in vivo evidence that this pivotal role of RsmB in signal transduction is important for the ability of P. wasabiae to induce virulence in response to other AHL-producing bacteria in multispecies plant lesions. Our results suggest that the signaling architecture in P. wasabiae was coopted to prime the bacteria to eavesdrop on other bacteria and quickly join the efforts of other species, which are already exploiting host resources. IMPORTANCE Quorum-sensing mechanisms enable bacteria to communicate through small signal molecules and coordinate group behaviors. Often, bacteria have various quorum-sensing receptors and integrate information with other signal transduction pathways, presumably allowing them to respond to different ecological contexts. The plant pathogen Pectobacterium wasabiae has two N-acyl homoserine lactone
Antibacterial activities of wasabi against Escherichia coli O157:H7 and Staphylococcus aureus
Directory of Open Access Journals (Sweden)
Zhongjing Lu
2016-09-01
Full Text Available Escherichia coli O157:H7 and Staphylococcus aureus are two of the major pathogens frequently involved in foodborne outbreaks. Control of these pathogens in foods is essential to food safety. It is of great interest in the use of natural antimicrobial compounds present in edible plants to control foodborne pathogens as consumers prefer more natural green foods. Allyl isothiocyanate (AITC is an antimicrobial compound naturally present in wasabi (Japanese horseradish and several other edible plants. Although the antibacterial effects of pure AITC and wasabi extract (essential oil against several bacteria have been reported, the antibacterial property of natural wasabi has not been well studied. This study investigated the antibacterial activities of wasabi as well as AITC against E. coli O157:H7 and S. aureus. Chemical analysis showed that AITC is the major isothiocyanate in wasabi. The AITC concentration in the wasabi powder used in this study was 5.91±0.59 mg/g. The minimum inhibitory concentration (MIC of wasabi against E. coli O157:H7 or S. aureus was 1% (or 10 mg/ml. Wasabi at 4% displayed higher bactericidal activity against S. aureus than against E. coli O157:H7. The MIC of AITC against either pathogen was between 10 and 100 µg/ml. AITC at 500 µg/ml was bactericidal against both pathogens while AITC at 1000 µg/ml eliminated E. coli O157:H7 much faster than S. aureus. The results from this study showed that wasabi has strong antibacterial property and has high potential to effectively control E. coli O157:H7 and S. aureus in foods. The antibacterial property along with its natural green color, unique flavor, and advantage to safeguard foods at the point of ingestion makes wasabi a promising natural edible antibacterial plant. The results from this study may be of significant interest to the food industry as they develop new and safe foods. These results may also stimulate more research to evaluate the antibacterial effect of wasabi
Antibacterial Activities of Wasabi against Escherichia coli O157:H7 and Staphylococcus aureus.
Lu, Zhongjing; Dockery, Christopher R; Crosby, Michael; Chavarria, Katherine; Patterson, Brett; Giedd, Matthew
2016-01-01
Escherichia coli O157:H7 and Staphylococcus aureus are two of the major pathogens frequently involved in foodborne outbreaks. Control of these pathogens in foods is essential to food safety. It is of great interest in the use of natural antimicrobial compounds present in edible plants to control foodborne pathogens as consumers prefer more natural "green" foods. Allyl isothiocyanate (AITC) is an antimicrobial compound naturally present in wasabi (Japanese horseradish) and several other edible plants. Although the antibacterial effects of pure AITC and wasabi extract (essential oil) against several bacteria have been reported, the antibacterial property of natural wasabi has not been well studied. This study investigated the antibacterial activities of wasabi as well as AITC against E . coli O157:H7 and S . aureus . Chemical analysis showed that AITC is the major isothiocyanate in wasabi. The AITC concentration in the wasabi powder used in this study was 5.91 ± 0.59 mg/g. The minimum inhibitory concentration (MIC) of wasabi against E. coli O157:H7 or S. aureus was 1% (or 10 mg/ml). Wasabi at 4% displayed higher bactericidal activity against S. aureus than against E. coli O157:H7. The MIC of AITC against either pathogen was between 10 and 100 μg/ml. AITC at 500 μg/ml was bactericidal against both pathogens while AITC at 1000 μg/ml eliminated E. coli O157:H7 much faster than S. aureus . The results from this study showed that wasabi has strong antibacterial property and has high potential to effectively control E. coli O157:H7 and S. aureus in foods. The antibacterial property along with its natural green color, unique flavor, and advantage to safeguard foods at the point of ingestion makes wasabi a promising natural edible antibacterial plant. The results from this study may be of significant interest to the food industry as they develop new and safe foods. These results may also stimulate more research to evaluate the antibacterial effect of wasabi against other
Directory of Open Access Journals (Sweden)
Rita S. Valente
2017-05-01
Full Text Available Bacterial communities can sense their neighbors, regulating group behaviors in response to cell density and environmental changes. The diversity of signaling networks in a single species has been postulated to allow custom responses to different stimuli; however, little is known about how multiple signals are integrated and the implications of this integration in different ecological contexts. In the plant pathogen Pectobacterium wasabiae (formerly Erwinia carotovora, two signaling networks—the N-acyl homoserine lactone (AHL quorum-sensing system and the Gac/Rsm signal transduction pathway—control the expression of secreted plant cell wall-degrading enzymes, its major virulence determinants. We show that the AHL system controls the Gac/Rsm system by affecting the expression of the regulatory RNA RsmB. This regulation is mediated by ExpR2, the quorum-sensing receptor that responds to the P. wasabiae cognate AHL but also to AHLs produced by other bacterial species. As a consequence, this level of regulation allows P. wasabiae to bypass the Gac-dependent regulation of RsmB in the presence of exogenous AHLs or AHL-producing bacteria. We provide in vivo evidence that this pivotal role of RsmB in signal transduction is important for the ability of P. wasabiae to induce virulence in response to other AHL-producing bacteria in multispecies plant lesions. Our results suggest that the signaling architecture in P. wasabiae was coopted to prime the bacteria to eavesdrop on other bacteria and quickly join the efforts of other species, which are already exploiting host resources.
2012-01-01
The influence of the aqueous extract of Japanese Dodder (Cuscuta japonica) on the velocity of Mycobacterium tuberculosis growth has been shown. To accelerate the growth of Myc. tuberculosis, dry culture media of FAST-3L and of Lowenstein Jensen were mixed with the aqueous extract of Cuscuta japonica. It was found out that the complex chemical composition of the aqueous extract made of dry seeds or dry vegetative stems of the plant parasite Cuscuta japonica has a biological effect on Myc. tube...
Valente, Rita S; Xavier, Karina B
2016-01-15
Pectobacterium wasabiae (previously known as Erwinia carotovora) is an important plant pathogen that regulates the production of plant cell wall-degrading enzymes through an N-acyl homoserine lactone-based quorum sensing system and through the GacS/GacA two-component system (also known as ExpS/ExpA). At high cell density, activation of GacS/GacA induces the expression of RsmB, a noncoding RNA that is essential for the activation of virulence in this bacterium. A genetic screen to identify regulators of RsmB revealed that mutants defective in components of a putative Trk potassium transporter (trkH and trkA) had decreased rsmB expression. Further analysis of these mutants showed that changes in potassium concentration influenced rsmB expression and consequent tissue damage in potato tubers and that this regulation required an intact Trk system. Regulation of rsmB expression by potassium via the Trk system occurred even in the absence of the GacS/GacA system, demonstrating that these systems act independently and are both required for full activation of RsmB and for the downstream induction of virulence in potato infection assays. Overall, our results identified potassium as an essential environmental factor regulating the Rsm system, and the consequent induction of virulence, in the plant pathogen P. wasabiae. Crop losses from bacterial diseases caused by pectolytic bacteria are a major problem in agriculture. By studying the regulatory pathways involved in controlling the expression of plant cell wall-degrading enzymes in Pectobacterium wasabiae, we showed that the Trk potassium transport system plays an important role in the regulation of these pathways. The data presented further identify potassium as an important environmental factor in the regulation of virulence in this plant pathogen. We showed that a reduction in virulence can be achieved by increasing the extracellular concentration of potassium. Therefore, this work highlights how elucidation of the
Kitamura, Masashi; Ando, Hirokazu; Sasaki, Yohei
2018-03-01
Coptis japonica is widely distributed in Japan, and its dried rhizome is a source of the domestic herbal medicine Coptidis Rhizoma ( Oren). There are three varieties of C. japonica, two of which, namely, C. japonica var. anemonifolia and C. japonica var. major, are important as sources of traditional medicines. Coptis japonica var. anemonifolia and C. japonica var. major are distinguishable on the basis of their ternate or biternate compound leaves, respectively. In the Hokuriku area, where both C. japonica var. anemonifolia and C. japonica var. major grow naturally, some individual plants cannot be identified unambiguously on the basis of leaf morphology because changes in leaf morphology may occur due to intra-variety variation or crossbreeding between the two varieties. In addition, genetic differences between the two varieties have remained unclear. In this study, we employed new genetic and morphological classification approaches to discriminate between the two varieties. Based on the single nucleotide polymorphisms of the tetrahydroberberine oxidase gene, we found four conserved SNPs between the two varieties and were able to classify C. japonica into two varieties and crossbreeds. Furthermore, we introduced a new leaf type index based on the overall degree of leaflet dissection calculated by surface area of a leaflet and length of leaflet margin and petiolule. Using our new index we were able to discriminate between the two varieties and their crossbreeds more accurately than is possible with the conventional discrimination method. Our genetic and morphological classification methods may be used as novel benchmarks to discriminate between the two varieties and their crossbreeds.
Effects of Sophora japonica flowers (Huaihua on cerebral infarction
Directory of Open Access Journals (Sweden)
Hsieh Ching-Liang
2010-09-01
Full Text Available Abstract The dried flowers and buds of Sophora japonica are used as a medicinal herb in China, Japan and Korea to treat bleeding hemorrhoids and hematemesis. This article presents an overview of the effects of Sophora japonica on cerebral infarction based on literature searched from Medline, PubMed, Cochrane Library and the China National Knowledge Infrastructure (CNKI. Sophora japonica contains both anti-hemorrhagic and anti-hemostatic substances. Sophora japonica reduces cerebral infarction partly as a result of its anti-oxidative and anti-inflammatory activities. Previous studies found that Sophora japonica reduced the size of cerebral infarction and neurological deficits and reduced microglial activation, interleukin-1β release and number of apoptotic cells in ischemia-reperfusion injured Sprague-Dawley rats. Further study is required to determine the relationship between Sophora japonica-mediated reduction in cerebral infarction size and the effects of Sophora japonica on platelet aggregation and cardiovascular function.
Diagnostic Assay for Rickettsia japonica
Hanaoka, Nozomu; Matsutani, Minenosuke; Kawabata, Hiroki; Yamamoto, Seigo; Fujita, Hiromi; Sakata, Akiko; Azuma, Yoshinao; Ogawa, Motohiko; Takano, Ai; Watanabe, Haruo; Kishimoto, Toshio; Shirai, Mutsunori; Kurane, Ichiro
2009-01-01
We developed a specific and rapid detection system for Rickettsia japonica and R. heilongjiangensis, the causative agents of spotted fever, using a TaqMan minor groove binder probe for a particular open reading frame (ORF) identified by the R. japonica genome project. The target ORF was present only in R. japonica–related strains. PMID:19961684
Valente, Rita S.; Xavier, Karina B.
2015-01-01
Pectobacterium wasabiae (previously known as Erwinia carotovora) is an important plant pathogen that regulates the production of plant cell wall-degrading enzymes through an N-acyl homoserine lactone-based quorum sensing system and through the GacS/GacA two-component system (also known as ExpS/ExpA). At high cell density, activation of GacS/GacA induces the expression of RsmB, a noncoding RNA that is essential for the activation of virulence in this bacterium. A genetic screen to identify reg...
IDENTIFICATION OF WIDE COMPATIBILITY VARIETIES IN SOME TROPICAL JAPONICA RICE
Directory of Open Access Journals (Sweden)
A. Hairmansis
2013-07-01
Full Text Available The F1 hybrid sterility in indica/japonica crosses is the major barrier in developing hybrid rice varieties between these two diverse germplasm. The sterility problem in japonica/indica hybrids can be overcome by using wide compatibility genes. The objective of this study was to identify wide compatibility varieties (WCVs in some tropical japonica rice. Twenty five tropical japonica varieties as male parents were crossed with indica (IR64 and japonica (Akitakomachi testers as female parents. The crosses were planted following a randomized complete block design with three replications. Varieties having average spikelet fertility of more than 70% with both the indica and japonica testers were rated as WCVs. Result from this study showed that six tropical japonica varieties were classified as WCVs, i.e., Cabacu, Grogol, Kencana Bali, Klemas, Lampung Lawer, and Napa. Hybrid sterility is caused by partial sterility of male and female gametes. The WCVs from the present study can be used in hybrid rice breeding program to solve hybrid sterility in indica/japonica hybrids.
African Journals Online (AJOL)
user
2011-03-28
Mar 28, 2011 ... pyrophosphatase (V-PPiase) were isolated from loquat (Eriobotrya japonica) pulp. Thereafter, northern analysis ... #These authors contributed equally to this work. ... (TA) correlates highly with malate concentration, but does not correlate ... (1997) have shown that, a nonacid sweet lime (Citrus limmetioides) ...
The Influence of Different Processing Methods on Component Content of Sophora japonica
Ji, Y. B.; Zhu, H. J.; Xin, G. S.; Wei, C.
2017-12-01
The purpose of this experiment is to understand the effect of different processing methods on the content of active ingredients in Sophora japonica, and to determine the content of rutin and quercetin in Sophora japonica under different processing methods by UV spectrophotometry of the content determination. So as to compare the effect of different processing methods on the active ingredient content of Sophora japonica. Experiments can be seen in the rutin content: Fried Sophora japonica>Vinegar sunburn Sophora> Health products Sophora japonica> Charred sophora flower, Vinegar sunburn Sophora and Fried Sophora japonica difference is not obvious; Quercetin content: Charred sophora flower> Fried Sophora japonica> Vinegar sunburn Sophora>Health products Sophora japonica. It is proved that there are some differences in the content of active ingredients in Sophora japonica in different processing methods. The content of rutin increased with the increase of the processing temperature, but the content decreased after a certain temperature; Quercetin content will increase gradually with time.
Directory of Open Access Journals (Sweden)
Xitao Wang
2016-07-01
Conclusions: This study provides an alternative and economical way to reduce the algin content in L. japonica through degradation by WB1, making it a promising potential source of feed for cultured L. japonica.
Yu, Xiao-Dan; Jiang, Chao; Huang, Lu-Qi; Qin, Shuang-Shuang; Zeng, Xiang-Mei; Chen, Ping; Yuan, Yuan
2013-08-01
To clone SABATH methyltransferase (rLjSABATHMT) gene in Lonicera japonica var. chinensis, and compare the gene expression and intron sequence of SABATH methyltransferase orthologous in L. japonica with L. japonica var. chinensis. It provide a basis for gene regulate the formation of L. japonica floral scents. The cDNA and genome sequences of LjSABATHMT from L. japonica var. chinensis were cloned according to the gene fragments in cDNA library. The LjSABATHMT protein was characterized by bioinformatics analysis. SABATH family phylogenetic tree were built by MEGA 5.0. The transcripted level of SABATHMT orthologous were analyzed in different organs and different flower periods of L. japonica and L. japonica var. chinensis using RT-PCR analysis. Intron sequences of SABATHMT orthologous were also analyzied. The cDNA of LjSABATHMT was 1 251 bp, had a complete coding frame with 365 amino acids. The protein had the conservative SABATHMT domain, and phylogenetic tree showed that it may be a salicylic acid/benzoic acid methyltransferase. Higher expression of SABATH methyltransferase orthologous was found in flower. The intron sequence of L. japonica and L. japonica var. chinensis had rich polymorphism, and two SNP are unique genotype of L. japonica var. chinensis. The motif elements in two orthologous genes were significant differences. The intron difference of SABATH methyltransferase orthologous could be inducing to difference of gene expression between L. japonica and L. japonica var. chinensis. These results will provide important base on regulating active compounds of L. japonica.
Characteristics and Application Analysis of Traditional Chinese Medicine Containing Sophora Japonica
Wei, Zhenzhen; Feng, Suxiang; Fang, Xiaoyan; Miao, Mingsan
2018-01-01
Purposes: To sum up the characteristics of Chinese medicine with Sophora Japonica and provide reference for the research, development and utilization of the Chinese medicine of Sophora japonica in the future. Methods: The author sums up the forms, functions, indications, usage, dosage and contraindications of the proprietary Chinese medicine containing Sophora Japonica in the Chinese Pharmacopoeia and the Ministerial standards. In addition, we will inquire about the clinical application of proprietary Chinese medicine containing Sophora japonica in the China National Knowledge Infrastructure (CNKI). Results: The proprietary Chinese medicine containing Sophora Japonica was widely used in the treatment of various diseases in clinic, but it was taken orally and without any external use of Chinese patent medicine. Moreover, in most of the proprietary Chinese medicine, Sophora japonica was used as a supplement; In addition, the causes of adverse reactions were not analyzed, and the safety of the drugs needed to be further analyzed. Conclusions: To make clear the role of Sophora japonica in proprietary Chinese medicine, we can develop the Chinese medicine new dosage forms of Sophora japonica; The Chinese medicine is made up of a variety of single herbs, some are toxic drugs, when an adverse reaction occurs, We should analyze the specific causes and avoid the occurrence of adverse reactions. In addition, Sophora japonica is a traditional herbal medicine and food in China; we can expand the application in other areas and explore the pharmacological and toxicological pathology.
Different Aluminum Tolerance among Indica, Japonica and Hybrid Rice Varieties
Directory of Open Access Journals (Sweden)
Shu Chang
2015-05-01
Full Text Available Hydroponic cultures were conducted to compare the aluminum (Al tolerance among different rice (Oryza sativa L. varieties, including indica, japonica and their hybrids. The results showed that the root growth of rice plant was inhibited in different degrees among Al treated varieties. The Al tolerance observed through relative root elongation indicated that five japonica varieties including Longjing 9, Dharial, LGC 1, Ribenyou and Koshihikari were relatively more tolerant than indica varieties. Most indica varieties in this study, such as Aus 373 and 9311 (awnless, were sensitive to Al toxicity. The Al tolerance of most progenies from japonica × indica or indica × japonica crosses was constantly consistent with indica parents. The differences of Al tolerance among Longjing 9 (japonica, Yangdao 6 (indica and Wuyunjing 7 (japonica were studied. Biomass and the malondial-dehyde content of Yangdao 6 under Al exposure decreased and increased, respectively, while there was no significant effect on those of Longjing 9 and Wuyunjing 7. Remarkable reduction of root activities was observed in all these three rice varieties. Significantly higher Al content in roots was found in Yangdao 6 compared to Longjing 9 or Wuyunjing 7.
Genetic Differentiations among the Populations of Salvia japonica (Lamiaceae and Its Related Species
Directory of Open Access Journals (Sweden)
SUDARMONO
2008-03-01
Full Text Available Morphological and genetic variations within Salvia japonica (Lamiaceae and its related species in Japan were analyzed for clarifying their taxonomic significance. The genetic variations were explored through chloroplast and nuclear ribosomal DNA sequences and allozyme polymorphisms. Since chromosome numbers characterized the genus of Salvia, we also examined whether the karyotypes were different. We examined 58 populations of S. japonica and 14 populations of others species of Salvia. Among the populations of S. japonica represented four forms (f. japonica, f. longipes, f. lanuginosa and f. albiflora. The size of chromosomes were various among Salvia spp. Based on the allozyme as well as the DNA sequence, the populations of S. japonica separated from the others Salvia species. The populations of S. japonica exhibited four combinations of the morphological characters. However, these combinations did not correlate to the four forms of S. japonica. In addition, the morphological variations did not correlate to the allozyme and DNA sequences. It is suggested that the four morphological variations as well as the four form of S. japonica should not considered to be a taxonomic unit; accordingly, S. japonica were considered to be still at the early stage of speciation process.
Wang, Dong; Hu, Fei; Chen, Yu-Fen; Yang, Jun; Kong, Chui-Hua
2007-08-01
The study on the photosynthetic characteristics of Cuscuta japonica and its hosts showed that there was a negative correlation between the photosynthetic pigment content (PPC) of C. japonica and its hosts. The PPC increased in the C. japonica-preferred hosts' parasitized and neighboring leaves, but decreased in its less preferred hosts' parasitized and neighboring leaves. The leaves parasitized by C. japonica and their neighboring far from the parasitized ones had a lowered net photosynthesis rate P(n), and the decreasing order accorded with that of parasitization. The decrease of P(n) for C. japonica-less preferred hosts was mainly due to the stomatal factors, but that for the preferred hosts was regulated by multi-factors. Under light, the PPC of C. japonica detached from preferred hosts increased faster than that of C. japonica detached from less preferred hosts, but the dry matter decrease was in adverse. In dark, however, the changes in PPC and dry matter content of C. japonica were not significant, whatever hosts it was detached from.
Antioxidant and Anti-Adipogenic Activities of Trapa japonica Shell Extract Cultivated in Korea
Lee, DooJin; Lee, Ok-Hwan; Choi, Geunpyo; Kim, Jong Dai
2017-01-01
Trapa japonica shell contains phenolic compounds such as tannins. Studies regarding the antioxidant and anti-adipogenic effects of Trapa japonica shell cultivated in Korea are still unclear. Antioxidant and anti-adipogenic activities were measured by in vitro assays such as 2,2-diphenyl-1-picrylhydrazy (DPPH) radical scavenging activity, 2,2′-azinobis( 3-ethylbenzothiazoline-6-sulphonic acid) (ABTS) radical scavenging activity, ferric reducing ability of plasma assay, reducing power, superoxide dismutase-like activity, and iron chelating ability in 3T3-L1 cells. We also measured the total phenol and flavonoids contents (TPC and TFC, respectively) in Trapa japonica shell extract. Our results show that TPC and TFC of Trapa japonica shell extract were 157.7±0.70 mg gallic acid equivalents/g and 25.0±1.95 mg quercetin equivalents/g, respectively. Trapa japonica shell extract showed strong antioxidant activities in a dose-dependent manner in DPPH and ABTS radical scavenging activities and other methods. Especially, the whole antioxidant activity test of Trapa japonica shell extract exhibited higher levels than that of butylated hydroxytoluene as a positive control. Furthermore, Trapa japonica shell extract inhibited lipid accumulation and reactive oxygen species production during the differentiation of 3T3-L1 preadipocytes. Trapa japonica shell extract possessed a significant antioxidant and anti-adipogenic property, which suggests its potential as a natural functional food ingredient. PMID:29333386
Transcriptome sequencing and De Novo analysis of Youngia japonica using the illumina platform.
Directory of Open Access Journals (Sweden)
Yulan Peng
Full Text Available Youngia japonica, a weed species distributed worldwide, has been widely used in traditional Chinese medicine. It is an ideal plant for studying the evolution of Asteraceae plants because of its short life history and abundant source. However, little is known about its evolution and genetic diversity. In this study, de novo transcriptome sequencing was conducted for the first time for the comprehensive analysis of the genetic diversity of Y. japonica. The Y. japonica transcriptome was sequenced using Illumina paired-end sequencing technology. We produced 21,847,909 high-quality reads for Y. japonica and assembled them into contigs. A total of 51,850 unigenes were identified, among which 46,087 were annotated in the NCBI non-redundant protein database and 41,752 were annotated in the Swiss-Prot database. We mapped 9,125 unigenes onto 163 pathways using the Kyoto Encyclopedia of Genes and Genomes Pathway database. In addition, 3,648 simple sequence repeats (SSRs were detected. Our data provide the most comprehensive transcriptome resource currently available for Y. japonica. C4 photosynthesis unigenes were found in the biological process of Y. japonica. There were 5596 unigenes related to defense response and 1344 ungienes related to signal transduction mechanisms (10.95%. These data provide insights into the genetic diversity of Y. japonica. Numerous SSRs contributed to the development of novel markers. These data may serve as a new valuable resource for genomic studies on Youngia and, more generally, Cichoraceae.
[Two kaempferol triglycosides from pericarps of Sophora japonica L].
Tang, Y P; Lou, F C; Wang, J H
2001-12-01
To study the flavonol triglycosides in the pericarps of Sophora japonica. Various chromatographic techniques were used to isolate and purify the constituents. The structures were elucidated by chemical evidence and spectral analysis, especially by 2D NMR experiments. Two kaempferol triglycosides were isolated and identified as kaempferol 3-O-beta-D-sophoroside-7-O-alpha-L-rhamnoside and kaempferol 3-O-(2"-O-beta-D-glucosyl)-beta-D-rutinoside. Both of them were reported in S. japonica for the first time.
Directory of Open Access Journals (Sweden)
Cristina Rodrigues Mendes
2012-10-01
Full Text Available The southern State of Rio Grande do Sul (RS is the main rice producer in Brazil with a 60% participation of the national production and 86% participation of the region. Rice culture irrigation system is done by flooding, which leads to soil salinization, a major environmental constraint to production since it alters the plants’ metabolism exposed to this type of stress. The indica cultivar, widely used in RS, has a higher sensitivity to salinity when compared to that of the japonica cultivar in other physiological aspects. Current research analyzes enzymes expression involved in salt-subjected indica and japonica rice cultivars’ respiration. Oryza sativa L. spp. japonica S.Kato (BRS Bojuru, IAS 12-9 Formosa and Goyakuman and Oryza sativa L. spp. indica S. Kato (BRS Taim-7, BRS Atalanta and BRS Querencia were the cultivars employed. Seedlings were transferred to 15 L basins containing 50% Hoagland nutrient solution increased by 0, 25, 50, 75 and 100 mM NaCl, and collected at 14, 28 and 42 days after transfer (DAT. Plant tissues were macerated and placed in eppendorf tubes with Scandálios extractor solution. Electrophoresis was performed in 7% of the polyacrylamide gels in vertical vats. Bands were revealed for the following enzymes systems: esterase, alcohol dehydrogenase, phosphoglucoisomerase, malate dehydrogenase, malic enzyme and alpha amylase. The enzymes expression was greater in subspecies japonica, with more intense bands in proportion to salinity increase. Results show that enzyme systems are involved in the salinity defense mechanisms in O. sativa spp. japonica cultivar.O Estado do Rio Grande do Sul (RS destaca-se como principal produtor de arroz, participando com 60% da produção nacional e 86% da regional. O sistema de irrigação da cultura é por inundação, que induz o solo à salinização, um dos maiores limitadores ambientais à produção, alterando o metabolismo da plantas expostas a este tipo de estresse. As cultivares
De Novo Assembly and Characterization of Sophora japonica Transcriptome Using RNA-seq
Directory of Open Access Journals (Sweden)
Liucun Zhu
2014-01-01
Full Text Available Sophora japonica Linn (Chinese Scholar Tree is a shrub species belonging to the subfamily Faboideae of the pea family Fabaceae. In this study, RNA sequencing of S. japonica transcriptome was performed to produce large expression datasets for functional genomic analysis. Approximate 86.1 million high-quality clean reads were generated and assembled de novo into 143010 unique transcripts and 57614 unigenes. The average length of unigenes was 901 bps with an N50 of 545 bps. Four public databases, including the NCBI nonredundant protein (NR, Swiss-Prot, Kyoto Encyclopedia of Genes and Genomes (KEGG, and the Cluster of Orthologous Groups (COG, were used to annotate unigenes through NCBI BLAST procedure. A total of 27541 of 57614 unigenes (47.8% were annotated for gene descriptions, conserved protein domains, or gene ontology. Moreover, an interaction network of unigenes in S. japonica was predicted based on known protein-protein interactions of putative orthologs of well-studied plant genomes. The transcriptome data of S. japonica reported here represents first genome-scale investigation of gene expressions in Faboideae plants. We expect that our study will provide a useful resource for further studies on gene expression, genomics, functional genomics, and protein-protein interaction in S. japonica.
Two cases of schistosomiasis japonica diagnosed on computed tomography and ultrasonography
Energy Technology Data Exchange (ETDEWEB)
Seki, Tatsuo; Midorikawa, Shigeo; Hagiri, Masumi; Itoh, Haruhisa; Haku, Eijitsu (Teikyo Univ., Tokyo (Japan). Faculty of Medicine)
1982-12-01
We reported two cases of schistosomiasis japonica which showed pathognomonic pattern on liver C.T. and ultrasonography. Schistosomiasis japonica is an endemic disease in areas of Japan, but only chronic case of the disease is found now since Schistosoma Japonicum is thought to be died out in Japan. The adult worms are most commonly in branches of portal system, such as superior mesenteric vein, and many eggs are carried to the liver, where they cause inflammatory pseudotubercle formation, periportal fibrosis, and calcifications in interlobular connective tissue. According to Nakayama et al, pathognomonic pattern of schistosomiasis japonica on U.S. for the liver consists of the amounts of the eggs' calcifications, that is, the more eggs' calcifications, the more pathognomonic U.S. finding. Typical sonographic finding in the liver is network or fishscale pattern, which consists of streaky high level echo and internal low level echo. C.T. similarly demonstrates mosaic high density streak resulting from eggs' calcifications in peripheral portal branches. In addition, if patient's past history shows the life in the endemic area such as these two cases, we can easily make a diagnosis of ''schistosomiasis japonica''.
Two cases of schistosomiasis japonica diagnosed on computed tomography and ultrasonography
International Nuclear Information System (INIS)
Seki, Tatsuo; Midorikawa, Shigeo; Hagiri, Masumi; Itoh, Haruhisa; Haku, Eijitsu
1982-01-01
We reported two cases of schistosomiasis japonica which showed pathognomonic pattern on liver C.T. and ultrasonography. Schistosomiasis japonica is an endemic disease in areas of Japan, but only chronic case of the disease is found now since Schistosoma Japonicum is thought to be died out in Japan. The adult worms are most commonly in branches of portal system, such as superior mesenteric vein, and many eggs are carried to the liver, where they cause inflammatory pseudotubercle formation, periportal fibrosis, and calcifications in interlobular connective tissue. According to Nakayama et al, pathognomonic pattern of schistosomiasis japonica on U.S. for the liver consists of the amounts of the eggs' calcifications, that is, the more eggs' calcifications, the more pathognomonic U.S. finding. Typical sonographic finding in the liver is network or fishscale pattern, which consists of streaky high level echo and internal low level echo. C.T. similarly demonstrates mosaic high density streak resulting from eggs' calcifications in peripheral portal branches. In addition, if patient's past history shows the life in the endemic area such as ours two cases, we can easily make a diagnosis of ''schistosomiasis japonica''
Directory of Open Access Journals (Sweden)
Libin eZhang
2016-05-01
Full Text Available The perennial and evergreen twining vine, Lonicera japonica is an important herbal medicine with great economic value. However, gene expression information for flowers and leaves of L. japonica remains elusive, which greatly impedes functional genomics research on this species. In this study, transcriptome profiles from leaves and flowers of L. japonica were examined using next-generation sequencing technology. A total of 239.41 million clean reads were used for de novo assembly with Trinity software, which generated 150,523 unigenes with N50 containing 947 bp. All the unigenes were annotated using Nr, SwissProt, COGs (Clusters of Orthologous Groups, GO (Gene Ontology and KEGG (Kyoto Encyclopedia of Genes and Genomes databases. A total of 35,327 differentially expressed genes (DEGs, P≤0.05 between leaves and flowers were detected. Among them, a total of 6,602 DEGs were assigned with important biological processes including Metabolic process, Response to stimulus, Cellular process and etc. KEGG analysis showed that three possible enzymes involved in the biosynthesis of chlorogenic acid were up-regulated in flowers. Furthermore, the TF-based regulation network in L. japonica identified three differentially expressed transcription factors between leaves and flowers, suggesting distinct regulatory roles in L. japonica. Taken together, this study has provided a global picture of differential gene expression patterns between leaves and flowers in L japonica, providing a useful genomic resource that can also be used for functional genomics research on L. japonica in the future.
Antimicrobial Air Filters Using Natural Euscaphis japonica Nanoparticles.
Directory of Open Access Journals (Sweden)
Gi Byoung Hwang
Full Text Available Controlling bioaerosols has become more important with increasing participation in indoor activities. Treatments using natural-product nanomaterials are a promising technique because of their relatively low toxicity compared to inorganic nanomaterials such as silver nanoparticles or carbon nanotubes. In this study, antimicrobial filters were fabricated from natural Euscaphis japonica nanoparticles, which were produced by nebulizing E. japonica extract. The coated filters were assessed in terms of pressure drop, antimicrobial activity, filtration efficiency, major chemical components, and cytotoxicity. Pressure drop and antimicrobial activity increased as a function of nanoparticle deposition time (590, 855, and 1150 µg/cm2(filter at 3-, 6-, and 9-min depositions, respectively. In filter tests, the antimicrobial efficacy was greater against Staphylococcus epidermidis than Micrococcus luteus; ~61, ~73, and ~82% of M. luteus cells were inactivated on filters that had been coated for 3, 6, and 9 min, respectively, while the corresponding values were ~78, ~88, and ~94% with S. epidermidis. Although statistically significant differences in filtration performance were not observed between samples as a function of deposition time, the average filtration efficacy was slightly higher for S. epidermidis aerosols (~97% than for M. luteus aerosols (~95%. High-performance liquid chromatography (HPLC and electrospray ionization-tandem mass spectrometry (ESI/MS analyses confirmed that the major chemical compounds in the E. japonica extract were 1(ß-O-galloyl pedunculagin, quercetin-3-O-glucuronide, and kaempferol-3-O-glucoside. In vitro cytotoxicity and disk diffusion tests showed that E. japonica nanoparticles were less toxic and exhibited stronger antimicrobial activity toward some bacterial strains than a reference soluble nickel compound, which is classified as a human carcinogen. This study provides valuable information for the development of a
Laminaria japonica Extract, an Inhibitor of Clavibater michiganense Subsp. Sepedonicum.
Directory of Open Access Journals (Sweden)
Jin Cai
Full Text Available Bacterial ring rot of potato is one of the most serious potato plant and tuber diseases. Laminaria japonica extract was investigated for its antimicrobial activity against Clavibater michiganense subsp. sepedonicum (Spieckermann & Kotthoff Davis et al., the causative agent of bacterial ring rot of potato. The results showed that the optimum extraction conditions of antimicrobial substances from L. japonica were an extraction temperature of 80°C, an extraction time of 12 h, and a solid to liquid ratio of 1∶25. Active compounds of L. japonica were isolated by solvent partition, thin layer chromatography (TLC and column chromatography. All nineteen fractionations had antimicrobial activities against C. michiganense subsp. sepedonicum, while Fractionation three (Fr.3 had the highest (P<0.05 antimicrobial activity. Chemical composition analysis identified a total of 26 components in Fr.3. The main constituents of Fr.3 were alkanes (80.97%, esters (5.24%, acids (4.87% and alcohols (2.21%. Antimicrobial activity of Fr.3 against C. michiganense subsp. sepedonicum could be attributed to its ability to damage the cell wall and cell membrane, induce the production of reactive oxygen species (ROS, increase cytosolic Ca2+ concentration, inhibit the glycolytic pathway (EMP and tricarboxylic acid (TCA cycle, inhibit protein and nucleic acid synthesis, and disrupt the normal cycle of DNA replication. These findings indicate that L. japonica extracts have potential for inhibiting C. michiganense subsp. sepedonicum.
Park, Hun; Song, Uhram
2017-10-03
Although Azolla species are among the most promising plants for use in phytoremediation, more studies on their growth and nitrogen (N) uptake along the N gradients of growing media are required. In this study, N concentration-dependent growth in growing media and phosphorus (P) and N accumulation by Azolla japonica were studied by estimating direct N uptake from media by molybdenum-iron proteins. The doubling time of A. japonica was less than a week, regardless of the N concentration (0, 5, and 25 mg N/L) present in the growth media, indicating that this plant is suitable for remediation. Plants showed a high uptake of P, probably via plant-bacteria symbiosis, indicating their potential for effective P remediation. A. japonica also showed more than 4% N content regardless of the treatment and accumulated more than 40 mg of N per microcosm in 3 weeks. iron and molybdenum levels in plants were strongly associated with N fixation, and N uptake from media was estimated to be more than 25 mg per microcosm in 3 weeks, indicating that A. japonica has N remediation potential. As A. japonica is a rapidly growing plant, capable of efficient P and N remediation, it has great potential for use in phytoremediation of nutrient-enriched waters such as agricultural or urban wastewater and eutrophicated aquatic ecosystems.
50 CFR 226.215 - Critical habitat for the North Pacific Right Whale (Eubalaena japonica).
2010-10-01
... Right Whale (Eubalaena japonica). 226.215 Section 226.215 Wildlife and Fisheries NATIONAL MARINE... DESIGNATED CRITICAL HABITAT § 226.215 Critical habitat for the North Pacific Right Whale (Eubalaena japonica). (a) Primary Constituent Elements. The primary constituent elements of the North Pacific right whale...
Directory of Open Access Journals (Sweden)
Cholak I.S.
2013-10-01
Full Text Available This work represents the results of the research ofessential oil contained in Sophora japonica L. flowerbuds volatile compounds collected during the nextstages of their development: green flower buds, formedflower buds and the beginning of flower buds opening.Essential oil assay content in Sophora japonica L.flower buds was determined with hydrodistillationmethod. Content of essential oil in the raw material isless than 0,1%. Qualitative composition and assaycontent of Sophora japonica L. flower buds essential oilconstituents were determined with chromato-massspectrometry method. In consequence of the research 80constituents were identified in Sophora japonica L.flower buds out of which 61 substances are during thegreen flower buds and beginning of flower budsopening stages, 66 substances are during formed flowerbuds stage. Substances are represented by aliphatic andcyclic terpenoids, their alcohols and ketones. Mostvolatile substances were extracted on the stage offormed buds.
Behaviors of 14C-butachlor, 14C-chlorpyrifos and 14C-DDT in Rana japonica japonica Guenther
International Nuclear Information System (INIS)
Zhang Yiqiang; Zhong Chuangguang; Zhao Xiaokui; Chen Shunhua
2002-01-01
The research on the behaviors of 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT in the frog Rana japonica japonica Guenther was carried out. After administrated per os to the frogs in doses of 380, 347, 363 Bq/g, 14 C-butachlor, 14 C-chlorpyrifos and 14 C-DDT, were distributed respectively to various organs within 24 h with specific accumulating organs as gallbladder, intestine and intestine, relevantly to the pesticides described. Compared to that in gallbladder and intestine, the radioactivity of many organs was extremely low, and this might due to the characters of the pesticides. Analysis of the metabolites of 14 C-DDT in frog at 24 th hr demonstrated that DDT was difficult to be degraded. Most 14 C-butachlor, 14 C-chlorpyrifos 14 C-DDT in liver and fat or ovary of frog was extractable with acetone. However, there were some differences between the pesticides, and the organs as well. And 14 C-butachlor, 14 C-chlorpyrifos or 14 C-DDT were better bound in liver than in fat
Japonica rice variety Yangfujing 7 bred by mutation
International Nuclear Information System (INIS)
He Zhentian; Chen Xiulan; Han Yuepeng; Wang Jinrong; Yang Hefeng; Wang Jianhua
2006-01-01
A japonica variety, Yangfujing 7, which possessing high yield potential, good quality and disease resistance was developed through cross breeding combined mutation breeding. The variety met the needs of agricultural environment in Jiangsu province. (authors)
Wang, He-Tong; Jin, Feng; Jiang, Yi-Jun; Lin, Qing-Shan; Xu, Hai; Chen, Wen-Fu; Xu, Zheng-Jin
2013-11-01
Indica-japonica hybridization is one of the most important breeding methods in China, whereas identifying subspecies differentiation mechanisms is the key in indica-japonica hybridization breeding. By using InDels (Insert/Deletion) and ILPs (Intron Length Polymorphism), an analysis was made on the F6 populations derived from the hybridization of indica-japonica (Qishanzhan/Akihikari) planted in Liaoning and Guangdong provinces and generated by bulk harvesting (BM), single-seed descent methods (SSD), and pedigree method (PM). No segregation distortion was observed for the BM and SSD populations. The frequency distribution of japonica kinship percentage (Dj) was concentrated in 40%-60%. The PM populations in the two provinces presented indica-deviated distribution (30%-55%), with significant difference between Guangdong (38%) and Liaoning (42%). In addition, there was a significant positive correlation between the Dj and the kinship of functional gene regions in the BM and SSD populations. However, part of the positive correlation was broken in the PM populations that showed a regular distribution in the genotype patterns of indica and japonica loci. The above results demonstrated that artificial selection could be the main factor affecting the population differentiation in indica-japonica hybridization, and, with the synergistic effect of natural selection, induced the phenomenon of segregation distortion. There existed a close relationship between the differentiation of subspecies and the important agronomic traits, which could be the main reason why indica-japonica hybridiation breeding could not achieve the expected effect of combining the two subspecies advantages.
Eom, Hee Jeong; Kang, Hee Rae; Kim, Ho Kyong; Jung, Eun Bee; Park, Hyun Bong; Kang, Ki Sung; Kim, Ki Hyun
2016-06-01
The bark of Betula platyphylla var. japonica (Betulaceae) has been used to treat pneumonia, choloplania, nephritis, and chronic bronchitis. This study aimed to investigate the bioactive chemical constituents of the bark of B. platyphylla var. japonica. A bioassay-guided fractionation and chemical investigation of the bark of B. platyphylla var. japonica resulted in the isolation and identification of a new lupane-type triterpene, 27-hydroxybetunolic acid (1), along with 18 known triterpenoids (2-19). The structure of the new compound (1) was elucidated on the basis of 1D and 2D NMR spectroscopic data analysis as well as HR-ESIMS. Among the known compounds, chilianthin B (17), chilianthin C (18), and chilianthin A (19) were triterpene-lignan esters, which are rarely found in nature. Compounds 4, 6, 7, 17, 18, and 19 showed significant antioxidant activities with IC50 values in the range 4.48-43.02μM in a DPPH radical-scavenging assay. However, no compound showed significant inhibition of acetylcholine esterase (AChE). Unfortunately, the new compound (1) exhibited no significance in both biological activities. This study strongly suggests that B. platyphylla var. japonica bark is a potential source of natural antioxidants for use in pharmaceuticals and functional foods. Copyright © 2016 Elsevier Inc. All rights reserved.
Ishikawa, Naoko; Ikeda, Hajime; Yi, Ting-shuang; Takabe-Ito, Eriko; Okada, Hiroshi; Tsukaya, Hirokazu
2014-06-01
The Cayratia japonica-Cayratia tenuifolia species complex (Vitaceae) is distributed from temperate to tropical East Asia, Southeast Asia, India, and Australia. The spatiotemporal diversification history of this complex was assessed through phylogenetic and biogeographic analyses. Maximum parsimony, neighbor-joining, and maximum likelihood methods were used to analyze sequences of one nuclear (AS1) and two plastid regions (trnL-F and trnC-petN). Bayesian dating analysis was conducted to estimate the divergence times of clades. The likelihood method LAGRANGE was used to infer ancestral areas. The Asian C. japonica and C. tenuifolia should be treated as an unresolved complex, and Australian C. japonica is distinct from the Asian C. japonica-C. tenuifolia species complex and should be treated as separate taxa. The Asian C. japonica-C. tenuifolia species complex was estimated to have diverged from its closest relatives during the Late Eocene (35.1 million years ago [Ma], 95% highest posterior densities [HPD]=23.3-47.3Ma) and most likely first diverged in mid-continental Asia. This complex was first divided into a northern clade and a southern clade during the middle Oligocene (27.3Ma; 95% HPD=17.4-38.1Ma), which is consistent with a large southeastward extrusion of the Indochina region relative to South China along the Red River. Each of the northern and southern clades then further diverged into multiple subclades through a series of dispersal and divergence events following significant geological and climatic changes in East and Southeast Asia during the Miocene. Multiple inter-lineage hybridizations among four lineages were inferred to have occurred following this diversification process, which caused some Asian lineages to be morphologically cryptic. Copyright © 2014 Elsevier Inc. All rights reserved.
Flavonoids and fatty acids of Camellia japonica leaves extract
Directory of Open Access Journals (Sweden)
Cinthia M. Azuma
2011-07-01
Full Text Available The ethanol extract from the leaves of Camellia japonica L., Theaceae, showed antiradical potential in the DPPH test using TLC plates (SiO2. Aiming the isolation of active compounds, this extract was partitioned between BuOH:H2O (1:1 and the two obtained phases were also evaluated to detection of antiradical activity. The active BuOH phase was fractionated in Sephadex LH-20 and silica (normal or reverse phase to afford three aglycone flavonoids (quercetin, kaempferol and apigenin, which have been described in the C. japonica at first time, two glycosilated flavonoids (rutin and quercetrin, and a mixture of saturated fatty acids. The structures of isolated compounds were defined by NMR and GC/MS analyses.
Flavonoids and fatty acids of Camellia japonica leaves extract
Directory of Open Access Journals (Sweden)
Cinthia M. Azuma
2011-12-01
Full Text Available The ethanol extract from the leaves of Camellia japonica L., Theaceae, showed antiradical potential in the DPPH test using TLC plates (SiO2. Aiming the isolation of active compounds, this extract was partitioned between BuOH:H2O (1:1 and the two obtained phases were also evaluated to detection of antiradical activity. The active BuOH phase was fractionated in Sephadex LH-20 and silica (normal or reverse phase to afford three aglycone flavonoids (quercetin, kaempferol and apigenin, which have been described in the C. japonica at first time, two glycosilated flavonoids (rutin and quercetrin, and a mixture of saturated fatty acids. The structures of isolated compounds were defined by NMR and GC/MS analyses.
Studies on chemical constituents of Polygala japonica Houtt.
Institute of Scientific and Technical Information of China (English)
LI Ting-zhao; ZHANG Wei-dong; LIU Run-hui; CHEN Hai-sheng; ZHANG Chuan; SU Juan; XU Xi-ke
2006-01-01
Objective:To investigate the chemical constituents of Polygala japonica Houtt.. Methods:The constituents were separated and purified by column chromatographies with silical gel, RP-silical gel and Sephadex LH-20. Their structures were elucidated on the basis of spectral data (IR, MS, 1H-NMR, 13C-NMR, HMQC and HMBC). Results: Totally 15 compounds were obtained from Polygala japonica Houtt. And their structures were identified as castaprenol-12 (Ⅰ), β-sitosterol (Ⅱ), stigmasterol (Ⅲ),stigmasta-7,22-di-ene-3-one (Ⅳ), n-dotriacontanol ( Ⅴ ), n-hexadecanol ( Ⅵ ), arachidic acid (Ⅶ), erogosterol (Ⅷ), kaempferol (Ⅸ), quercetin (Ⅹ), daucosterol (Ⅺ), p-hydroxybenzoic acid (Ⅻ),coumaric acid (ⅩⅢ), rhamnocitrin 3-O-β-D-galactopyranoside (ⅪⅤ), quercetin 3-O-β-D-glucopyranoside (ⅩⅤ). Conclusion: Compounds Ⅰ , Ⅲ , Ⅳ, Ⅴ , Ⅵ, Ⅶ, Ⅷ, Ⅻ , ⅩⅢ and ⅩⅣ were obtained from this plant for the first time.
Park, Pyo-Jam; Kim, Eun-Kyung; Lee, Seung-Jae; Park, Sun-Young; Kang, Dong-Soo; Jung, Bok-Mi; Kim, Kui-Shik; Je, Jae-Young; Ahn, Chang-Bum
2009-02-01
Enzymatic hydrolysates of Laminaria japonica were evaluated for antioxidative activities using hydroxyl radical scavenging activity and protective effects against H(2)O(2)-induced DNA and cell damage. In addition, activities of antioxidative enzymes, including catalase, glutathione peroxidase, and glutathione S-transferase, of the enzymatic hydrolysates from L. japonica were also estimated. L. japonica was first enzymatically hydrolyzed by seven carbohydrases (Dextrozyme, AMG, Promozyme, Maltogenase, Termamyl, Viscozyme, and Celluclast [all from Novo Co., Novozyme Nordisk, Bagsvaerd, Denmark]) and five proteinases (Flavourzyme, Neutrase, Protamex, Alcalase [all from Novo Co.], and pancreatic trypsin). The hydroxyl radical scavenging activities of Promozyme and pancreatic trypsin hydrolysates from L. japonica were the highest as compared to those of the other carbohydrases and proteinases, and their 50% inhibitory concentration values were 1.67 and 317.49 mug/mL, respectively. The pancreatic trypsin hydrolysates of L. japonica exerted a protective effect on H(2)O(2)-induced DNA damage. We also evaluated the protective effect on hydroxyl radical-induced oxidative damage in PC12 cells via propidium iodide staining using a flow cytometer. The AMG and pancreatic trypsin hydrolysates of L. japonica dose-dependently protected PC12 cells against cell death caused by hydroxyl radical-induced oxidative damage. Additionally, we analyzed the activity of antioxidative enzymes such as catalase, glutathione peroxidase, and the phase II biotransformation enzyme glutathione S-transferase in L. japonica-treated cells. The activity of all antioxidative enzymes was higher in L. japonica-treated cells compared with the nontreated cells. These results indicate that enzymatic hydrolysates of L. japonica possess antioxidative activity.
Anti-inflammatory and antioxidant properties of Eriobotrya japonica ...
African Journals Online (AJOL)
Abstract. Background: In the present work we determined phenolic and flavonoids content of Eriobotrya japonica leaves extracts and fractions and their antioxidant and anti-inflammatory properties. Objectives: To evaluate the inhibition of inflammatory PLA2 and antioxidant effects of extracts and fractions from Erio-.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Dioscorea japonica 名詞 一般 * * * * ...ヤマノイモ ヤマノイモ ヤマノイモ Thesaurus2015 200906042151087664 C LS06/LS63/LS72 UNKNOWN_2 Dioscorea japonica
Antiatherogenic Effect of Camellia japonica Fruit Extract in High Fat Diet-Fed Rats
Lee, Hyun-Ho; Paudel, Keshav Raj; Jeong, Jieun; Wi, An-Jin; Park, Whoa-Shig; Kim, Dong-Wook; Oak, Min-Ho
2016-01-01
Hypercholesterolemia is a well-known etiological factor for cardiovascular disease and a common symptom of most types of metabolic disorders. Camellia japonica is a traditional garden plant, and its flower and seed have been used as a base oil of traditional cosmetics in East Asia. The present study was carried out to evaluate the effect of C. japonica fruit extracts (CJF) in a high fat diet- (HFD-) induced hypercholesterolemic rat model. CJF was administered orally at three different doses: ...
International Nuclear Information System (INIS)
Balestrino, F.; Mathis, A.; Veronesi, E.; Lang, S.
2017-01-01
Hulecoeteomyia japonica japonica (=Aedes japonicus japonicus) (Diptera: Culicidae) (Theobald 1901), a container breeding invasive species in North America and Europe, is attracting particular attention for its high local abundances and possible roles in the transmission of human and animal pathogens. The preferential habitats of this species are forested and bushy areas, which renders control measures extremely inefficient. Use of the sterile insect technique (SIT) may contribute to the implementation of area-wide integrated pest management strategies, as has been successfully proven with other aedine mosquito species. The present study investigates the effects of irradiation at a dose of 40 Gy on fitness parameters in H. j. japonica. Irradiation was performed on 16–24- h-old pupae from a colonized strain (PA) using a True- Beam linear accelerator. Males from the PA strain were crossed with females of the same colony or with field-collected females. Irradiation induced a slight increase in mortality in male pupae, but did not alter the survival and mating abilities of emerging adult males. Rates of blood feeding and fertility were lower when PA strain males were kept with field-collected females rather than PA females. Irradiated males induced reductions in fertility (residual fertility: 2.6%) and fecundity in mated females. The data indicate that the SIT is a suitable technique to enhance the control of this species. (author)
International Nuclear Information System (INIS)
Lin, Haiying; Sun, Tao; Zhou, Yi; Zhang, Xiaomei
2016-01-01
To investigate the potential influences of anthropogenic pollutants, we evaluated the responses of the intertidal seagrass Zostera japonica to three heavy metals: copper (Cu), lead (Pb), and cadmium (Cd). Z. japonica was exposed to various concentrations of Cu, Pb , and Cd (0, 0.5, 5, 50 μM) over seven days. The effects were then analyzed using the antioxidant enzyme catalase (CAT), superoxide dismutase (SOD), peroxidase (POD), glutathione peroxidase (GPX), and lipid peroxidation measured using malondialdehyde (MDA) as proxy. Metal accumulation in the above-ground tissues and phenotypic changes were also investigated. Our results revealed that heavy metal concentration increased in seagrass exposed to high levels of metals. Z. japonica has great potential for metal accumulation and a suitable candidate for the decontamination of moderately Cu contaminated bodies of water and can also potentially enhanced efforts of environmental decontamination, either through phytoextraction abilities or by functioning as an indicator for monitoring programs that use SOD, CAT, GPX, POD and MDA as biomarkers. - Highlights: • Anti-oxidative feedback of Zostera japonica to the heavy metals Cu, Pb, and Cd was determined. • The endangered intertidal seagrass Z. japonica had a high metal accumulation potential. • Z. japonica might be a potential indicator in monitoring programs using SOD, CAT, GPX, POD and MDA as biomarkers.
Characterization and analysis of a de novo transcriptome from the pygmy grasshopper Tetrix japonica.
Qiu, Zhongying; Liu, Fei; Lu, Huimeng; Huang, Yuan
2017-05-01
The pygmy grasshopper Tetrix japonica is a common insect distributed throughout the world, and it has the potential for use in studies of body colour polymorphism, genomics and the biology of Tetrigoidea (Insecta: Orthoptera). However, limited biological information is available for this insect. Here, we conducted a de novo transcriptome study of adult and larval T. japonica to provide a better understanding of its gene expression and develop genomic resources for future work. We sequenced and explored the characteristics of the de novo transcriptome of T. japonica using Illumina HiSeq 2000 platform. A total of 107 608 206 paired-end clean reads were assembled into 61 141 unigenes using the trinity software; the mean unigene size was 771 bp, and the N50 length was 1238 bp. A total of 29 225 unigenes were functionally annotated to the NCBI nonredundant protein sequences (Nr), NCBI nonredundant nucleotide sequences (Nt), a manually annotated and reviewed protein sequence database (Swiss-Prot), Gene Ontology (GO) and Kyoto Encyclopedia of Genes and Genomes (KEGG) databases. A large number of putative genes that are potentially involved in pigment pathways, juvenile hormone (JH) metabolism and signalling pathways were identified in the T. japonica transcriptome. Additionally, 165 769 and 156 796 putative single nucleotide polymorphisms occurred in the adult and larvae transcriptomes, respectively, and a total of 3162 simple sequence repeats were detected in this assembly. This comprehensive transcriptomic data for T. japonica will provide a usable resource for gene predictions, signalling pathway investigations and molecular marker development for this species and other pygmy grasshoppers. © 2016 John Wiley & Sons Ltd.
Tsukayama, Izumi; Toda, Keisuke; Takeda, Yasunori; Mega, Takuto; Tanaka, Mitsuki; Kawakami, Yuki; Takahashi, Yoshitaka; Kimoto, Masumi; Yamamoto, Kei; Miki, Yoshimi; Murakami, Makoto; Suzuki-Yamamoto, Toshiko
2018-03-01
Hyperproduced prostaglandin E 2 by cyclooxygenase-2 and microsomal prostaglandin E synthase-1 evokes several pathophysiological responses such as inflammation and carcinogenesis. Our recent study demonstrated that Dioscorea japonica extract suppressed the expression of cyclooxygenase-2 and microsomal prostaglandin E synthase-1 and induced apoptosis in lung carcinoma A549 cells. In the present study, we investigated the effects of Dioscorea japonica on squamous cell carcinoma of mouse skin. Dioscorea japonica feeding and Dioscorea japonica extract topical application suppressed the expression of cyclooxygenase-2, microsomal prostaglandin E synthase-1, interleukin-1β and interleukin-6 and inhibited tumor formation, hyperplasia and inflammatory cell infiltration. Immunohistochemical analyses showed the immunoreactivities of cyclooxygenase-2 and microsomal prostaglandin E synthase-1 in tumor keratinocytes and stronger immunoreactivities of cyclooxygenase-2 and hematopoietic prostaglandin D synthase in epidermal dendritic cells (Langerhans cells). Treatment with Dioscorea japonica decreased the immunoreactivity of cyclooxygenase-2 and microsomal prostaglandin E synthase-1. These results indicate that Dioscorea japonica may have inhibitory effects on inflammation and carcinogenesis via suppression of the prostaglandin E 2 synthetic pathway.
Absorption and translocation of 15N in Japonica (Hinohikari) and Indica (Hadsaduri) rice varieties
International Nuclear Information System (INIS)
Islam, N.; Inagaki, S.; Chishaki, N.; Horiguchi, T.
1997-01-01
The absorption and translocation of 15 N-labeled nitrogen (N) applied as three N levels of ammonium nitrate at the stages of panicle initiation (PI) and heading (HD) were compared between a japonica rice variety (var. Hinohikari) and a tall indica rice variety (var. Hadsaduri) by growing them hydroponically. With the supply of low N level, 15 N absorption by the japonica variety was larger, but at medium and high N levels, the tall indica variety absorbed larger amounts of 15 N at both stages. However, the amount of 15 N partitioned to the panicles at maturity was considerably smaller in the indica variety, since dry matter allocation to the panicles was also smaller in this variety. The tall indica variety showed a considerable loss of 15 N from heading to maturity at the high N-level unlike the japonica variety. (author)
Catalytic pyrolysis of Laminaria japonica over nanoporous catalysts using Py-GC/MS
Directory of Open Access Journals (Sweden)
Jeon Jong-Ki
2011-01-01
Full Text Available Abstract The catalytic pyrolysis of Laminaria japonica was carried out over a hierarchical meso-MFI zeolite (Meso-MFI and nanoporous Al-MCM-48 using pyrolysis gas chromatography/mass spectrometry (Py-GC/MS. The effect of the catalyst type on the product distribution and chemical composition of the bio-oil was examined using Py-GC/MS. The Meso-MFI exhibited a higher activity in deoxygenation and aromatization during the catalytic pyrolysis of L. japonica. Meanwhile, the catalytic activity of Al-MCM-48 was lower than that of Meso-MFI due to its weak acidity.
Directory of Open Access Journals (Sweden)
Yonghui Li
2017-03-01
Full Text Available Propylea japonica (Thunberg (Coleoptera: Coccinellidae are prevalent predators and pollen feeders in East Asian maize fields. They are therefore indirectly (via prey and directly (via pollen exposed to Cry proteins within Bt-transgenic maize fields. The effects of Cry1Ie-producing transgenic maize pollen on the fitness of P. japonica was assessed using two dietary-exposure experiments in the laboratory. In the first experiment, survival, larval developmental time, adult fresh weight, and fecundity did not differ between ladybirds consuming Bt or non-Bt maize pollen. In the second experiment, none of the tested lethal and sublethal parameters of P. japonica were negatively affected when fed a rapeseed pollen-based diet containing Cry1Ie protein at 200 μg/g dry weight of diet. In contrast, the larval developmental time, adult fresh weight, and fecundity of P. japonica were significantly adversely affected when fed diet containing the positive control compound E-64. In both experiments, the bioactivity of the Cry1Ie protein in the food sources was confirmed by bioassays with a Cry1Ie-sensitive lepidopteran species. These results indicated that P. japonica are not affected by the consumption of Cry1Ie-expressing maize pollen and are not sensitive to the Cry1Ie protein, suggesting that the growing of Bt maize expressing Cry1Ie protein will pose a negligible risk to P. japonica.
Directory of Open Access Journals (Sweden)
Abdullah Muhamad Firdaurs
2017-01-01
Full Text Available The rise of awareness on environmentalism has demanded that all parties involved in built environment to implement green technology in their construction projects. Great care must be taken when designing a green roof system including the selection of plants and appropriate substrates. This study was performed to investigate the soil-root composite strength of two types of green roof vegetation (A. Ficoidea and Z. Japonica at different growth periods for up to 6 months. Both plants were planted in six plastic plots (45 cm × 29 cm × 13 cm containing a mixture of perlite, vermiculite and organic soil. Every two months, a series of direct shear tests were conducted on a sample from each species to determine the root-soil shear strength. The tests continued until the 6th month. The average results showed that Z. Japonica had higher soil-root shear strength (49.1 kPa compared to A. Ficoidea after two months of growth. In the 4th month however, A. Ficoidea managed to surpass Z. Japonica (28.7 kPa versus 18.5 kPa in terms of shear strength. However, their average peak shear strength decreased sharply compared to the previous month. Lastly, in six months, A. Ficoidea sustained a higher average peak soil shear strength (56.5 kPa compared to Z. Japonica (14.3 kPa. Therefore, it can be concluded that A. Ficoidea may offer a better soil reinforcement than Z. japonica and thus it could potentially be a good choice of green roof vegetation.
Effects of storage and gamma irradiation on (japonica) waxy rice
International Nuclear Information System (INIS)
Sung, W.-C.; Hong, Mei-Chu; Chang, T.-S.
2008-01-01
Japonica cultivar, Taichung waxy 70 (TCW 70), was exposed to gamma radiation with doses ranging from 0 to 2.0 kGy. The effects of gamma irradiation on waxy rice pasting properties and the qualities of its food product, mochi, were compared to the effects of storage over 12 months. Doses ranging from 0.5 to 2 kGy can decrease the paste viscosity of waxy rice as those obtained after 6 months of storage. Radiation treatments were less effective to decrease the hardness of mochi than waxy rice samples stored over 6 months. It was shown the effects of gamma irradiation on shortening the japonica waxy rice aging time and improving the quality of rice products, like mochi, were not as good as the effects of storage
Effects of storage and gamma irradiation on (japonica) waxy rice
Energy Technology Data Exchange (ETDEWEB)
Sung, W.-C. [Department of Hotel and Restaurant Management, Chia Nan University of Pharmacy and Science, 60 Erh-Jen Road, Sec. 1, Pao-An, Jen-Te Hsiang, Tainan 717, Taiwan (China)], E-mail: sungwilliam2001@yahoo.com.tw; Hong, Mei-Chu [TaiChung District Agricultural Research and Extension Station Council of Agriculture Executive Yuan, Taichung, Taiwan (China); Chang, T.-S. [Department of Biological Sciences and Technology, National University of Tainan, Tainan, Taiwan (China)
2008-01-15
Japonica cultivar, Taichung waxy 70 (TCW 70), was exposed to gamma radiation with doses ranging from 0 to 2.0 kGy. The effects of gamma irradiation on waxy rice pasting properties and the qualities of its food product, mochi, were compared to the effects of storage over 12 months. Doses ranging from 0.5 to 2 kGy can decrease the paste viscosity of waxy rice as those obtained after 6 months of storage. Radiation treatments were less effective to decrease the hardness of mochi than waxy rice samples stored over 6 months. It was shown the effects of gamma irradiation on shortening the japonica waxy rice aging time and improving the quality of rice products, like mochi, were not as good as the effects of storage.
Lifescience Database Archive (English)
Full Text Available MeCab user dictionary for science technology term Dioscorea japonica Thunb. 名詞 一般 *... * * * ヤマノイモ ヤマノイモ ヤマノイモ Thesaurus2015 200906042151087664 C LS06/LS63/LS72 UNKNOWN_2 Dioscorea japonica Thunb .
NCBI nr-aa BLAST: CBRC-GGOR-01-1282 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-GGOR-01-1282 ref|YP_003258172.1| d-galactonate transporter [Pectobacterium wasabia...e WPP163] gb|ACX86565.1| d-galactonate transporter [Pectobacterium wasabiae WPP163] YP_003258172.1 0.94 31% ...
Guo, Jie; Xu, Xiaomei; Li, Wentao; Zhu, Wenyin; Zhu, Haitao; Liu, Ziqiang; Luan, Xin; Dai, Ziju; Liu, Guifu; Zhang, Zemin; Zeng, Ruizhen; Tang, Guang; Fu, Xuelin; Wang, Shaokui; Zhang, Guiquan
2016-06-01
Rice (Oryza sativa L.) is an important staple crop. The exploitation of the great heterosis that exists in the inter-subspecific crosses between the indica and japonica rice has long been considered as a promising way to increase the yield potential. However, the male and female sterility frequently occurred in the inter-subspecific hybrids hampered the utilization of the heterosis. Here we report that the inter-subspecific hybrid sterility in rice is mainly affected by the genes at Sb, Sc, Sd and Se loci for F1 male sterility and the gene at S5 locus for F1 female sterility. The indica-compatible japonica lines (ICJLs) developed by pyramiding the indica allele (S-i) at Sb, Sc, Sd and Se loci and the neutral allele (S-n) at S5 locus in japonica genetic background through marker-assisted selection are compatible with indica rice in pollen fertility and in spikelet fertility. These results showed a great promise of overcoming the inter-subspecific hybrid sterility and exploiting the heterosis by developing ICJLs.
Cha, Jeong-Dan; Kim, Ji-Young
2012-01-01
Cryptomeria japonica D. Don (C. japonica) has been used in traditional medicines from Asia for a variety of indications, including liver ailments, and an antitussive, and for its antiulcer activities. We examined the cell viability and apoptosis of KB cells treated with C. japonica essential oil at several concentrations for 12 h by MTT assay, Hoechst-33258 dye staining, DNA fragmentation, flow cytometry (cell cycle), and Western blotting for mitochondria stress, activation of caspases, and p...
International Nuclear Information System (INIS)
Sun Fuhong; Zhou Qixing
2007-01-01
The accumulation of cadmium (Cd) and copper (Cu) in the polychaete Hediste japonica exposed to the mixture of Cd (or Cu) and petroleum hydrocarbons (PHCs) was investigated and compared with that exposed to single Cd (or Cu). The increased bioavailability of Cd or Cu with exposure concentrations resulted in an increase in the accumulation and net accumulation rate of Cd or Cu during single metal exposure. The net accumulation rate of Cd increased, but the net accumulation rate of Cu decreased with exposure time during single metal exposure, suggesting that H. japonica could actively regulate Cu burden in their body by inhibition of absolute uptake or promotion of excretion. The interactions between Cd (or Cu) and PHCs had complicated influences on the net accumulation rate of Cd and Cu in H. japonica under the condition of the binary mixture, which are dependent on their concentration combinations and exposure time. - The influences of petroleum hydrocarbons on Cd and Cu accumulation in H. japonica depend on their concentration combinations and exposure time
Park, Kiyun; Kwak, Ihn-Sil
2014-01-01
Heat shock protein 90 (HSP90) is a highly conserved molecular chaperone important in the maturation of a broad spectrum of protein. In this study, an HSP90 gene was isolated from Asian paddle crab, Charybdis japonica, as a bio-indicator to monitor the marine ecosystem. This work reports the responses of C. japonica HSP90 mRNA expression to cellular stress by endocrine disrupting chemicals (EDCs), such as bisphenol A (BPA) and 4-nonylphenol (NP) using real-time. reverse transcription polymerase chain reaction. The deduced amino acid sequence of HSP90 from C. japonica shared a high degree of homology with their homologues in other species. In a phylogenetic analysis, C. japonica HSP90 is evolutionally related with an ortholog of the other crustacean species. The expression of HSP90 gene was almost distributed in all the examined tissues of the C. japonica crab but expression levels varied among the different body parts of the crabs. We examined HSP90 mRNA expression pattern in C. japonica crabs exposed to EDCs for various exposure times. The expression of HSP90 transcripts was significantly increased in C. japonica crabs exposed to BPA and NP at different concentrations for 12, 24, 48 and 96 hours. The mRNA expression of HSP90 gene was significantly induced in a concentration- and time-dependent manner after BPA or NP exposures for 96 hours. Taken together, expression analysis of Asian paddle crab HSP90 gene provided useful molecular information about crab responses in stress conditions and potential ways to monitor the EDCs stressors in marine environments.
DNA variation in the phenotypically-diverse brown alga Saccharina japonica
Directory of Open Access Journals (Sweden)
Balakirev Evgeniy S
2012-07-01
Full Text Available Abstract Background Saccharina japonica (Areschoug Lane, Mayes, Druehl et Saunders is an economically important and highly morphologically variable brown alga inhabiting the northwest Pacific marine waters. On the basis of nuclear (ITS, plastid (rbcLS and mitochondrial (COI DNA sequence data, we have analyzed the genetic composition of typical Saccharina japonica (TYP and its two common morphological varieties, known as the “longipes” (LON and “shallow-water” (SHA forms seeking to clarify their taxonomical status and to evaluate the possibility of cryptic species within S. japonica. Results The data show that the TYP and LON forms are very similar genetically in spite of drastic differences in morphology, life history traits, and ecological preferences. Both, however, are genetically quite different from the SHA form. The two Saccharina lineages are distinguished by 109 fixed single nucleotide differences as well as by seven fixed length polymorphisms (based on a 4,286 bp concatenated dataset that includes three gene regions. The GenBank database reveals a close affinity of the TYP and LON forms to S. japonica and the SHA form to S. cichorioides. The three gene markers used in the present work have different sensitivity for the algal species identification. COI gene was the most discriminant gene marker. However, we have detected instances of interspecific COI recombination reflecting putative historical hybridization events between distantly related algal lineages. The recombinant sequences show highly contrasted level of divergence in the 5’- and 3’- regions of the gene, leading to significantly different tree topologies depending on the gene segment (5’- or 3’- used for tree reconstruction. Consequently, the 5’-COI “barcoding” region (~ 650 bp can be misleading for identification purposes, at least in the case of algal species that might have experienced historical hybridization events. Conclusion Taking into account
The naturalization of "loquat", Eriobotrya japonica (Rosaceae, Maloideae in Argentina
Directory of Open Access Journals (Sweden)
Gustavo Deluchi
2010-01-01
Full Text Available Based on herbarium specimens collected in our country, Eriobotrya japonica(Thunb. Lindl. (Rosaceae is mentioned for the first time as naturalized plant in Argentina. Ecological observations and information about various local uses are included. The species is described and illustrated.
Study on the isolation of active constituents in Lonicera japonica and ...
African Journals Online (AJOL)
Lonicera japonica has antibacterial and gall bladder-protective effects. Objective: To study the .... Dexamethasone acetate cream (999 Pi Yan. Ping), xylene, dry yeast ... 3 ml of yeast solution. (concentration of 20%) at dorsal skin, after inducing.
International Nuclear Information System (INIS)
Ta, T.C.; Ohira, Koji
1982-01-01
The uptake of 15 N-labeled ammonium and nitrate and their assimilation in 4-week-old Indica and Japonica rice plants were studied during 24 hr exposure to 2 mM solutions of ( 15 NH 4 ) 2 SO 4 and/or Na 15 NO 3 . Although there was no clear difference in the uptake and assimilation of 15 NH 4+ , significant differences in the uptake and assimilation of 15 NO 3- by both varieties were observed. When NH 4+ or NO 3- was supplied exclusively, the Indica rice plants absorbed the latter more effectively than the Japonica. In addition, despite a preference for uptake of NH 4+ rather than NO 3- as shown by both varieties when both forms were supplied together, the relative amounts of NO 3- uptake by the Indica were higher than those of Japonica. On the other hand, the Indica rice plants reduced the absorbed 15 NO 3- more rapidly than the Japonica. The incorporation 15 NO 3- into the ethanol insoluble nitrogen fraction of the Indica rice also exceeded that of the Japonica. These results suggest that the Indica has the ability to utilize NO 3- as a nitrogen source more effectively than the Japonica rice plants. (author)
DEFF Research Database (Denmark)
Stegmann, Evi; Albersmeier, Andreas; Spohn, Marius
2014-01-01
We report the complete genome sequence of Amycolatopsis japonica MG417-CF17T (=DSM 44213T) which was identified as the producer of (S,S)-N,N′-ethylenediaminedisuccinic acid during a screening for phospholipase C inhibitors. The genome of A. japonica MG417-CF17T consists of two replicons: the chro......We report the complete genome sequence of Amycolatopsis japonica MG417-CF17T (=DSM 44213T) which was identified as the producer of (S,S)-N,N′-ethylenediaminedisuccinic acid during a screening for phospholipase C inhibitors. The genome of A. japonica MG417-CF17T consists of two replicons...
On the Pacific coast of North America, at least two congeners of Zostera occur: native Zostera marina, and introduced, Z. japonica. Z. japonica is considered “invasive” and therefore, ecologically and economically harmful by some, while others consider it benign or perhaps benef...
Identification and characterisation of ROS modulator 1 in Lampetra japonica.
Zhao, Chunhui; Feng, Bin; Cao, Ying; Xie, Peng; Xu, Jie; Pang, Yue; Liu, Xin; Li, Qingwei
2013-08-01
Reactive oxygen species (ROS) are a heterogeneous group of highly reactive molecules that oxidise targets in biological systems. ROS are also considered important immune regulators. In this study, we identified a homologue of reactive oxygen species modulator 1 (Romo1) in the Japanese lamprey (Lampetra japonica). The L japonica Romo1 (Lj-Romo1) gene shares high sequence homology with the Romo1 genes of jawed vertebrates. Real-time quantitative PCR demonstrated the wide distribution of Lj-Romo1 in lamprey tissues. Furthermore, after the lampreys were stimulated with lipopolysaccharide (LPS), the level of Lj-Romo1 mRNA was markedly up-regulated in the liver, gill, kidney, and intestine tissues. Lj-Romo1 was localised to the mitochondria and has the capacity to increase the ROS level in cells. The results obtained in the present study will help us to understand the roles of Romo1 in ROS production and innate immune responses in jawless vertebrates. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Hideaki Taira
1998-01-01
Full Text Available Prediction of yearly atmospheric pollen counts is a very important component in the prevention of allergenic symptoms. We investigated the relationship between atomspheric pollen counts and the formation of male flowers of Cryptomeriajaponica D. Don (C. japonica. An atmospheric pollen survey of C. japonica was conducted from 1983 to 1996 using a Durham’s sampler. A regression analysis was performed between the total pollen count and July temperature in previous years. The atmospheric pollen counts of C. japonica had a high positive correlation with the mean temperature in July of the previous year. However, the predicted using average mean July temperature records of the previous year were insufficient, especially in years following high pollen count. In experimental conditions, using 60 C. japonica trees in pots, the formation of male flowers was shown to increase with a rise in incubation temperature. In a forest of C. japonica, our results showed that the length and weight of new needle growth from old needles, which produced many flowers in the previous year, were shorter and lighter, respectively. These aerobiological and plant physiological studies provide evidence that a smaller number of pollen counts are a common result in a year following one in which many male flowers are produced, even if the mean July temperature of that year was high.
Extremely Low Genomic Diversity of Rickettsia japonica Distributed in Japan.
Akter, Arzuba; Ooka, Tadasuke; Gotoh, Yasuhiro; Yamamoto, Seigo; Fujita, Hiromi; Terasoma, Fumio; Kida, Kouji; Taira, Masakatsu; Nakadouzono, Fumiko; Gokuden, Mutsuyo; Hirano, Manabu; Miyashiro, Mamoru; Inari, Kouichi; Shimazu, Yukie; Tabara, Kenji; Toyoda, Atsushi; Yoshimura, Dai; Itoh, Takehiko; Kitano, Tomokazu; Sato, Mitsuhiko P; Katsura, Keisuke; Mondal, Shakhinur Islam; Ogura, Yoshitoshi; Ando, Shuji; Hayashi, Tetsuya
2017-01-01
Rickettsiae are obligate intracellular bacteria that have small genomes as a result of reductive evolution. Many Rickettsia species of the spotted fever group (SFG) cause tick-borne diseases known as "spotted fevers". The life cycle of SFG rickettsiae is closely associated with that of the tick, which is generally thought to act as a bacterial vector and reservoir that maintains the bacterium through transstadial and transovarial transmission. Each SFG member is thought to have adapted to a specific tick species, thus restricting the bacterial distribution to a relatively limited geographic region. These unique features of SFG rickettsiae allow investigation of how the genomes of such biologically and ecologically specialized bacteria evolve after genome reduction and the types of population structures that are generated. Here, we performed a nationwide, high-resolution phylogenetic analysis of Rickettsia japonica, an etiological agent of Japanese spotted fever that is distributed in Japan and Korea. The comparison of complete or nearly complete sequences obtained from 31 R. japonica strains isolated from various sources in Japan over the past 30 years demonstrated an extremely low level of genomic diversity. In particular, only 34 single nucleotide polymorphisms were identified among the 27 strains of the major lineage containing all clinical isolates and tick isolates from the three tick species. Our data provide novel insights into the biology and genome evolution of R. japonica, including the possibilities of recent clonal expansion and a long generation time in nature due to the long dormant phase associated with tick life cycles. © The Author(s) 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.
Miyazawa, Mitsuo; Usami, Atsushi; Tanaka, Takio; Tsuji, Kaoru; Takehara, Manami; Hori, Yuki
2016-01-01
This study was conducted to determine the composition of essential oil from buds of male and female Eurya japonica flowers and to determine the aroma-active compounds of this plant by gas chromatography-mass spectrometry (GC-MS), sensory evaluation, and odor activity values (OAV). The oils contained eighty-five compounds. We identified for the first time forty-four compounds in E. japonica. Through sensory evaluation, nineteen aroma-active compounds were identified by gas chromatography-olfactometry (GC-O). Because the chemical composition can affect the interaction between plants and herbivorous insects, our results suggest that essential oils from male and female flower buds of E. japonica differently affect herbivores. Sexual differences in essential oils deserve further investigations in this plant-insect system.
Quantifying quality of life and disability of patients with advanced schistosomiasis japonica.
Directory of Open Access Journals (Sweden)
Tie-Wu Jia
Full Text Available BACKGROUND: The Chinese government lists advanced schistosomiasis as a leading healthcare priority due to its serious health and economic impacts, yet it has not been included in the estimates of schistosomiasis burden in the Global Burden of Disease (GBD study. Therefore, the quality of life and disability weight (DW for the advanced cases of schistosomiasis japonica have to be taken into account in the re-estimation of burden of disease due to schistosomiasis. METHODOLOGY/PRINCIPAL FINDINGS: A patient-based quality-of-life evaluation was performed for advanced schistosomiasis japonica. Suspected or officially registered advanced cases in a Schistosoma japonicum-hyperendemic county of the People's Republic of China (P.R. China were screened using a short questionnaire and physical examination. Disability and morbidity were assessed in confirmed cases, using the European quality of life questionnaire with an additional cognitive dimension (known as the "EQ-5D plus", ultrasonography, and laboratory testing. The age-specific DW of advanced schistosomiasis japonica was estimated based on patients' self-rated health scores on the visual analogue scale of the questionnaire. The relationships between health status, morbidity and DW were explored using multivariate regression models. Of 506 candidates, 215 cases were confirmed as advanced schistosomiasis japonica and evaluated. Most of the patients reported impairments in at least one health dimension, such as pain or discomfort (90.7%, usual activities (87.9%, and anxiety or depression (80.9%. The overall DW was 0.447, and age-specific DWs ranged from 0.378 among individuals aged 30-44 years to 0.510 among the elderly aged ≥ 60 years. DWs are positively associated with loss of work capacity, psychological abnormality, ascites, and active hepatitis B virus, while splenectomy and high albumin were protective factors for quality of life. CONCLUSIONS/SIGNIFICANCE: These patient-preference disability
Gonadal differentiation in frogs, Rana japonica and R. brevipoda, raised from UV irradiated eggs
International Nuclear Information System (INIS)
Shirane, T.
1982-01-01
The gonadal differentiation of anurans, Rana japonica and R. brevipoda, was examined in animals raised from eggs which had been irradiated at the vegetal hemisphere with UV (9300 erg/mm2) at the 2-cell stage. In R. japonica about 70% of the larvae at stage I from the pressed and UV-irradiated eggs were germ cell free, but at a stage immediately after metamorphosis all animals had at least some germ cells, although their gonads often were extremely small and poorly differentiated. When male animals matured sexually, many of them had abnormal gonads. However, all of them were shown by artificial means to be capable of fertilization. In the nonpressed and irradiated group, no larvae were germ cell free and the animals immediately after metamorphosis showed nearly normal gonadal differentiation except for the presence of a few degenerate oocytes in the ovaries. The results in R. brevipoda were basically similar to those in R. japonica. In both species, sex ratios were determined at two stages, the first immediately after metamorphosis and the other when the animals matured, as based on gonad morphology and histology and on external sexually dimorphic characters as well. Sex ratios at these two stages in frogs from the pressed and irradiated eggs differed markedly in R. brevipoda. The ratio was normal at metamorphosis but high M/F ratios occurred when animals became mature. That sex reversal took place in this species as well as in R. japonica (in which sex-ratio deviation was not statistically significant) was supported by the sex ratios of the progenies of these supernumerary males
On the Pacific coast of North America, at least two congeners of Zostera occur: native Z. marina, and introduced, Z. japonica. Z. marina is protected by State and Federal laws as essential fish habitat. Z. japonica is considered “invasive” and therefore, ecologicall...
Gao, Xue-Ke; Zhang, Shuai; Luo, Jun-Yu; Wang, Chun-Yi; Lü, Li-Min; Zhang, Li-Juan; Zhu, Xiang-Zhen; Wang, Li; Lu, Hui; Cui, Jin-Jie
2017-12-30
Lysiphlebia japonica (Ashmead) is a predominant parasitoid of cotton-melon aphids in the fields of northern China with a proven ability to effectively control cotton aphid populations in early summer. For accurate normalization of gene expression in L. japonica using quantitative reverse transcriptase-polymerase chain reaction (RT-qPCR), reference genes with stable gene expression patterns are essential. However, no appropriate reference genes is L. japonica have been investigated to date. In the present study, 12 selected housekeeping genes from L. japonica were cloned. We evaluated the stability of these genes under various experimental treatments by RT-qPCR using four independent (geNorm, NormFinder, BestKeeper and Delta Ct) and one comparative (RefFinder) algorithm. We identified genes showing the most stable levels of expression: DIMT, 18S rRNA, and RPL13 during different stages; AK, RPL13, and TBP among sexes; EF1A, PPI, and RPL27 in different tissues, and EF1A, RPL13, and PPI in adults fed on different diets. Moreover, the expression profile of a target gene (odorant receptor 1, OR1) studied during the developmental stages confirms the reliability of the chosen selected reference genes. This study provides for the first time a comprehensive list of suitable reference genes for gene expression studies in L. japonica and will benefit subsequent genomics and functional genomics research on this natural enemy. Copyright © 2017. Published by Elsevier B.V.
Lin, Yongwen; Lin, Sheng; Akutse, Komivi S; Hussain, Mubasher; Wang, Liande
2016-01-01
Transmission of plant pathogens through insect vectors is a complex biological process involving interactions between the host plants, insects, and pathogens. Simultaneous impact of the insect damage and pathogenic bacteria in infected host plants induce volatiles that modify not only the behavior of its insect vector but also of their natural enemies, such as parasitoid wasps. Therefore, it is essential to understand how insects such as the predator ladybird beetle responds to volatiles emitted from a host plant and how the disease transmission alters the interactions between predators, vector, pathogens, and plants. In this study, we investigated the response of Propylaea japonica to volatiles from citrus plants damaged by Diaphorina citri and Candidatus Liberibacter asiaticus through olfactometer bioassays. Synthetic chemical blends were also used to determine the active compounds in the plant volatile. The results showed that volatiles emitted by healthy plants attracted more P. japonica than other treatments, due to the presence of high quantities of D-limonene and beta-ocimene, and the lack of methyl salicylate. When using synthetic chemicals in the olfactory tests, we found that D-limonene attracted P. japonica while methyl salicylate repelled the predator. However, beta-ocimene attracted the insects at lower concentrations but repelled them at higher concentrations. These results indicate that P. japonica could not efficiently search for its host by using volatile cues emitted from psyllids- and Las bacteria-infected citrus plants.
Directory of Open Access Journals (Sweden)
Ji-Young Kim
2012-03-01
Full Text Available Cryptomeria japonica D. Don (C. japonica has been used in traditional medicines from Asia for a variety of indications, including liver ailments, and an antitussive, and for its antiulcer activities. We examined the cell viability and apoptosis of KB cells treated with C. japonica essential oil at several concentrations for 12 h by MTT assay, Hoechst-33258 dye staining, DNA fragmentation, flow cytometry (cell cycle, and Western blotting for mitochondria stress, activation of caspases, and poly (ADP-ribose polymerase. The essential oil induced the apoptosis of KB cells in a dose-dependent manner, which was verified by DNA fragmentation, appearance of apoptotic bodies, and the sub-G1 ratio. The essential oil also induced rapid and transient caspase-3 activity and cleavage of PARP of the KB cells. Treating the cells with the oil also caused changes in the mitochondrial level of the Bcl-2 family proteins such as Bcl-2 and Bax, thereby inducing the release of cytochrome c into the cytosol. The essential oil of C. japonica may have potential as a cancer chemopreventive and therapeutic agent.
An annotated review of the Salamander types described in the Fauna Japonica
Hoogmoed, M.S.
1978-01-01
The whereabouts of the salamander types described by Temminck & Schlegel in the Fauna Japonica (1838) are discussed and lectotypes are selected from the syntypes for the following nominal species : Salamandra naevia Temminck & Schlegel, S. unguiculata Temminck & Schlegel, S. subcristata Temminck &
When non-native plant species invade a system they often change patterns of primary production. I evaluate the contribution of the seagrass Zostera marina and it's non-native congener Z. japonica to primary production in Yaquina Bay. Few measurements of Z. japonica production e...
Expansion of the invasive dwarf eelgrass, Zostera japonica, in Yaquina Bay, Oregon
The areal coverage of the non-indigenous dwarf eelgrass, Zostera japonica, is increasing in several estuaries on the US West Coast. As a result, regulatory agencies in the states of California and Washington are considering methods of controlling its expansion. Factors relevan...
Dwarf eelgrass, Zostera japonica: a malevolent, benevolent, or benign invasive ecosystem engineer?
Dwarf eelgrass, Zostera japonica, is an introduced ecosystem engineering species first reported on the US west coast in 1957. In some US Pacific Northwest estuaries its areal coverage now exceeds that of the native eelgrass species, Zostera marina. Natural resource management’s...
Ding, Rui; Chen, Xu-Hui; Zhang, Li-Jun; Yu, Xiao-Dan; Qu, Bo; Duan, Ru; Xu, Yu-Feng
2014-01-01
Mycorrhizal association is known to be important to orchid species, and a complete understanding of the fungi that form mycorrhizas is required for orchid ecology and conservation. Liparis japonica (Orchidaceae) is a widespread terrestrial photosynthetic orchid in Northeast China. Previously, we found the genetic diversity of this species has been reduced recent years due to habitat destruction and fragmentation, but little was known about the relationship between this orchid species and the mycorrhizal fungi. The Rhizoctonia-like fungi are the commonly accepted mycorrhizal fungi associated with orchids. In this study, the distribution, diversity and specificity of culturable Rhizoctonia-like fungi associated with L. japonica species were investigated from seven populations in Northeast China. Among the 201 endophytic fungal isolates obtained, 86 Rhizoctonia-like fungi were identified based on morphological characters and molecular methods, and the ITS sequences and phylogenetic analysis revealed that all these Rhizoctonia-like fungi fell in the same main clade and were closely related to those of Tulasnella calospora species group. These findings indicated the high mycorrhizal specificity existed in L. japonica species regardless of habitats at least in Northeast China. Our results also supported the wide distribution of this fungal partner, and implied that the decline of L. japonica in Northeast China did not result from high mycorrhizal specificity. Using culture-dependent technology, these mycorrhizal fungal isolates might be important sources for the further utilizing in orchids conservation.
Directory of Open Access Journals (Sweden)
Rui Ding
Full Text Available Mycorrhizal association is known to be important to orchid species, and a complete understanding of the fungi that form mycorrhizas is required for orchid ecology and conservation. Liparis japonica (Orchidaceae is a widespread terrestrial photosynthetic orchid in Northeast China. Previously, we found the genetic diversity of this species has been reduced recent years due to habitat destruction and fragmentation, but little was known about the relationship between this orchid species and the mycorrhizal fungi. The Rhizoctonia-like fungi are the commonly accepted mycorrhizal fungi associated with orchids. In this study, the distribution, diversity and specificity of culturable Rhizoctonia-like fungi associated with L. japonica species were investigated from seven populations in Northeast China. Among the 201 endophytic fungal isolates obtained, 86 Rhizoctonia-like fungi were identified based on morphological characters and molecular methods, and the ITS sequences and phylogenetic analysis revealed that all these Rhizoctonia-like fungi fell in the same main clade and were closely related to those of Tulasnella calospora species group. These findings indicated the high mycorrhizal specificity existed in L. japonica species regardless of habitats at least in Northeast China. Our results also supported the wide distribution of this fungal partner, and implied that the decline of L. japonica in Northeast China did not result from high mycorrhizal specificity. Using culture-dependent technology, these mycorrhizal fungal isolates might be important sources for the further utilizing in orchids conservation.
Suzuki, Masahiro; Segawa, Takahiro; Mori, Hiroshi; Akiyoshi, Ayumi; Ootsuki, Ryo; Kurihara, Akira; Sakayama, Hidetoshi; Kitayama, Taiju; Abe, Tsuyoshi; Kogame, Kazuhiro; Kawai, Hiroshi; Nozaki, Hisayoshi
2016-01-01
Liagora japonica is a red algal species distributed in temperate regions of Japan. This species has not been collected from its type locality on the Pacific coast of Japan since 1927 and seems to have become extinct in this area. For molecular characterization of L. japonica, we extracted DNA from the topotype material of L. japonica collected in 1927, analyzed seven genes using Illumina next-generation sequencing, and compared these data with sequences from modern samples of similar red algae collected from the Japan Sea coast of Japan. Both morphological and molecular data from modern samples and historical specimens (including the lectotype and topotype) suggest that the specimens from the Pacific and Japan Sea coasts of Japan should be treated as a single species, and that L. japonica is phylogenetically separated from the genus Liagora. Based on the phylogenetic results and examination of reproductive structures, we propose Otohimella japonica gen. et comb. nov., characterized morphologically by diffuse carposporophytes, undivided carposporangia, and involucral filaments initiated only from the cortical cell on the supporting cell.
Zuo, Yu; Xie, Wenfang; Pang, Yue; Li, Tiesong; Li, Qingwei; Li, Yingying
2017-01-01
The composition of the bacterial communities in the hindgut contents of Lampetrs japonica was surveyed by Illumina MiSeq of the 16S rRNA gene. An average of 32385 optimized reads was obtained from three samples. The rarefaction curve based on the operational taxonomic units tended to approach the asymptote. The rank abundance curve representing the species richness and evenness was calculated. The composition of microbe in six classification levels was also analyzed. Top 20 members in genera level were displayed as the classification tree. The abundance of microorganisms in different individuals was displayed as the pie charts at the branch nodes in the classification tree. The differences of top 50 genera in abundance between individuals of lamprey are displayed as a heatmap. The pairwise comparison of bacterial taxa abundance revealed that there are no significant differences of gut microbiota between three individuals of lamprey at a given rarefied depth. Also, the gut microbiota derived from L. japonica displays little similarity with other aquatic organism of Vertebrata after UPGMA analysis. The metabolic function of the bacterial communities was predicted through KEGG analysis. This study represents the first analysis of the bacterial community composition in the gut content of L. japonica. The investigation of the gut microbiota associated with L. japonica will broaden our understanding of this unique organism.
Directory of Open Access Journals (Sweden)
Yu Zuo
Full Text Available The composition of the bacterial communities in the hindgut contents of Lampetrs japonica was surveyed by Illumina MiSeq of the 16S rRNA gene. An average of 32385 optimized reads was obtained from three samples. The rarefaction curve based on the operational taxonomic units tended to approach the asymptote. The rank abundance curve representing the species richness and evenness was calculated. The composition of microbe in six classification levels was also analyzed. Top 20 members in genera level were displayed as the classification tree. The abundance of microorganisms in different individuals was displayed as the pie charts at the branch nodes in the classification tree. The differences of top 50 genera in abundance between individuals of lamprey are displayed as a heatmap. The pairwise comparison of bacterial taxa abundance revealed that there are no significant differences of gut microbiota between three individuals of lamprey at a given rarefied depth. Also, the gut microbiota derived from L. japonica displays little similarity with other aquatic organism of Vertebrata after UPGMA analysis. The metabolic function of the bacterial communities was predicted through KEGG analysis. This study represents the first analysis of the bacterial community composition in the gut content of L. japonica. The investigation of the gut microbiota associated with L. japonica will broaden our understanding of this unique organism.
Zhang, Honggen; Che, Jianlan; Ge, Yongshen; Pei, Yan; Zhang, Lijia; Liu, Qiaoquan; Gu, Minghong; Tang, Shuzhu
2017-12-01
Three-line Oryza sativa (ssp. japonica) hybrids have been developed mainly using Chinsurah Boro II (BT)-type cytoplasmic male sterility (CMS). The Rf1 gene restores the fertility of BT-type CMS lines, and is the only fertility restorer gene (Rf) that has been used to produce three-line japonica hybrids. Using more Rf genes to breed BT-type restorer lines may broaden the genetic diversity of the restorer lines, and represents a viable approach to improve the heterosis level of BT-type japonica hybrids. We identified two major Rf genes from '93-11' that are involved in restoring the fertility of BT-type CMS plants. These genes were identified from resequenced chromosome segment substitution lines derived from a cross between the japonica variety 'Nipponbare' and the indica variety '93-11'. Molecular mapping results revealed that these genes were Rf5 and Rf6, which are the Rf genes that restore fertility to Honglian-type CMS lines. The BT-type F 1 hybrids with either Rf5 or Rf6 exhibited normal seed setting rates, but F 1 plants carrying Rf6 showed more stable seed setting rates than those of plants carrying Rf5 under heat-stress conditions. Furthermore, the seed setting rates of F 1 hybrids carrying both Rf5 and Rf6 were more stable than that of F 1 plants carrying only one Rf gene. Rf6 is an important genetic resource for the breeding of BT-type japonica restorer lines. Our findings may be useful for breeders interested in developing BT-type japonica hybrids.
Zhang, Xiaomei; Zhou, Yi; Liu, Peng; Wang, Feng; Liu, Bingjian; Liu, Xujia; Yang, Hongsheng
2015-05-15
In coastal areas of China, the seagrass Zostera japonica has drastically decreased in the past decades. Swan Lake is an exception, where we found extensive areas of Z. japonica beds. The growth of Z. japonica in the lagoon exhibited strong seasonal variation. The maximum shoot density of 9880±2786 shoots m(-2) occurred in August. The maximum specific growth rate (SGR) of 4.99±1.99%⋅d(-1) was recorded in June 2012. SGR might be a good parameter for assessing the growth status of Z. japonica population. N and P contents in the rhizome were significantly lower than those in the leaf and leaf sheath. Lower C/P ratios suggested P enrichment of the seagrass. The occurrence of Z. japonica in Swan Lake was featured by adapting to the intertidal harsh environments. The transplantation method using sectioned rhizomes would be a potential way for restoration of degraded Z. japonica beds. The establishment of the Rongcheng Swan National Nature Reserve in China has contributed to the survival and expansion of Z. japonica in Swan Lake. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Luciano do Amarante
2012-09-01
Full Text Available The southern State of Rio Grande do Sul (RS is the main rice producer in Brazil with a 60% participation of the national production and 86% participation of the region. Rice culture irrigation system is done by flooding, which leads to soil salinization, a major environmental constraint to production since it alters the plants’ metabolism exposed to this type of stress. The indica cultivar, widely used in RS, has a higher sensitivity to salinity when compared to that of the japonica cultivar in other physiological aspects. Current research analyzes enzymes expression involved in salt-subjected indica and japonica rice cultivars’ respiration. Oryza sativa L. spp. japonica S.Kato (BRS Bojuru, IAS 12-9 Formosa and Goyakuman and Oryza sativa L. spp. indica S. Kato (BRS Taim-7, BRS Atalanta and BRS Querencia were the cultivars employed. Seedlings were transferred to 15 L basins containing 50% Hoagland nutrient solution increased by 0, 25, 50, 75 and 100 mM NaCl, and collected at 14, 28 and 42 days after transfer (DAT. Plant tissues were macerated and placed in eppendorf tubes with Scandálios extractor solution. Electrophoresis was performed in 7% of the polyacrylamide gels in vertical vats. Bands were revealed for the following enzymes systems: esterase, alcohol dehydrogenase, phosphoglucoisomerase, malate dehydrogenase, malic enzyme and alpha amylase. The enzymes expression was greater in subspecies japonica, with more intense bands in proportion to salinity increase. Results show that enzyme systems are involved in the salinity defense mechanisms in O. sativa spp. japonica cultivar.
Directory of Open Access Journals (Sweden)
Linhong Teng
2017-11-01
Full Text Available Lipoxygenase (LOX plays important roles in fatty acid oxidation and lipid mediator biosynthesis. In this study, we give first insights into brown algal LOX evolution. Whole genome searches revealed four, three, and eleven LOXs in Ectocarpus siliculosus, Cladosiphon okamuranus, and Saccharina japonica, respectively. In phylogenetic analyses, LOXs from brown algae form a robust clade with those from prokaryotes, suggesting an ancestral origin and slow evolution. Brown algal LOXs were divided into two clades, C1 and C2 in a phylogenetic tree. Compared to the two species of Ectocarpales, LOX gene expansion occurred in the kelp S. japonica through tandem duplication and segmental duplication. Selection pressure analysis showed that LOX genes in brown algae have undergone strong purifying selection, while the selective constraint in the C2 clade was more relaxed than that in the C1 clade. Furthermore, within each clade, LOXs of S. japonica evolved under more relaxed selection constraints than E. siliculosus and C. okamuranus. Structural modeling showed that unlike LOXs of plants and animals, which contain a β barrel in the N-terminal part of the protein, LOXs in brown algae fold into a single domain. Analysis of previously published transcriptomic data showed that LOXs in E. siliculosus are responsive to hyposaline, hypersaline, oxidative, and copper stresses. Moreover, clear divergence of expression patterns was observed among different life stages, as well as between duplicate gene pairs. In E. siliculosus, all four LOXs are male-biased in immature gametophytes, and mature gametophytes showed significantly higher LOX mRNA levels than immature gametophytes and sporophytes. In S. japonica, however, our RNA-Seq data showed that most LOXs are highly expressed in sporophytes. Even the most recently duplicated gene pairs showed divergent expression patterns, suggesting that functional divergence has likely occurred since LOX genes duplicated, which
Energy Technology Data Exchange (ETDEWEB)
Mao Huan [Sperm Laboratory, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); The First Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou (China); Tan Fuqing [The First Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou (China); Wang Dahui [Sperm Laboratory, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Zhu Junquan [Faculty of Life Science and Bioengineering, Ningbo University, Zhejiang 315211 (China); Zhou Hong [Sperm Laboratory, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China); Yang Wanxi, E-mail: wxyang@spermlab.org [Sperm Laboratory, College of Life Sciences, Zhejiang University, Hangzhou 310058 (China)
2012-11-15
Metallothionein (MT) participates in metallic homeostasis and detoxification in living animals. Previous studies have focused mainly on the functions of MT in vertebrates, but the functions of MT during spermiogenesis in invertebrates remain unclear. In order to investigate the functions of MT during spermiogenesis in the Japanese stone crab (Charybdis japonica), we identified the C. japonica MT complete cDNA sequence from the total RNA of the testis using RT-PCR and RACE. The 587 bp MT cDNA contains: an 80 bp 5 Prime untranslated region, a 333 bp 3 Prime untranslated region, and a 174 bp open reading frame. MT has 57 amino acids including 19 cysteines. The protein alignment between MT sequences of C. japonica and other crabs shows a high similarity and a strong identity in cysteine residues vital for the metal-binding affinity of MT. After the cadmium (Cd) exposure, the testis displays both abnormal morphology and MT mRNA expression both of which indicate a sensitive response of testis MT to Cd. Therefore, we suggest that MT is an excellent biomarker candidate for evaluating Cd pollution.
DNA damage in gill cells of Corbicula japonica exposed to natural and anthropogenic stressors
Directory of Open Access Journals (Sweden)
Valentina Vladimirovna Slobodskova
2015-06-01
The results are presented as the percentage distribution of nuclei in the various damage classes and summarized in an index of DNA integrity or genetic damage index GDI (Cavas, Kohen, 2008: The results from our study showed significant level of DNA damage from the C. japonica which were collected from polluted sites. Unpolluted sites were described as with no or minimal DNA strand breaks. Mollusks collected at polluted areas (estuary Razdolnaya river, lagoon Tihaya showed high levels of DNA damage, GDI is equal to 3.22±0.2 and 3.11±0.7 in gills respectively. C. japonica obtained from a ‘clean’ areas (estuary Artemovka river, estuary Partizanskaya river demonstrate less high level of DNA damage destruction, GDI is equal to 0,6±0,08 and 0,71±0,12 in gills respectively. Lipid peroxidation level was assayed measurement of malondialdehyde (MDA, a decomposition product of polyunsaturated fatty acids hydro peroxides were determined by the TBA reaction. The absorbance was read at 532 nm after removal of substances (TBARS formed was calculated by using an extinction coefficient of 1.56*105 M-1 cm -1 formed per g dry weight. C. japonica sampled at Artemovka estuary, Partizanskaya estuary, Razdolnaya estuary, Tihaya lagoon showed LPX level (3.46±0.59, 5.62±0.82, 12.85±0.52, 15.32±1.13 nmol TBARS/g dry wt in gills respectively. In conclusion, it can be noted that in the course of the experiment we found a clear relationship between the amount of DNA damage and the level of peroxidation products (MDA in the gills of bivalve C. japonica, collected from sites with varying degrees of anthropogenic load. It should be emphasized that the shellfish that live in polluted areas are likely to be in a state of oxidative stress, which is one of the causes the degradation of DNA.
Savoie, Amanda M; Saunders, Gary W
2015-12-01
There is currently conflict in the literature on the taxonomic status of the reportedly cosmopolitan species Neosiphonia harveyi, a common red alga along the coast of Atlantic Canada and New England, USA. Neosiphonia harveyi sensu lato was assessed using three molecular markers: COI-5P, ITS and rbcL. All three markers clearly delimited three genetic species groups within N. harveyi sensu lato in this region, which we identified as N. harveyi, N. japonica and Polysiphonia akkeshiensis (here resurrected from synonymy with N. japonica). Although Neosiphonia harveyi is considered by some authors to be introduced to the Atlantic from the western Pacific, it was only confirmed from the North Atlantic suggesting it is native to this area. In contrast, Neosiphonia japonica was collected from only two sites in Rhode Island, USA, as well as from its reported native range in Asia (South Korea), which when combined with data in GenBank indicates that this species was introduced to the Northwest Atlantic. The GenBank data further indicate that N. japonica was also introduced to North Carolina, Spain, Australia and New Zealand. Despite the fact that all three markers clearly delimited N. harveyi and N. japonica as distinct genetic species groups, the ITS sequences for some N. harveyi individuals displayed mixed patterns and additivity indicating introgression of nuclear DNA from N. japonica into N. harveyi in the Northwest Atlantic. Introgression of DNA from an introduced species to a native species (i.e. 'genetic pollution') is one of the possible consequences of species introductions, and we believe this is the first documented evidence for this phenomenon in red algae. © 2015 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Yu-San Han
Full Text Available Anguilla japonica and Anguilla marmorata share overlapping spawning sites, similar drifting routes, and comparable larval durations. However, they exhibit allopatric geographical distributions in East Asia. To clarify this ecological discrepancy, glass eels from estuaries in Taiwan, the Philippines, Indonesia, and China were collected monthly, and the survival rate of A. marmorata under varying water salinities and temperatures was examined. The composition ratio of these 2 eel species showed a significant latitude cline, matching the 24 °C sea surface temperature isotherm in winter. Both species had opposing temperature preferences for recruitment. A. marmorata prefer high water temperatures and die at low water temperatures. In contrast, A. japonica can endure low water temperatures, but their recruitment is inhibited by high water temperatures. Thus, A. japonica glass eels, which mainly spawn in summer, are preferably recruited to Taiwan, China, Korea, and Japan by the Kuroshio and its branch waters in winter. Meanwhile, A. marmorata glass eels, which spawn throughout the year, are mostly screened out in East Asia in areas with low-temperature coastal waters in winter. During summer, the strong northward currents from the South China Sea and Changjiang River discharge markedly block the Kuroshio invasion and thus restrict the approach of A. marmorata glass eels to the coasts of China and Korea. The differences in the preferences of the recruitment temperature for glass eels combined with the availability of oceanic currents shape the real geographic distribution of Anguilla japonica and Anguilla marmorata, making them "temperate" and "tropical" eels, respectively.
Han, Yu-San; Yambot, Apolinario V; Zhang, Heng; Hung, Chia-Ling
2012-01-01
Anguilla japonica and Anguilla marmorata share overlapping spawning sites, similar drifting routes, and comparable larval durations. However, they exhibit allopatric geographical distributions in East Asia. To clarify this ecological discrepancy, glass eels from estuaries in Taiwan, the Philippines, Indonesia, and China were collected monthly, and the survival rate of A. marmorata under varying water salinities and temperatures was examined. The composition ratio of these 2 eel species showed a significant latitude cline, matching the 24 °C sea surface temperature isotherm in winter. Both species had opposing temperature preferences for recruitment. A. marmorata prefer high water temperatures and die at low water temperatures. In contrast, A. japonica can endure low water temperatures, but their recruitment is inhibited by high water temperatures. Thus, A. japonica glass eels, which mainly spawn in summer, are preferably recruited to Taiwan, China, Korea, and Japan by the Kuroshio and its branch waters in winter. Meanwhile, A. marmorata glass eels, which spawn throughout the year, are mostly screened out in East Asia in areas with low-temperature coastal waters in winter. During summer, the strong northward currents from the South China Sea and Changjiang River discharge markedly block the Kuroshio invasion and thus restrict the approach of A. marmorata glass eels to the coasts of China and Korea. The differences in the preferences of the recruitment temperature for glass eels combined with the availability of oceanic currents shape the real geographic distribution of Anguilla japonica and Anguilla marmorata, making them "temperate" and "tropical" eels, respectively.
Fallopia japonica, a Natural Modulator, Can Overcome Multidrug Resistance in Cancer Cells
Directory of Open Access Journals (Sweden)
Safaa Yehia Eid
2015-01-01
Full Text Available Resistance of cancer cells to chemotherapy is controlled by the decrease of intracellular drug accumulation, increase of detoxification, and diminished propensity of cancer cells to undergo apoptosis. ATP-binding cassette (ABC membrane transporters with intracellular metabolic enzymes contribute to the complex and unresolved phenomenon of multidrug resistance (MDR. Natural products as alternative medicine have great potential to discover new MDR inhibitors with diverse modes of action. In this study, we characterized several extracts of traditional Chinese medicine (TCM plants (N = 16 for their interaction with ABC transporters, cytochrome P3A4 (CYP3A4, and glutathione-S-transferase (GST activities and their cytotoxic effect on different cancer cell lines. Fallopia japonica (FJ (Polygonaceae shows potent inhibitory effect on CYP3A4 P-glycoprotein activity about 1.8-fold when compared to verapamil as positive control. FJ shows significant inhibitory effect (39.81% compared with the known inhibitor ketoconazole and 100 μg/mL inhibited GST activity to 14 μmol/min/mL. FJ shows moderate cytotoxicity in human Caco-2, HepG-2, and HeLa cell lines; IC50 values were 630.98, 198.80, and 317.37 µg/mL, respectively. LC-ESI-MS were used to identify and quantify the most abundant compounds, emodin, polydatin, and resveratrol, in the most active extract of FJ. Here, we present the prospect of using Fallopia japonica as natural products to modulate the function of ABC drug transporters. We are conducting future study to evaluate the ability of the major active secondary metabolites of Fallopia japonica to modulate MDR and their impact in case of failure of chemotherapy.
Antimicrobial evaluation of the crude extract of symbiotic fungi from marine sponge Reniera japonica
Directory of Open Access Journals (Sweden)
Xuelian Bai
2018-05-01
Full Text Available Marine sponge-derived microbes are one of the rich sources of bioactive natural products with a broad spectrum of bioactivities. The present work focuses on the isolation and antimicrobial screening of the marine sponge-associated fungi from Reniera japonica MNP-2016. The results indicated that five fungi (L1-2, L2-1, L4, L8-1 and L14 were successfully isolated. Bioassay tests showed that only strain L14 had strong inhibitory effect on the pathogens, Staphyloccocus aureus, Escherichia coli and Candida albicans. 18S rDNA sequence analysis indicated that strain L14 was ascribed to Aspergillus genus. To the best of our knowledge, this work was the first report on the isolation and antimicrobial evaluation of fungi from R. japonica.
Directory of Open Access Journals (Sweden)
Bruno P. Berto
2013-12-01
Full Text Available The Japanese quail Coturnix japonica originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current paper characterizes Eimeria bateri, Eimeria tsunodai and Eimeria uzura recovered from C. japonica. Based on the fact that quails have a global distribution, as are their coccidia, the findings of this study should provide the means for diagnosis of those Eimeria spp. in other regions and continents. Eimeria bateri showed the greatest intensity of infection and shed oocysts from the fourth day after infection; in contrast, E. tsunodai and E. uzura shed oocysts from the fifth day after infection. The three species shared a high degree of similarity and were all polymorphic. Yet, the application of line regressions, histograms and ANOVA provided means for the identification of these species. Finally, the algorithm was very efficient since verified that resultant values were not superimposed.
Directory of Open Access Journals (Sweden)
Jae-Young Kim
2018-04-01
Full Text Available The intestinal microbial communities play critical roles in various aspects of body function of the host. Prebiotics, such as dietary fiber, can affect health of the host by altering the composition of intestinal microbiota. Although brown seaweed Laminaria japonica is rich in dietary fiber, studies on its prebiotic potential are quite rare. In this study, basal diet (control, basal diet supplemented with dried L. japonica (DLJ, heat-treated dried L. japonica (HLJ, or heated dried L. japonica with added fructooligosaccharide (FHLJ was fed to rats for 16 weeks. Serum concentrations of IgG, triglyceride, and cholesterol were measured. In addition, the intestinal microbiota composition was analyzed by high-throughput sequencing of 16S rRNA gene. As compared to the control group, DLJ, HLJ, and FHLJ groups showed significantly higher serum IgG concentration, but had lower weight gain and serum triglyceride concentration. Moreover, DLJ, HLJ, and FHLJ groups showed lower Fimicutes to Bacteroidetes ratio when compared with the control group. As compared with the control group, obesity-associated bacterial genera (Allobaculum, Turicibacter, Coprobacillus, Mollicute, and Oscilibacter, and the genera with pathogenic potentials (Mollicute, Bacteroides, Clostridium, Escherichia, and Prevotella decreased while leanness-associated genera (Alistipes, Bacteroides, and Prevotella, and lactic acid bacterial genera (Subdoligranulum, Streptococcus, Lactobacillus, Enterococcus, and Bifidobacterium increased in all treatment groups. On the contrary, butyric acid producing genera including Subdoligranulum, Roseburia, Eubacterium, Butyrivibrio, and Anaerotruncus increased significantly only in FHLJ group. The overall results support multiple prebiotic effects of seaweed L. japonica on rats as determined by body weight reduction, enhanced immune response, and desirable changes in intestinal microbiota composition, suggesting the great potential of L. japonica as an
Tan, Hui; Ashour, Ahmed; Katakura, Yoshinori; Shimizu, Kuniyoshi
2015-04-15
Our previous results elucidated that the leaves of Eriobotrya japonica possessed the potential to suppress ovariectomy-induced bone mineral density deterioration, and ursolic acid, the major bioactive component in these leaves, suppressed the osteoclast differentiation. The aim of this study was to discover more candidates for development of novel antiosteoclastogenesis agents from the leaves of E. japonica. Phytochemical analysis following a cell-based osteoclastic tartrate-resistant acid phosphatase (TRAP) activity assay revealed 11 more compounds with a potent antiosteoclastogenesis effect. The potency of ursane-type triterpenoids from the leaves of E. japonica prompted us to investigate the structure-activity relationships underlying their antiosteoclastogenesis. The results revealed that both the hydroxyl group at C-3 and the carboxylic group at C-17 played indispensable roles in the antiosteoclastogenesis activity of ursane-type triterpenoids. The configuration at C-3 (a beta-form of the hydroxyl group) was found to be important for this activity. While introducing a hydroxyl group at C-19 increased the inhibitory activity of ursane-type triterpenoids carrying an alpha-form hydroxyl group at C-3. The bioactivity analyses of ursolic acid and oleanolic acid demonstrated that the antiosteoclastogenesis effect of ursolic acid may be related to different positions of the C-29 and C-30 methyl groups on the E-ring, since oleanolic acid showed limited activity. The addition of a hydroxyl group at C-2 would dramatically improve the inhibition of oleanane-type triterpenoids. Collectively, these findings could provide important clues for the improvement of multi-targeted antiosteoclastogenesis agents from the leaves of E. japonica. Copyright © 2015 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Amir Hossein Esmaeili
2014-06-01
Full Text Available Objectives: Eriobotrya japonica belongs to the Rosaceae. Studies have shown that the flowers of this plant are rich in phenolic and flavonoid compounds. Accorrdingly, the evaluation of antioxidative effects of Eriobotrya japonica Flower Extract (EJFE have been performed in vitro. Material and Methods: In this study, to investigate the influences of components of EJFE on its antioxidative activity, extract was prepared using hydro-alcoholic (25:75 V/V solvent and the antioxidative activity of the extract was evaluated based on the scavenging of various radicals (DPPH and H2O2 by spectrophotometric method and chelating of ferrous ions by ferrozine reagent. Results: HPLC analysis of the Eriobotrya japonica Flower Extract (EJFE revealed hesperetin and gallic acid as the major antioxidants. When the content of total flavonoid and polyphenolic compounds in the flower extract of this plant was examined, a significantly higher level of total polyphenols was found in Eriobotrya japonica flower extract. Conclusion: Results demonstrate that the high ability to scavenge free radicals, reducing power, and Fe+2chelating activity exerted by the EJFE were due to the high content of hesperetin and gallic acid in the flowers.
International Nuclear Information System (INIS)
Reddy, P.R.; Madhusudhan Rao, L.
1976-01-01
Three genotypes of rice, one in each of japonica, indica, and a japonica-indica cross were grown in half-Hoagland culture solution. 32 P (40 μCi/I) was added to each of these culture jars and placed at 10,20,30 and 40degC in growth chamber for a period of 1,5 and 10 h at each temperature. The actual uptake of 32 P in plant was very low at 10 and 20degC; moderately low at 40degC and very low at 30degC in japonica and the cross. The uptake was higher at 30 and 40degC in indica. This indicates their ability in uptake of fertilizer at these temperatures. The percentage of absorbed ions decreased at 10 and 20degC and increased at 30 and 40degC with increased duration in all the genotypes. The actual uptake of ions was in proportion to the absorbed ions at higher temperatures and inversely proportional at lower temperatures. The percentage of translocation of 32 P to shoot increased with time between 20 and 50degC in indica, whereas it was high only at 30 and 40degC in japonica and the cross. The translocation was low at 10degC in all the genotypes. The uptake of 32 P at different concentrations under different diurnal temperatures (20/10, 30/20 and 40/30degC) was also studied. (author)
Harvest time of Cryptomeria japonica seeds depending on climate factors
Son, Seog-Gu; Kim, Hyo-Jeong; Kim, Chang-Soo; Byun, Kwang-Ok
2010-05-01
Sound seeds should have good germination rates and seed germination can be influenced by several factors. Seed picking time is regarded as one of the necessary elements to obtain sound seeds. From a clonal seed orchard of Cryptomeria japonica located in southern part of Korean peninsular, cones were picked about every 10 days from 30th of July 2005 to 30th of October in both 2005 and 2006. We have also analyzed the effects of climatic factors about two consecutive years on seed productivity. From the picked cones, seeds were collected and these germination ability, seed size and embryo shapes were investigated according to cone picking time. The 1,000-seed weight picked on 18th of August was 3.3 g and 5.3 g on 30th of September 2005and 2006. The size of seeds picked from 18th of August to 30th of September increased from 19.3 mm to 21.3 mm in length and from 15.8 mm to 18.5 mm in width. Depending on picking time, various shapes of embryos, including embryos with liquid material, jellied material and fully matured ones were observed. Germination aspects also varied throughout the test days. About two weeks after seeding in a glass petri-dish, germinal apparatuses appeared from each test seed sets which had been picked from after 10 August 2005 and 10 August 2006. The germination rates started from 10.7% from seeds picked 20 August 2006. Average germination rate in 2005 was 18.3 and 19.6 in 2006. In 2005, the highest germination rate was 34.3% from seeds picked on the 30th of September. In 2006, the highest germination rate was 31.7% for seeds picked at the same date as the 2005 seeds. After September, the highest germination rate for picked seeds decreased in both 2005 and 2006. Among the climatic factors, monthly sum of temperature and of precipitation were the main factors for maturation of C. japonica seeds. The results implied that the best cone picking time for the Korean C. japonica seed orchard to be around the end of September.
International Nuclear Information System (INIS)
Wu Dafu; Zhang Shengli; Li Dongfang
2009-01-01
[Objective] The study provided theoretical basis for production practice . [Method] With Lonicera japonica Thunb .as material, diurnal changes of net photosynthetic rate (NPR) in leaves of the plant and the responding mathematical model of NPR to photosynthetic valid radiation were studied using portable photosynthetic determinator system. [Result] Like most of C3 plants, the diurnal changes curve of NPR of Lonicera japonica Thunb .showed double peaks, but there were time difference in reaching the peak value between the study and previous ones . The responding mathematical model of NPR to photosynthetic valid radiation could be described by three mathematic functions, such as logarithm, linearity and binomial, but binomial function was more precise than the others. Light saturation point of Lonicera japonica Thunb. was figured out by binomial equation deduced in the study , and light saturation point was 1 086 .3 μmol/ (m2•s) . [Conclusion] The diurnal changes curve of NPR of Lonicera japonica Thunb .showed double peaks, and the responding mathematical model of NPR to photosynthetic valid radiation could be described by binomial functions
International Nuclear Information System (INIS)
Ta, T.C.; Ohira, Koji
1982-01-01
The effects of various environmental condition such as temperature and light intensity on the uptake and assimilation of ammonium and nitrate in 4-week-old Indica and Japonica rice plants were studied using the 15 N tracer technique. Both temperature and light intensity profoundly affected the uptake and assimilation of ammonium and nitrate, and the effects were more apparent in the utilization of nitrate by both Indica and Japonica rice plants. The uptake as well as assimilation of the two forms of nitrogen were greatly inhibited at low temperature and low light intensity. On the other hand, although no significant difference in the effects of environmental conditions on the utilization of ammonium was observed between the Indica and Japonica rice plants, the former were more sensitive than the latter in the utilization of nitrate. At high temperature and high light intensity, the Indica rice plants absorbed, reduced, and assimilated nitrate more effectively than the Japonica, and this effect disappeared when the temperature or light intensity was reduced. (author)
Effect of Biochar on Relieving Cadmium Stress and Reducing Accumulation in Super japonica Rice
Institute of Scientific and Technical Information of China (English)
ZHANG Zhen-yu; MENG Jun; DANG Shu; CHEN Wen-fu
2014-01-01
It is of great importance to solve the threats induced by cadmium pollution on crops. This paper examined the effect of biochar on cadmium accumulation in japonica rice and revealed the mechanism underlying the response of protective enzyme system to cadmium stress. Biochar derived from rice straw was applied at two application rates under three cadmium concentrations. Shennong 265, super japonica rice variety, was selected as the test crop. The results indicated that cadmium content in above-ground biomass of rice increased with increasing soil cadmium concentrations, but the biochar application could suppress the accumulation of cadmium to some extent. Under high concentrations of cadmium, content of free proline and MDA (malondialdehyde) were high, so did the SOD (superoxide dismutase), POD (peroxidase) and CAT (catalase) activity in the lfag leaf of rice. However, the protective enzyme activities remained at low level when biochar was added.
Watanabe, Shun; Minegishi, Yuki; Yoshinaga, Tatsuki; Aoyama, Jun; Tsukamoto, Katsumi
2004-01-01
To compensate for the limited number of morphological characteristics of fish eggs and larvae, we established a convenient and robust method of species identification for eggs of the Japanese eel (Anguilla japonica) using a real-time polymerase chain reaction (PCR) that can be performed onboard research ships at sea. A total of about 1.2 kbp of the mitochondrial 16S ribosomal RNA gene sequences from all species of Anguilla and 3 other anguilliform species were compared to design specific primer pairs and a probe for A. japonica. This real-time PCR amplification was conducted for a total of 44 specimens including A. japonica, A. marmorata, A. bicolor pacifica, and 6 other anguilliform species. Immediate PCR amplification was only observed in A. japonica. We then tested this method under onboard conditions and obtained the same result as had been produced in the laboratory. These results suggest that real-time PCR can be a powerful tool for detecting Japanese eel eggs and newly hatched larvae immediately after onboard sampling during research cruises and will allow targeted sampling efforts to occur rapidly in response to any positive onboard identification of the eggs and larvae of this species.
Insect parasitoids are often manipulated to improve biological control programs for various arthropod pests. Volatile compounds can be a relevant cue used by most parasitoid hymenoptera for host or host microhabitat location. We studied olfactory responses of the braconid Asobara japonica Belokobyls...
Kimura, Yoshiyuki; Sumiyoshi, Maho
2011-09-01
The Swertia japonica is used clinically as a remedy for gastrointestinal symptoms in Japan. We examined the effects of a S. japonica and swertiamarin on gastric emptying and gastrointestinal motility in atropine-, dopamine-, and 5-hydroxytryptamine (5-HT)-treated mice. All three preparations inhibited reductions in gastric emptying and gastrointestinal motility induced by dopamine (1mg/kg, intraperitoneal injection, ip). Neither the powder, swertiamarin, nor itopride had any effect on the reductions in gastric emptying and gastrointestinal motility caused by 5-HT (4 mg/kg, ip). These findings suggest that the powder and swertiamarin stimulate gastric emptying and gastrointestinal motility by inhibiting the dopamine D(2) receptor. Copyright © 2011 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Liangping Zha
2017-07-01
Full Text Available The content of active compounds differ in buds and flowers of Lonicera japonica (FLJ and L. japonica var. chinensis (rFLJ. Chlorogenic acid (CGAs were major active compounds of L. japonica and regarded as measurements for quality evaluation. However, little is known concerning the formation of active compounds at the molecular level. We quantified the major CGAs in FLJ and rFLJ, and found the concentrations of CGAs were higher in the buds of rFLJ than those of FLJ. Further analysis of CpG methylation of CGAs biosynthesis genes showed differences between FLJ and rFLJ in the 5′-UTR of phenylalanine ammonia-lyase 2 (PAL2. We identified 11 LjbZIP proteins and 24 rLjbZIP proteins with conserved basic leucine zipper domains, subcellular localization, and electrophoretic mobility shift assay showed that the transcription factor LjbZIP8 is a nuclear-localized protein that specifically binds to the G-box element of the LjPAL2 5′-UTR. Additionally, a transactivation assay and LjbZIP8 overexpression in transgenic tobacco indicated that LjbZIP8 could function as a repressor of transcription. Finally, treatment with 5-azacytidine decreased the transcription level of LjPAL2 and CGAs content in FLJ leaves. These results raise the possibility that DNA methylation might influence the recruitment of LjbZIP8, regulating PAL2 expression level and CGAs content in L. japonica.
Li, Yue-Song; Chen, Xin-Jun; Yang, Hong
2012-06-01
By adopting FVCOM-simulated 3-D physical field and based on the biological processes of chub mackerel (Scomber japonicas) in its early life history from the individual-based biological model, the individual-based ecological model for S. japonicas at its early growth stages in the East China Sea was constructed through coupling the physical field in March-July with the biological model by the method of Lagrange particle tracking. The model constructed could well simulate the transport process and abundance distribution of S. japonicas eggs and larvae. The Taiwan Warm Current, Kuroshio, and Tsushima Strait Warm Current directly affected the transport process and distribution of the eggs and larvae, and indirectly affected the growth and survive of the eggs and larvae through the transport to the nursery grounds with different water temperature and foods. The spawning grounds in southern East China Sea made more contributions to the recruitment to the fishing grounds in northeast East China Sea, but less to the Yangtze estuary and Zhoushan Island. The northwestern and southwestern parts of spawning grounds had strong connectivity with the nursery grounds of Cheju and Tsushima Straits, whereas the northeastern and southeastern parts of the spawning ground had strong connectivity with the nursery grounds of Kyushu and Pacific Ocean.
This presentation describes a technique for mapping distributions of the nonindigenous Japanese eelgrass Zostera japonica in estuarine ecosystems of the Pacific Northwest. The relatively broad distribution of this intertidal plant, often on very soft substrate, makes classical g...
Zhang, Wujun; Wu, Longmei; Wu, Xiaoran; Ding, Yanfeng; Li, Ganghua; Li, Jingyong; Weng, Fei; Liu, Zhenghui; Tang, She; Ding, Chengqiang; Wang, Shaohua
2016-12-01
Lodging in rice production often limits grain yield and quality by breaking or bending stems. Excessive nitrogen (N) fertilizer rates are the cause of poor lodging resistance in rice, but little is known about the effect of top-dressing N application rates on the mechanical strength of japonica rice plants, especially how the anatomical structure in culms is affected by N. In this study, field experiments on two japonica rice varieties with three top-dressing N application rates, 0 kg N ha(-1) (LN), 135 kg N ha(-1) (MN), and 270 kg N ha(-1) (HN) as urea, were conducted. Wuyunjing23, a lodging-resistant japonica rice cultivar and W3668, a lodging-susceptible japonica rice cultivar were used. The lodging index, breaking strength, morphological and anatomical traits in culms were measured in this study. The visual lodging rate in japonica rice differed remarkably between genotypes and top-dressing N treatments. The higher lodging index of rice plants was primarily attributed to the weak breaking strength of the lower internodes. The longer elongated basal internodes were responsible for higher plant height and a higher lodging index. Correlation analysis showed that breaking strength was significantly and positively correlated with the thickness of the mechanical tissue but was significantly and negatively correlated with the inner diameter of the major axis (b2). With increasing top-dressing N rates, the sclerenchyma cells of the mechanical tissues and the vascular bundles of the Wuyunjing23 cultivar varied little. The plant height, inner diameter of the minor axis (a2) and b2 increased significantly, but the area of the large vascular bundle (ALVB) and the area of the small vascular bundle (ASVB) decreased significantly and resulted in lower stem strength and a higher lodging index under higher top-dressing N conditions. The culm diameter of the W3668 cultivar increased slightly with no significant difference, and the sclerenchyma cells in the mechanical
International Nuclear Information System (INIS)
Tada, Y.; Sugai, M.; Furuhashi, K.
1996-01-01
When seedlings of Cuscuta japonica were grown with Vigna radiata in a flower pot for 6 d under white light and then irradiated with far-red or blue light, the seedlings parasitized V. radiata. However, no parasitism of the seedlings was observed under red or white light or in darkness. The parasitic behavior of seedlings of C. japonica was observed even if an acrylic rod was used as a substitute for the host plant. Upon incubation under far-red light, the seedling twined tightly around the rod and developed haustoria towards it. Haustoria also developed when apical and subapical regions of seedlings were held between two glass plants that were about 0.7 mm apart and were irradiated with far-red light. However, no haustoria were induced by either the hold or irradiation alone. These results indicate that parasitism of cuscuta japonica is controlled by the cooperative effects of two physical signals, far-red light and appropriate tactile pressure. Our findings suggest that parasitism by the genus Cuscuta involves a novel strategy
Nykyri, Johanna; Mattinen, Laura; Niemi, Outi; Adhikari, Satish; Kõiv, Viia; Somervuo, Panu; Fang, Xin; Auvinen, Petri; Mäe, Andres; Palva, E Tapio; Pirhonen, Minna
2013-01-01
In this study, we characterized a putative Flp/Tad pilus-encoding gene cluster, and we examined its regulation at the transcriptional level and its role in the virulence of potato pathogenic enterobacteria of the genus Pectobacterium. The Flp/Tad pilus-encoding gene clusters in Pectobacterium atrosepticum, Pectobacterium wasabiae and Pectobacterium aroidearum were compared to previously characterized flp/tad gene clusters, including that of the well-studied Flp/Tad pilus model organism Aggregatibacter actinomycetemcomitans, in which this pilus is a major virulence determinant. Comparative analyses revealed substantial protein sequence similarity and open reading frame synteny between the previously characterized flp/tad gene clusters and the cluster in Pectobacterium, suggesting that the predicted flp/tad gene cluster in Pectobacterium encodes a Flp/Tad pilus-like structure. We detected genes for a novel two-component system adjacent to the flp/tad gene cluster in Pectobacterium, and mutant analysis demonstrated that this system has a positive effect on the transcription of selected Flp/Tad pilus biogenesis genes, suggesting that this response regulator regulate the flp/tad gene cluster. Mutagenesis of either the predicted regulator gene or selected Flp/Tad pilus biogenesis genes had a significant impact on the maceration ability of the bacterial strains in potato tubers, indicating that the Flp/Tad pilus-encoding gene cluster represents a novel virulence determinant in Pectobacterium. Soft-rot enterobacteria in the genera Pectobacterium and Dickeya are of great agricultural importance, and an investigation of the virulence of these pathogens could facilitate improvements in agricultural practices, thus benefiting farmers, the potato industry and consumers.
International Nuclear Information System (INIS)
Aziz, A.; Khan, I.; Azam, S.; Mehnaz, S.; Ahmad, B.
2017-01-01
The aim of the current study was to synthesize Zinc nanoparticles (ZnNPs) of Eriobotrya japonica, their characterization using standard procedures and its screening for various pharmacological activities; antibacterial, antifungal, phytotoxic and heamaglutination in comparison with the methanolic, ethanolic and Ethyl acetate (EtOAc) fractions. The UV-Visible absorption spectra of ZnNPs showed peaks at 455 nm and Fourier Transform Infrared spectroscopy (FTIR) confirmed the presence of various functional groups such as, hydroxyl, amide, carbonyl, aldehyde, and alkynes. The Scanning Electron Microscope (SEM) analysis showed that the particle size was between 30-60 nm with spherical shape. The presence of Zinc along with other elements, such as C, O, S, Si, and K, was confirmed by Energy Dispersive X-ray (EDX), andthe mean size was 33nm as indicated in X-ray diffraction (XRD) spectra. The results of percent antibacterial activity for the methanolic, ethanolic and EtOAc fractions of E. japonica against E. coli was 62, 59.2, 44.4, P. aeruginosa 44.4, 40.7, 37, S. aureus 69.2, 46.1, 50, A. baumannii 52.1, 43.4, 0, M. morganii 59, 40.9, 68, MRSA 73.6, 52.6, 0 and P. vulgaris 60, 52, 64. The Zn NPs exhibited significant antibacterial activity against MRSA (94%) and P. vulgaris (92%), good against S. aureus (73%) and M. morganii (63.6%), moderate against E. coli (48.1%) and A. baumannii (43.4%) and low against P. aeruginosa (37%), respectively. The methanolic, ethanolic and EtOAc fractions of E. japonica showed low (<24%) and no antifungal activity against the tested fungal pathogens. The antifungal activity of Zn NPs against the test fungal pathogens was; A. parasiticus (30%), P. notatum and A. niger (40%), P. chrysogenum (55%), H. pseudocrispula (60%) while it was inactive against V. longisporum. The methanolic, ethanolic and EtOAc extract of E. japonica showed 50, 50 and 60% growth regulation at 1000, 50, 40 and 60% at 100 µg/ml, while at 10 µg/ml, 40, 20 and 50
Directory of Open Access Journals (Sweden)
Chuan-Hua Wang
2018-05-01
Full Text Available In this study, effects of nitrogen (N availability on growth, survival of Ramalina calicaris var. japonica, and whether it respond nitrogen stress in an integrated physiological way was evaluated. Thalli growth and propagule survival, thalli N and phosphorus (P content, and activity of phosphomonoesterase (PME of R. calicaris var. japonica were determined in a field experiment. Its differentiate adsorption in ammonia and nitrate, the activity of glutamine synthetase (GSA and nitrate reductase (NRA also were investigated in a series of indoor experiments. The results showed that N deposition significantly decreased the growth and survival of this lichen, and the N sensitivity threshold was suggested at 6.0 kg N⋅ha-1⋅y-1. When the N deposition increased from 8.59 kg N⋅ha-1⋅y-1 to 14.24, 20.49, 32.99 and 57.99 kg N⋅ha-1⋅y-1, the growth rates of lichen thalli decreased by 26.47, 39.01, 52.18 and 60.3%, respectively; Whereas the survival rate of the lichen propagules decreased from 92.8% of control (0.0 kg N⋅ha-1⋅y-1 to 10.7% of 50.0 kg N⋅ha-1⋅y-1, when they were treated with 0.00, 6.25, 12.5, 25.0, and 50.0 kg N⋅ha-1⋅y-1 deposition. Compared with an adequate adsorption of ammonium N, no nitrate adsorption occurred when thalli was submerged in solution lower than 0.4 mM. Our results also suggested that thalli total nitrogen, N:P ratio increased with N availability, and the activity of PME was significantly correlated with thalli total nitrogen. These all indicated that phosphorus limitation occurred when R. calicaris var. japonica treated with higher nitrogen deposition. Compared with slightly effects of NRA, GSA of R. calicaris var. japonica responded nitrogen availability significantly; In addition, GSA and NRA negatively correlated with thalli growth rate and propagule survival significantly. These results indicated that nitrogen stress do decrease growth and survival of R. calicaris var. japonica, and lichen would be
Fu, X.; Kong, W.; Peng, G.; Zhou, J.; Azam, M.; Xu, C.; Grierson, D.; Chen, K.
2012-01-01
Loquat (Eriobotrya japonica Lindl.) can be sorted into red- and white-fleshed cultivars. The flesh of Luoyangqing (LYQ, red-fleshed) appears red-orange because of a high content of carotenoids while the flesh of Baisha (BS, white-fleshed) appears ivory white due to a lack of carotenoid accumulation.
Directory of Open Access Journals (Sweden)
Zhenming Lü
2016-03-01
Full Text Available The common Chinese cuttlefish (Sepiella japonica has been considered one of the most economically important marine Cephalopod species in East Asia and seed breeding technology has been established for massive aquaculture and stock enhancement. In the present study, we used Illumina HiSeq2000 to sequence, assemble and annotate the transcriptome of the ovary tissues of S. japonica for the first time. A total of 53,116,650 and 53,446,640 reads were obtained from the immature and matured ovaries, respectively (NCBI SRA database SRX1409472 and SRX1409473, and 70,039 contigs (N50 = 1443 bp were obtained after de novo assembling with Trinity software. Digital gene expression analysis reveals 47,288 contigs show differential expression profile and 793 contigs are highly expressed in the immature ovary, while 38 contigs are highly expressed in the mature ovary with FPKM >100. We hope that the ovarian transcriptome and those stage-enriched transcripts of S. japonica can provide some insight into the understanding of genome-wide transcriptome profile of cuttlefish gonad tissue and give useful information in cuttlefish gonad development. Keywords: Cuttlefish, Gonad development, Transcriptome
Jiang, Qiu-Yun; Zhuo, Feng; Long, Shi-Hui; Zhao, Hai-Di; Yang, Dan-Jing; Ye, Zhi-Hong; Li, Shao-Shan; Jing, Yuan-Xiao
2016-02-01
A greenhouse pot experiment was conducted to study the impact of arbuscular mycorrhizal fungi-Glomus versiforme (Gv) and Rhizophagus intraradices (Ri) on the growth, Cd uptake, antioxidant indices [glutathione reductase (GR), ascorbate peroxidase (APX), superoxide dismutase (SOD), catalase (CAT), ascorbate (ASA), glutathione (GSH) and malonaldehyde (MDA)] and phytochelatins (PCs) production of Lonicera japonica in Cd-amended soils. Gv and Ri significantly increased P acquisition, biomass of shoots and roots at all Cd treatments. Gv significantly decreased Cd concentrations in shoots and roots, and Ri also obviously reduced Cd concentrations in shoots but increased Cd concentrations in roots. Meanwhile, activities of CAT, APX and GR, and contents of ASA and PCs were remarkably higher in Gv/Ri-inoculated plants than those of uninoculated plants, but lower MDA and GSH contents in Gv/Ri-inoculated plants were found. In conclusion, Gv and Ri symbiosis alleviated Cd toxicity of L. japonica through the decline of shoot Cd concentrations and the improvement of P nutrition, PCs content and activities of GR, CAT, APX in inoculated plants, and then improved plant growth. The decrease of shoot Cd concentrations in L. japonica inoculated with Gv/Ri would provide a clue for safe production of this plant from Cd-contaminated soils.
Directory of Open Access Journals (Sweden)
Seong Kyu Park
2013-01-01
Full Text Available Laminaria japonica has been frequently used as food supplements in many of the Asian countries and as a drug in traditional oriental medicine. This research investigated the effects of Laminaria japonica extract (LJE on acute phase inflammation in a carrageenan-induced paw edema model, as assessed by histomorphometric and immunohistochemical analyses. The effect of LJE was also evaluated in Raw264.7 cells stimulated with lipopolysaccharide (LPS in the aspect of the inhibition of nitric oxide (NO, prostaglandin E2 (PGE2, and proinflammatory cytokines production. NO, PGE2, tumor necrosis factor (TNF-α, interleukin-1β, and interleukin-6 contents were assayed by ELISA, and inducible NO synthase (iNOS and cyclooxygenase (COX-2 expressions were determined by western blot analyses. In rats, LJE treatment inhibited carrageenan-induced paw edema formation and infiltration of inflammatory cells in H&E staining. LJE treatment prevented the ability of LPS to increase the levels of iNOS and COX-2 protein in a concentration-dependent manner. Consistently, LJE suppressed the production of TNF-α, interleukin-1β, and interleukin-6. Treatment of the cells with LJE caused inhibition of inhibitor of κBα phosphorylation induced by LPS, suggesting LJE repression of nuclear factor-κB activity by LPS. In conclusion, this study shown here may be of help to understand the action mechanism of LJE and the anti-inflammatory use of L. japonica.
Directory of Open Access Journals (Sweden)
Cale A. Miller
2017-07-01
Full Text Available Photosynthesis and respiration are vital biological processes that shape the diurnal variability of carbonate chemistry in nearshore waters, presumably ameliorating (daytime or exacerbating (nighttime short-term acidification events, which are expected to increase in severity with ocean acidification (OA. Biogenic habitats such as seagrass beds have the capacity to reduce CO2 concentration and potentially provide refugia from OA. Further, some seagrasses have been shown to increase their photosynthetic rate in response to enriched total CO2 (TCO2. Therefore, the ability of seagrass to mitigate OA may increase as concentrations of TCO2 increase. In this study, we exposed native Zostera marina and non-native Zostera japonica seagrasses from Padilla Bay, WA (USA to various levels of irradiance and TCO2. Our results indicate that the average maximum net photosynthetic rate (Pmax for Z. japonica as a function of irradiance and TCO2 was 3x greater than Z. marina when standardized to chlorophyll (360 ± 33 μmol TCO2 mg chl−1 h−1 and 113 ± 10 μmol TCO2 mg chl−1 h−1, respectively. Additionally, Z. japonica increased its Pmax ~50% when TCO2 increased from ~1,770 to 2,051 μmol TCO2 kg−1. In contrast, Z. marina did not display an increase in Pmax with higher TCO2, possibly due to the variance of photosynthetic rates at saturating irradiance within TCO2 treatments (coefficient of variation: 30–60% relative to the range of TCO2 tested. Our results suggest that Z. japonica can affect the OA mitigation potential of seagrass beds, and its contribution may increase relative to Z. marina as oceanic TCO2 rises. Further, we extended our empirical results to incorporate various biomass to water volume ratios in order to conceptualize how these additional attributes affect changes in carbonate chemistry. Estimates show that the change in TCO2 via photosynthetic carbon uptake as modeled in this study can produce positive diurnal changes in pH and
Institute of Scientific and Technical Information of China (English)
向增旭; 赵维佳; 高山林
2005-01-01
Using gas chromatography (GC), the organochlorine insecticide residues were determined in Lonicera japonica Thunb. flowers. The results showed that the amount of organochlorine insecticide in L. japonica flowers collected from Fengqiu in He' nan Province, Pingyi in Shandong Province was less than 0.01 mg·kg-1. The average recoveries added in samples were 93.54% -98.85%, RSD≤6.8%. It shows that the amount of organochlorine insecticide in L. japonica flowers accords with the demands of traditional Chinese medicine production.
Wang, Xitao; Wang, Lili; Che, Jian; Li, Zhen; Zhang, Jiancheng; Li, Xiaoyu; Hu, Weiqing; Xu, Yongping
2015-07-01
Laminaria japonica feedstuff is used as a substitute for Sargassum thunbergii in the small-scale culturing of Apostichopus japonicus (sea cucumber) because of its abundant sources and low price in China. However, the difficulty associated with the degradation of algin by A. japonicus and, hence, its utilization have limited the practical value of L. japonica feedstuff in sea cucumber farming. In this study, A. japonicus individuals were fed with L. japonica feedstuff pretreated, via fermentation with the algin-degrading bacterial strain, Bacillus amyloliquefaciens WB1, and their growth performance, nonspecific immune responses, and resistance against Vibrio infection were then determined over a 60-day period. Growth performance of these individuals was similar to those fed with a commercial feedstuff made from S. thunbergii (mean weight gain of 5.79 versus 5.69 g on day 60), but was significantly (P content had been degraded by B. amyloliquefaciens WB1 could improve the growth performance of A. japonicus as well its resistance to bacterial infection. It could therefore act as an alternative to S. thunbergii and is economical at the same time.
Japanese beetle Popillia japonica Newman : foliar feeding on wine grapes in Virginia
Boucher, T. Jude
1986-01-01
The natural infestation level for 1985 of the Japanese beetle, Popillia japonica Newman, in the Shenandoah Valley of Virginia failed to reduce berry quality, yield or shoot growth in a commercial vineyard. Intensive postveraison foliage feeding by Japanese beetle resulted 1n fruit with lower soluble solids and higher total titratable acidity at harvest, but did not affect pH, sugar per berry, berry weight, yield, leaves per vine or shoot length. Intensive previraison feeding a...
Seagrasses can colonize unstructured mudflats either through clonal growth or seed germination and survival. Zostera japonica is an introduced seagrass in North America that has rapidly colonized mudflats along the Pacific Coast, leading to active management of the species. Gro...
He, Zhizhou; Chen, Yongshun; Chen, Yongheng; Liu, Haohuai; Yuan, Guanfu; Fan, Yaming; Chen, Kun
2013-09-01
The use of a microwave-assisted extraction (MAE) method for the extraction of phlorotannins from Saccharina japonica Aresch ( S. japonica) has been evaluated with particular emphasis on the influential parameters, including the ethanol concentration, solid/liquid ratio, extraction time, extraction temperature, and microwave power. The MAE procedure was optimized using single-factor design and orthogonal array design (OAD). The content of total phlorotannins in S. japonica was determined using a Folin-Ciocalteu (FC) assay. A maximum total phlorotannin content of 0.644 mg of phloroglucinol equivalent per gram of dry weight plant (mg PGE/g DW) was obtained using the optimized model, which included an ethanol concentration of 55%, solid/liquid ratio of 1:8, extraction time of 25 min, irradiation power of 400 W, and temperature of 60°C. Under similar conditions, the application of a conventional extraction method led to a lower phlorotannin yield of 0.585 mg PGE/g WD. These results demonstrated that the MAE approach provided better results for the extraction of phlorotannins from S. japonica and was a promising technique for the extraction of phenolic compounds from S. japonica and other materials. In addition, screening tests for the inhibitory activity showed that the phlorotannin-containing extracts significantly inhibited the growth of human hepatocellular carcinoma cells (HepG2) by inducing their apoptosis. The morphological changes that occurred during cell apoptosis were characterized using Hoechst33258 staining.
Yun, Kil-Young; Park, Myoung Ryoul; Mohanty, Bijayalaxmi; Herath, Venura; Xu, Fuyu; Mauleon, Ramil; Wijaya, Edward; Bajic, Vladimir B.; Bruskiewich, Richard; de los Reyes, Benildo G
2010-01-01
-plant level analyses established a holistic view of chilling stress response mechanism of japonica rice. Early response regulatory network triggered by oxidative signals is critical for prolonged survival under sub-optimal temperature. Integration of stress
Terazawa, Saori; Uemura, Yuka; Koyama, Yuka; Kawakami, Susumu; Sugimoto, Sachiko; Matsunami, Katsuyoshi; Otsuka, Hideaki; Shinzato, Takakazu; Kawahata, Masatoshi; Yamaguchi, Kentaro
2017-01-01
Microtropins Q-W, (2S,3R)-2-ethyl-2,3-dihydroxybutyrate of various glucosides and glucose, as well as three ent-labdane diterpenoid glucosides, named microtropiosides G, H and I, an ursane-type triterpene diglucoside and a flavonoid glycoside were isolated from the MeOH extract of the leaves of Microtropis japonica. The structure of microtropioside A, also isolated from the branches of M. japonica, was elucidated spectroscopically in a previous experiment and was found to possess a rare seven-membered oxyrane ring. Its structure was confirmed by X-ray crystallographic analysis of its pentaacetate.
Antiatherogenic Effect of Camellia japonica Fruit Extract in High Fat Diet-Fed Rats
Directory of Open Access Journals (Sweden)
Hyun-Ho Lee
2016-01-01
Full Text Available Hypercholesterolemia is a well-known etiological factor for cardiovascular disease and a common symptom of most types of metabolic disorders. Camellia japonica is a traditional garden plant, and its flower and seed have been used as a base oil of traditional cosmetics in East Asia. The present study was carried out to evaluate the effect of C. japonica fruit extracts (CJF in a high fat diet- (HFD- induced hypercholesterolemic rat model. CJF was administered orally at three different doses: 100, 400, and 800 mg·kg−1·day−1 (CJF 100, 400, and 800, resp.. Our results showed that CJF possessed strong cholesterol-lowering potency as indicated by the decrease in serum total cholesterol (TC, triglyceride (TG, and low-density lipoprotein (LDL, accompanied by an increase in serum high-density lipoprotein (HDL. Furthermore, CJF reduced serum lipid peroxidation by suppressing the formation of thiobarbituric acid reactive substance. In addition, oil red O (ORO staining of rat arteries showed decreased lipid-positive staining in the CJF-treated groups compared to the control HFD group. Taken together, these results suggest that CJF could be a potent herbal therapeutic option and source of a functional food for the prevention and treatment of atherosclerosis and other diseases associated with hypercholesterolemia.
Energy Technology Data Exchange (ETDEWEB)
Liu Zhouli [Institute of Applied Ecology, Chinese Academy of Sciences, 72 Wenhua Road, Shenhe District, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Jia 19 Yuquan Road, Beijing 100039 (China); He Xingyuan, E-mail: hexy@iae.ac.cn [Institute of Applied Ecology, Chinese Academy of Sciences, 72 Wenhua Road, Shenhe District, Shenyang 110016 (China); Chen Wei; Yuan Fenghui [Institute of Applied Ecology, Chinese Academy of Sciences, 72 Wenhua Road, Shenhe District, Shenyang 110016 (China); Yan Kun [Institute of Applied Ecology, Chinese Academy of Sciences, 72 Wenhua Road, Shenhe District, Shenyang 110016 (China); Graduate School, Chinese Academy of Sciences, Jia 19 Yuquan Road, Beijing 100039 (China); Tao Dali [Institute of Applied Ecology, Chinese Academy of Sciences, 72 Wenhua Road, Shenhe District, Shenyang 110016 (China)
2009-09-30
Phytoremediation using hyperaccumulators is a promising technique of removing soil pollutants. In the study, growth responses, cadmium (Cd) accumulation capability and physiological mechanisms of Lonicera japonica Thunb. under Cd stress were investigated. Exposed to 5 and 10 mg L{sup -1} Cd, the plants did not show any visual symptoms, furthermore, the height, dry biomass of leaves, roots and total and the chlorophyll (CHL) content were obtained different grade increase. When the concentration of Cd was up to 50 mg L{sup -1}, the height, dry biomass of leaves and roots had not significant differences compared with the control. The indexes of tolerance (IT) were all above 0.8. The maintenance of high superoxide dismutase (SOD) and catalase (CAT) activities was observed along with the increased Cd concentration, suggesting strong internal detoxification mechanisms inside plant cells. After 21 days exposure to 25 mg L{sup -1} Cd, stem and shoot Cd concentrations reached 344.49 {+-} 0.71 and 286.12 {+-} 9.38 {mu}g g{sup -1} DW, respectively and the plant had higher bioaccumulation coefficient (BC) and translocation factor (TF). According to these results, it was shown L. japonica had strong tolerance and accumulation capability to Cd, therefore it is a potential Cd-hyperaccumulator.
Distribution and metabolism of galactitol in Euonymus japonica L
International Nuclear Information System (INIS)
Boersig, M.R.; Negm, F.B.
1987-01-01
Metabolism of [ 14 C]-galactitol was studied in immature and mature leaves of Euonymus japonica L. The highest rates of galactitol metabolism occurred in young expanding leaves. After a 12 h incubation in [ 14 C]-galactitol, the proportions of label remaining in galactitol were 82 and 96% in immature and mature tissues, respectively. A NAD dependent galactitol dehydrogenase reaction was demonstrated in extracts from immature leaves. The product of this reaction was the aldose sugar, galactose. Label from [ 14 C]-galactitol was detected in two unidentified carbohydrates as well as in sucrose, glucose, fructose and galactose. When incubated with [ 14 C]-galactose, immature and mature leaf strips, respectively, accumulated 1 and 22% of the label in the form of galactitol
Zhao, Yueran; Dou, Deqiang; Guo, Yueqiu; Qi, Yue; Li, Jun; Jia, Dong
2018-06-01
Thirteen trace elements and active constituents of 40 batches of Lonicera japonica flos and Lonicera flos were comparatively studied using inductively coupled plasma mass-spectrometry (ICP-MS) and high-performance liquid chromatography-photodiode array (HPLC-PDA). The trace elements were 24 Mg, 52 Cr, 55 Mn, 57 Fe, 60 Ni, 63 Cu, 66 Zn, 75 As, 82 Se, 98 Mo, 114 Cd, 202 Hg, and 208 Pb, and the active compounds were chlorogenic acid, 3,5-O-dicaffeoylquinc acid, 4,5-O-dicaffeoylquinc acid, luteolin-7-O-glucoside, and 4-O-caffeoylquinic acid. The data of 18 variables were statistically processed using principal component analysis (PCA) and discriminate analysis (DA) to classify L. japonica flos and L. flos. The validated method was developed to divide the 40 samples into two groups based on the PCA in terms of 18 variables. Furthermore, the species of Lonicera was better discriminated by using DA with 12 variables. These results suggest that the method and statistical analysis of the contents of trace elements and chemical components can classify the L. japonica flos and L. flos using 12 variables, such as 3,5-O-dicaffeoylquincacid, luteolin-7-O-glucoside, Cd, Mn, Hg, Pb, Ni, 4-O-caffeoyl-quinic acid, 4,5-O-dicaffeoylquinc acid, Fe, Mg, and Cr.
Yan, Feiwei; Hao, Haitao
2016-12-01
Polysaccharides are the major active ingredients responsible for the bioactivities of Laminaria japonica. However, the effects of L. japonica polysaccharides (LJP) on exercise endurance and oxidative stress have never been investigated. Therefore, this study was conducted to investigate the effects of LJP on exercise endurance and oxidative stress in a forced swimming mouse model. The animals were divided into four groups, namely the control (C), LJP-75, LJP-150, and LJP-300 groups, which received physiological saline and 75, 150, and 300 mg kg(-1) LJP, respectively, by gavage once a day for 28 days. This was followed by a forced swimming test and measurements of various biochemical parameters. LJP increased swimming time to exhaustion, the liver and muscle glycogen content, and levels of superoxide dismutase, glutathione peroxidase, and catalase in the serum, liver, and muscle, which were accompanied by corresponding decreases in the malondialdehyde (MDA) content of the same tissues. Furthermore, decreases in blood lactic acid and serum myeloperoxidase (MPO) levels were observed. LJP enhanced exercise endurance and protected mice against exhaustive exercise-induced oxidative stress.
Kim, Jong-Hyeob; Kim, Seung Hyeon; Kim, Young Kyun; Lee, Kun-Seop
2016-12-01
Seagrasses require a large amount of nutrient assimilation to support high levels of production, and thus nutrient limitation for growth often occurs in seagrass habitats. Seagrasses can take up nutrients from both the water column and sediments. However, since seagrasses inhabiting in the intertidal zones are exposed to the air during low tide, the intertidal species may exhibit significantly different carbon (C) and nitrogen (N) dynamics compared to the subtidal species. To examine C and N dynamics of the intertidal seagrass, Zostera japonica, C and N content and stable isotope ratios of above- and below-ground tissues were measured monthly at the three intertidal zones in Koje Bay on the southern coast of Korea. The C and N content and stable isotope (δ13C and δ15N) ratios of seagrass tissues exhibited significant seasonal variations. Both leaf and rhizome C content were not significantly correlated with productivity. Leaf δ13C values usually exhibited negative correlations with leaf productivity. These results of tissue C content and δ13C values suggest that photosynthesis of Z. japonica in the study site was not limited by inorganic C supply, and sufficient inorganic C was provided from the atmosphere. The tissue N content usually exhibited negative correlations with leaf productivity except at the upper intertidal zone, suggesting that Z. japonica growth was probably limited by N availability during high growing season. In the upper intertidal zone, no correlations between leaf productivity and tissue elemental content and stable isotope ratios were observed due to the severely suppressed growth caused by strong desiccation stress.
Directory of Open Access Journals (Sweden)
Chun-jun Chu
2014-01-01
Full Text Available Rabdosia japonica var. glaucocalyx (Maxim. Hara, belonging to the Labiatae family, is widely used as an anti-inflammatory and antitumor drug for the treatment of different inflammations and cancers. Aim of the Study. To investigate therapeutic effects and possible mechanism of the flavonoids fraction of Rabdosia japonica var. glaucocalyx (Maxim. Hara (RJFs in acute lung injury (ALI mice induced by lipopolysaccharide (LPS. Materials and Methods. Mice were orally administrated with RJFs (6.4, 12.8, and 25.6 mg/kg per day for 7 days, consecutively, before LPS challenge. Lung specimens and the bronchoalveolar lavage fluid (BALF were isolated for histopathological examinations and biochemical analysis. The level of complement 3 (C3 in serum was quantified by a sandwich ELISA kit. Results. RJFs significantly attenuated LPS-induced ALI via reducing productions of the level of inflammatory mediators (TNF-α, IL-6, and IL-1β, and significantly reduced complement deposition with decreasing the level of C3 in serum, which was exhibited together with the lowered myeloperoxidase (MPO activity and nitric oxide (NO and protein concentration in BALF. Conclusions. RJFs significantly attenuate LPS-induced ALI via reducing productions of proinflammatory mediators, decreasing the level of complement, and reducing radicals.
Development of microsatellite markers from loquat, Eriobotrya japonica (Thunb.) Lindl.
Gisbert, A D; Lopez-Capuz, I; Soriano, J M; Llacer, G; Romero, C; Badenes, M L
2009-05-01
Loquat (Eriobotrya japonica) is a minor fruit which has become an interesting alternative into the European fruit industry. This interest resulted in a loquat germplasm collection established at the Instituto Valenciano de Investigaciones Agrarias, Valencia, Spain. Currently, it is the main reservoir of this species outside Asia. We developed and characterized the first 21 polymorphic microsatellite loci from a CT/AG-enriched loquat genomic library. The observed heterozygosity ranged between 0.20 and 1.00, expected heterozygosity ranged between 0.17 and 0.81, three markers were multilocus and eight loci departed significantly from Hardy-Weinberg equilibrium. These markers will facilitate diversity and genetic studies into the species. © 2009 The Authors. Journal compilation © 2009 Blackwell Publishing Ltd.
Two neutral alleles of improving male gamete abortion in indica-japonica hybrid rice
Institute of Scientific and Technical Information of China (English)
无
2000-01-01
@@It was difficult to use the pronounced heterosis of indica-japonica hybrids rice due to the panicle sterility caused by male and female gamete abortion. The female gamete abortion in most of subspecific hybrids could be solved by using an abortion-neutral gene S5-n, a wide compatibility gene. The problem of male gamete abortion indicated by distorted segregation of marker genes remained to be studied. Segregation distortion via male gamete had been reported on chromosomes 3, 7, 8, 11, and 12.
Induction of mutation with gamma irradiation in camellia (Camellia Japonica L.)
International Nuclear Information System (INIS)
Zhou Diying; Shen Shoujiang; Wang Yanjun
1990-01-01
Studies on the radiosensitivity and mutagenic effects in Camellia (Camellia Japonica L.) were carried out with the shoot cuttings, one-year seedlings and three or four-year plants irradiated with 60 Co-γ rays. Results obtained showed that the radiosensitivities varied greatly in cultivars and in different parts of the plant. The suitable irradiation doses for shoot cuttings are 1-3 krad. The treatment of low doses (bellow 2 kard) resulted in higher frequency of mutation with plants of high sensitivity to γ-rays. The frequencies of mutation in flower color and type were 2.5-12.0%. The mutant with ornamental value has been obtained
The non-indigenous seagrass Zostera japonica Ascher. & Graeb. (dwarf eelgrass) was first identified in central Oregon (USA) estuaries about 30 years ago. The autecology of this species is poorly described at the southern end of its non-native range although several process orien...
International Nuclear Information System (INIS)
Katayama, Y.; Aoki, T.; Ko, S.; Yoshida, K.
2000-01-01
Distribution profiles of Sr and Ca occurring naturally in the stem of a Japanese cedar (Cryptomeria japonica D. Don) were determined using PIXE. The average concentration of Sr was around 7.5 ppm and the average Ca concentration was about 540 ppm. (author)
Directory of Open Access Journals (Sweden)
Fengxia Liu
Full Text Available Rice is a very important food staple that feeds more than half the world's population. Two major Asian cultivated rice (Oryza sativa L. subspecies, japonica and indica, show significant phenotypic variation in their stress responses. However, the molecular mechanisms underlying this phenotypic variation are still largely unknown. A common link among different stresses is that they produce an oxidative burst and result in an increase of reactive oxygen species (ROS. In this study, methyl viologen (MV as a ROS agent was applied to investigate the rice oxidative stress response. We observed that 93-11 (indica seedlings exhibited leaf senescence with severe lesions under MV treatment compared to Nipponbare (japonica. Whole-genome microarray experiments were conducted, and 1,062 probe sets were identified with gene expression level polymorphisms between the two rice cultivars in addition to differential expression under MV treatment, which were assigned as Core Intersectional Probesets (CIPs. These CIPs were analyzed by gene ontology (GO and highlighted with enrichment GO terms related to toxin and oxidative stress responses as well as other responses. These GO term-enriched genes of the CIPs include glutathine S-transferases (GSTs, P450, plant defense genes, and secondary metabolism related genes such as chalcone synthase (CHS. Further insertion/deletion (InDel and regulatory element analyses for these identified CIPs suggested that there may be some eQTL hotspots related to oxidative stress in the rice genome, such as GST genes encoded on chromosome 10. In addition, we identified a group of marker genes individuating the japonica and indica subspecies. In summary, we developed a new strategy combining biological experiments and data mining to study the possible molecular mechanism of phenotypic variation during oxidative stress between Nipponbare and 93-11. This study will aid in the analysis of the molecular basis of quantitative traits.
Zhang, Q.; Xiang, J.; Zhang, L.; Zhu, X.; Evers, J.B.; Werf, van der W.; Duan, L.
2014-01-01
Germinated brown rice is a well-known functional food due to its high content of gamma-aminobutyric acid (GABA). This study was designed to test the difference of producing GABA in two domesticated rice genotypes (indica and japonica rice), and the effects of adding exogenous glutamic acid or
Siahaan, Evi Amelia; Pendleton, Phillip; Woo, Hee-Chul; Chun, Byung-Soo
2014-01-01
The edible, brown seaweed Saccharina japonica was prepared as powder in the size range 500-900 μm for the desorption release of allyl isothiocyanate (AITC). Powders were used as raw (containing lipids) and as de-oiled, where the lipid was removed. In general, de-oiled powders adsorbed larger masses of AITC after vapour or solution contact. Mass adsorbed due to solution contact exceeded vapour contact. Larger particles adsorbed more than smaller particles. No chemical bonding between AITC and the powder surface occurred. Release from vapour deposited particles reached 70-85% available within 72 h; solution deposited reached 70-90% available at 192 h. The larger amounts of AITC adsorbed via solution deposition resulted in greater vapour-phase concentrations at 72 h for antimicrobial activity studies. No loss of activity was detected against Escherichia coli, Salmonella Typhimurium or Bacillus cereus. Only a nominal activity against Staphylococcus aureus was demonstrated. S. japonica powder could be used as an edible, natural vehicle for AITC delivery. Copyright © 2013 Elsevier Ltd. All rights reserved.
Distribution of Tributyltin in Tissues of Mature Japanese Whiting, Sillago japonica and Their Eggs
Shimasaki, Yohei; Oshima, Yuji; Inoue, Yoshiyuki; Shibata, Hisashi; Nakayama, Kei; Inoue, Suguru; Imoto, Hisaya; Kang, Ik Joon; Honjo, Tsuneo
2008-01-01
Tributyltin (TBT) has continued to pollute the coastal areas therein following global regulation for its use as an anti-fouling agent. The tissue dynamics of TBT in fish have been extensively documented, but few studies on maternal transfer of TBT have been performed. Previously, we reported that TBT was maternally transferred from parent fish to eggs. The present study examined the distribution of TBT in the tissues and spawned eggs of Japanese whiting, Sillago japonica, after dietary exp...
The breeding of Japonica Yanjing 10 rice mutant induced by space mutation
International Nuclear Information System (INIS)
Wang Jianhua; Chen Xiulan; Zhang Rong; Wang Jinrong; Liu Jian; Jiao Juan; He Zhentian; Wang Lin
2011-01-01
The dry seed of mid-maturing Japonica rice Yanjing 10 was used for space mutation breeding which was carried by a satellite for 15 days in 2006. Through three generations of breeding, a group of mutants were obtained. In the article, we reported in detail the breeding procedures, proposed the breeding technical method for space mutation for rice improvement. Planting multiple seedlings per hill to prohibit tillering at SP 1 generation, and bulked selection in combination with directional selection at the SP 2 ∼ SP 3 generation were the two key points of the breeding methods. (authors)
Aspects of the Genotype-Environment Interaction at the Japanese Quail (Coturnix-Coturnix Japonica
Directory of Open Access Journals (Sweden)
Teofil Oroian
2010-05-01
Full Text Available We analyzed the problems of genotype-environment interaction at three Coturnix Coturnix Japonica varieties. The environment where the experiment took place is perfect identically for all the activities, to ensure that the observed differences at the followed traits to be strictly attributed to the genotype differences. We analyzed the body weight, eggs weight, eggs large and small diameter, yolk and egg white weight, egg-shell weight. The data were statistically interpreted using the average and dispersal indices estimation, and the significance testing using Student test.
Koyama, Yuka; Matsunami, Katsuyoshi; Otsuka, Hideaki; Shinzato, Takakazu; Takeda, Yoshio
2010-04-01
From a 1-BuOH-soluble fraction of a MeOH extract of the leaves of Microtropis japonica, collected in the Okinawa islands, six ent-labdane glucosides, named microtropiosides A-F, were isolated together with one known acyclic sesquiterpene glucoside. Their structures were elucidated by a combination of spectroscopic analyses, and their absolute configurations determined by application of the beta-D-glucopyranosylation-induced shift-trend rule in (13)C NMR spectroscopy and the modified Mosher's method. Copyright 2010 Elsevier Ltd. All rights reserved.
Abacar, Jose Daniel; Zhao-miao, Lin; Xin-cheng, Zhang; Cheng-qiang, Ding; She, Tang; Zheng-hui, Liu; Shao-hua, Wang; Yan-feng, Ding
2016-01-01
To select elite germplasms, 112 mutants derived from japonica rice cultivar Wuyujing 3 were evaluated. The yield components such as panicle number per square meter, grain number per panicle, and grain weight were measured. The quality traits such as percentage of chalky grains (PCG), brown rice yield (BRY), milled rice yield (MRY), degree of milling (DM), amylose content (AC), protein content (PC), and relationships among traits were inverstigated. Results showed that grain yield ranged from ...
Directory of Open Access Journals (Sweden)
Zhao-Dong Liu
2017-08-01
Full Text Available This work was designed to understand the mechanisms of adsorption of copper (Cu and cadmium (Cd on roots of indica and japonica varieties of rice. Six varieties each of indica and japonica rice were grown in hydroponics and the chemical properties of the root surface were analyzed, including surface charges and functional groups (-COO- groups as measured by the streaming potential and attenuated total reflectance-Fourier transform infrared spectroscopy (ATR-FTIR. Binding forms of heavy metals adsorbed on rice roots were identified using sequential extraction methods. In rice roots exposed to Cu and Cd solutions, Cu existed mainly in both exchangeable and complexed forms, whereas Cd existed mainly in the exchangeable form. The amounts of exchangeable Cu and Cd and total adsorbed metal cations on the roots of indica varieties were significantly greater than those on the roots of japonica varieties, and the higher negative charges and the larger number of functional groups on the roots of indica varieties were responsible for their higher adsorption capacity and greater binding strength for Cu and Cd. Surface charge and functional groups on roots play an important role in the adsorption of Cu and Cd on the rice roots.
Fukuda, N; Kuroki, M; Shinoda, A; Yamada, Y; Okamura, A; Aoyama, J; Tsukamoto, K
2009-06-01
The influences of water temperature and feeding regime on otolith growth in Anguilla japonica glass eels and elvers were investigated using individuals reared at 5, 10, 15, 20, 25 and 30 degrees C and in fed or unfed conditions at salinity 32 after their otoliths were marked with alizarin complexone (ALC). To eliminate the difficulty of observing the edges of otoliths with optical (OM) or scanning electron (SEM) microscopes, three to 10 individuals were sampled from each tank at 10, 20 and 30 days during the experiment and reared for an additional 10 days at 25 degrees C after their otoliths were marked a second time. Otolith growth and the number of increments were measured using both OM and SEM. Most A. japonica commenced feeding after 10 days at 20-30 degrees C or after 20 days at 15 degrees C, but no feeding occurred at 5 and 10 degrees C. No otolith growth occurred at 5 and 10 degrees C except in two individuals with minimal increment deposition at 10 degrees C. Otolith growth was proportional to water temperature within 15-25 degrees C and not different between 25 and 30 degrees C. At 15, 25 and 30 degrees C, the mean otolith growth rate in fed conditions was higher than in unfed conditions. The number of increments per day was significantly different among water temperatures (0.00-0.01 day(-1) at 5 and 10 degrees C, 0.43-0.48 day(-1) at 15 degrees C and 0.94-1.07 day(-1) at 20-30 degrees C). These results indicated that otolith growth in A. japonica glass eels and elvers was affected by temperature and ceased at otoliths of wild-caught A. japonica glass eels and elvers need to carefully consider the water temperatures potentially experienced by the juveniles in the wild.
Lee, Jeong-Ho; Lee, Byung-Kyu; Kim, Jong-Hee; Lee, Sang Hee; Hong, Soon-Kwang
2009-04-01
The chemical compositions, and antibacterial and antifungal effects of essential oils extracted from three coniferous species, Pinus densiflora, Cryptomeria japonica, and Chamaecyparis obtusa, were investigated. Gas chromatography mass analysis of the essential oils revealed that the major components and the percentage of each essential oil were 16.66% beta-phellandrene and 14.85% alpha-pinene in P. densiflora; 31.45% kaur-16-ene and 11.06% sabinene in C. japonica; and 18.75% bicyclo [2, 2, 1] heptan-2-ol and 17.41% 2-carene in Ch. obtusa. The antimicrobial assay by agar disc diffusion method showed that 2.2 microg of Ch. obtusa oil inhibited most effectively the growth of Escherichia coli ATCC 33312 and Klebsiella oxytoca ATCC 10031, whereas the C. japonica oil gave weak antimicrobial activity. The minimal inhibitory concentration (MIC) values for bacterial strains were in the range of 5.45-21.8 mg/ml depending on essential oils, but most Gram-negative bacteria were resistant even at 21.8 mg oil/ml. P. densiflora oil showed the most effective antifungal activity and the MIC values for Cryptococcus neoformans B42419 and Candida glabrata YFCC 062CCM 11658 were as low as 0.545 and 2.18 mg/ml, respectively. Cryp. neoformans B42419 was the most sensitive to all essential oils in the range of 0.545-2.18 mg/ml. Our data clearly showed that the essential oils from the three conifers had effective antimicrobial activity, especially against fungi.
Characteristic features of computed tomography (CT) in hepatic schistosomiasis japonica
Energy Technology Data Exchange (ETDEWEB)
Sakemi, Taisuke; Sakai, Terufumi; Majima, Yasuo [Kurume Univ., Fukuoka (Japan). School of Medicine
1984-06-01
Characteristic finding of CT in the liver of hepatic schistosomiasis japonica were compared with histological changes. The study was made on 7 cases with schistosomatic liver cirrhosis (SLC) and 7 SLC cases with hepatocellular carcinoma (HCC). Characteristic CT findings were high density funicular patterns showing turtle shell appearance (4 cases), high density spotty patterns (3 cases) and both mixed patterns (7 cases). These patterns were not changed by contrast medium study. Funicular and mixed patterns were observed in both lobes of the liver, however, spotty patterns were seen only in the right lobe. It was difficult to distinguish liver tissue surrounded by funicular patterns from HCC lesion. Histopathological study of autopsied livers and CT scanning of thin cut livers revealed that high density funicular patterns represent deposits of calcified schistosomal ova in the fibrous septa.
Dongjiao Liu; Hao Jiang; Robin Zhang; Kate S. He
2011-01-01
The spatial distribution of most invasive plants is poorly documented and studied. This project examined and compared the spatial distribution of a successful invasive plant, Japanese honeysuckle (Lonicera japonica), in two similar-sized but ecologically distinct watersheds in western Kentucky (Ledbetter Creek) and western Tennessee (Panther Creek)....
Boon, P; Visser, GH; Daan, S
2000-01-01
Effect of photoperiod and food duration on body weight gain, energy intake, energy expenditure, and sexual development were investigated in two strains of Japanese quail (Coturnix c. japonica), bred for meat (broilers) or egg production (layers), from 7 to 71 days of age. In a first experiment
Quan, Meirong; Liu, Qi Zhi; Liu, Zhi Long
2018-05-17
The essential oil of Stachys riederi var. japonica (Family: Lamiaceae) was extracted by hydrodistillation and determined by GC and GC-MS. A total of 40 components were identified, representing 96.01% of the total oil composition. The major compounds in the essential oil were acetanisole (15.43%), anisole (9.43%), 1,8-cineole (8.07%), geraniol (7.89%), eugenol (4.54%), caryophyllene oxide (4.47%), caryophyllene (4.21%) and linalool (4.07%). Five active constituents (acetanisole, anisole, 1,8-cineole, eugenol and geraniol) were identified by bioactivity-directed fractionation. The essential oil possessed fumigant toxicity against maize weevils ( Sitophilus zeamais ) and booklice ( Liposcelis bostrychophila ), with LC 50 values of 15.0 mg/L and 0.7 mg/L, respectively. Eugenol and anisole exhibited stronger fumigant toxicity than the oil against booklice. 1,8-Cineole showed stronger toxicity, and anisole as well as eugenol exhibited the same level of fumigant toxicity as the essential oil against maize weevils. The essential oil also exhibited contact toxicity against S. zeamais adults and L. bostrychophila , with LC 50 values of 21.8 µg/adult and 287.0 µg/cm², respectively. The results indicated that the essential oil of S. riederi var. japonica and its isolates show potential as fumigants, and for their contact toxicity against grain storage insects.
Shangguan, Jingbo; Li, Zhongbao
2018-03-01
Thirty-five new microsatellite loci from the sea cucumbers Holothurian scabra (Jaeger, 1833) and Apostichopus japonicas (Selenka, 1867) were screened and characterized using the method of magnetic bead enrichment. Of the twenty-four polymorphic loci tested, eighteen were consistent with Hardy-Weinberg equilibrium after a modified false discovery rate (B-Y FDR) correction, whereas six showed statistically significant deviations (CHS2 and CHS11: Psea cucumbers ( Holothurian scabra, Holothuria leucospilota, Stichopus horrens and Apostichopus japonicas) were tested for mutual cross-amplification using a total of ninety microsatellite loci. Although transferability and universality of all loci were generally low, the results of the cross-species study showed that the markers can be applied to identify individuals to species according to the presence or absence of specific microsatellite alleles. The microsatellite markers reported here will contribute to the study of genetic diversity, assisted breeding, and population conservation in sea cucumbers, as well as allow for the identification of individuals to closely related species.
Fang, Lianxiang; Xiong, Aizhen; Yang, Xiao; Cheng, Wenzhi; Yang, Li; Wang, Zhengtao
2014-08-01
Pyrrolizidine alkaloids are highly hepatotoxic natural chemicals that produce irreversible chronic and acute hepatotoxic effects on human beings. Purification of large amounts of pyrrolizidine alkaloids is necessary for toxicity studies. In this study, an efficient method for targeted analysis and purification of pyrrolizidine alkaloid cis/trans isomers from herbal materials was developed for the first time. Targeted analysis of the hepatotoxic pyrrolizidine alkaloids was performed by liquid chromatography with tandem mass spectrometry (precursor ion scan and daughter ion scan), and the purification of pyrrolizidine alkaloids was achieved with a mass-directed auto purification system. The extraction and preparative liquid chromatography conditions were optimized. The developed method was applied to analysis of Gynura japonica (Thunb.) Juel., a herbal medicine traditionally used for detumescence and relieving pain but is potentially hepatotoxic as it contains pyrrolizidine alkaloids. Twelve pyrrolizidine alkaloids (six cis/trans isomer pairs) were identified with reference compounds or characterized by liquid chromatography with tandem mass spectrometry, and five individual pyrrolizidine alkaloids, including (E)-seneciphylline, seneciphylline, integerrimine, senecionine, and seneciphyllinine, were prepared from G. japonica roots with high efficiency. The results of this work provide a new technique for the preparation of large amounts of pyrrolizidine alkaloid reference substances, which will also benefit toxicological studies of pyrrolizidine alkaloids and treatments for pyrrolizidine alkaloid-induced toxicity. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Measurement of injected Sr in the stem of a Japanese cedar (Cryptomeria japonica D. Don) using PIXE
International Nuclear Information System (INIS)
Katayama, Y.; Aoki, T.; Ko, S.; Yoshida, K.
1999-01-01
Distribution profiles of Sr injected into the stem of a Japanese cedar (Cryptomeria japonica D. Don) were determined using PIXE. The Sr injected into the middle of the sapwood of the cedar stem moved upwards easily along the grain. The Sr in the stem moved in a radial direction in the sapwood section (assumed to be through the ray) and there was almost no tangential movement. (author)
This study addressed the following question: In a coastal estuary of the northeastern Pacific Ocean with a relatively large areal extent of the native eelgrass Zostera marina, is an expanding distribution of the non-indigenous dwarf eelgrass Z. japonica accompanied by a measurab...
Zostera japonica is a non-native seagrass along the Pacific Coast of North America that is distributed from Northern California, USA to British Columbia, Canada. Recent observations indicate that the species is expanding both latitudinally and into areas of lower salinity. Ther...
Emission of floral volatiles from Mahonia japonica (Berberidaceae).
Picone, Joanne M; MacTavish, Hazel S; Clery, Robin A
2002-07-01
Flowering Mahonia japonica plants were subjected to controlled environments and the floral volatiles emitted from whole racemes (laterals) were trapped by Porapak Q adsorbent and analysed by GC-FID. An experiment with photoperiods of 6 and 9 h at constant temperature (10+/-1 degrees C) demonstrated that photoperiod was the stimulus for enhanced emission of most volatiles. Small quantitative differences in emitted fragrance composition were observed between light and dark periods and between plants acclimatised to different photoperiods. Maximum rates of emission occurred in the middle of the light period; aromatic compounds (benzaldehyde, benzyl alcohol and indole) displayed a more rapid increase and subsequent decline compared with monoterpenes (cis- and trans-ocimene and linalool). When the photoperiod was extended from 6 to 9 h, maximum rates of emission continued throughout the additional 3 h. Total emission (microg/h) of volatiles was 2-fold greater in the day-time (DT) (39.7 microg/h) compared with the night-time (NT) (19.8 microgg/h) under a 6 h photoperiod and was not significantly different from total emission under a 9 h photoperiod.
Hasegawa, Eisuke; Yamaguchi, Takeshi
1997-01-01
The effect of slave raiding of Polyergus samurai on nest persistency of its host, Formica (Serviformica) japonica was investigated. Nest persistence rate after the raiding season was not different between raided and unraided nests. Many raided nests stopped aboveground activities for 2-3 weeks after a raiding but surviving workers maintained underground nest structure. These observations suggest that it is required to reconsider the previous interpretation that the raided nests died out from ...
International Nuclear Information System (INIS)
Paukova, Z.; Krskova, L.
2011-01-01
Mapping of one of the most dangerous invasive species Fallopia japonica was conducted at selected locations of northwestern Slovakia: in the cadastral territory of Zazriva, in the village Parnica towards Kralovany, in the village Kralovany and the city of Dolny Kubin - Zaskalie, stretch Timravina in the Lower Orava in late summer and early autumn 2009. We recorded by field survey 24 invading Japanese knotweed in the area of 12.238 m 2 . (authors)
Energy Technology Data Exchange (ETDEWEB)
Rodrigues, Luis Roberto Franco [UNESP, Botucatu, SP (Brazil). Dept. de Genetica; Ando, Akihiko [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil)
2003-07-01
Sixty-five upland rice cultivars (Oryza sativa L.) were evaluated in relation to gamma-ray sensitivity. Seeds were subjected to seven doses of gamma-radiation and sown in wooden boxes in randomised complete block design with three replications. The experiment was conducted in greenhouse during the year of 1992. Physiological effects caused by radiation in the M{sub 1} generation, were evaluated. The results showed that the sensitivity to the radiation at doses 300 and 360 Gy was useful for distinguishing Indican and Japonica groups. (author)
Use of gamma-rays sensitivity for discrimination of upland cultivars of groups Indican and Japonica
International Nuclear Information System (INIS)
Rodrigues, Luis Roberto Franco
2003-01-01
Sixty-five upland rice cultivars (Oryza sativa L.) were evaluated in relation to gamma-ray sensitivity. Seeds were subjected to seven doses of gamma-radiation and sown in wooden boxes in randomised complete block design with three replications. The experiment was conducted in greenhouse during the year of 1992. Physiological effects caused by radiation in the M 1 generation, were evaluated. The results showed that the sensitivity to the radiation at doses 300 and 360 Gy was useful for distinguishing Indican and Japonica groups. (author)
Chen, Ying; Du, Kunze; Li, Jin; Bai, Yun; An, Mingrui; Tan, Zhijing
2018-01-01
A simple cloud point preconcentration method was developed and validated for the determination of gallic acid, bergenin, quercitrin, and embelin in Ardisia japonica by high-performance liquid chromatography (HPLC) using ultrasonic assisted micellar extraction. Nonionic surfactant Genapol X-080 was selected as the extraction solvent. The effects of various experimental conditions such as the type and concentration of surfactant and salt, temperature, and solution pH on the extraction of these components were studied to optimize the conditions of Ardisia japonica. The solution was incubated in a thermostatic water bath at 60°C for 10 min, and 35% NaH2PO4 (w/v) was added to the solution to promote the phase separation and increase the preconcentration factor. The intraday and interday precision (RSD) were both below 5.0% and the limits of detection (LOD) for the analytes were between 10 and 20 ng·mL−1. The proposed method provides a simple, efficient, and organic solvent-free method to analyze gallic acid, bergenin, quercitrin, and embelin for the quality control of Ardisia japonica. PMID:29487621
Directory of Open Access Journals (Sweden)
Ying Chen
2018-01-01
Full Text Available A simple cloud point preconcentration method was developed and validated for the determination of gallic acid, bergenin, quercitrin, and embelin in Ardisia japonica by high-performance liquid chromatography (HPLC using ultrasonic assisted micellar extraction. Nonionic surfactant Genapol X-080 was selected as the extraction solvent. The effects of various experimental conditions such as the type and concentration of surfactant and salt, temperature, and solution pH on the extraction of these components were studied to optimize the conditions of Ardisia japonica. The solution was incubated in a thermostatic water bath at 60°C for 10 min, and 35% NaH2PO4 (w/v was added to the solution to promote the phase separation and increase the preconcentration factor. The intraday and interday precision (RSD were both below 5.0% and the limits of detection (LOD for the analytes were between 10 and 20 ng·mL−1. The proposed method provides a simple, efficient, and organic solvent-free method to analyze gallic acid, bergenin, quercitrin, and embelin for the quality control of Ardisia japonica.
Tuckerella japonica Ehara (Acari: Tetranychoidea: Tuckerellidae) is found where longitudinal splitting occurs on exposed green periderm tissue of shoots on certain varieties or seedling plants of Camellia sinensis (L.) O. Kuntze (Theales: Theaceae) in the continental United States. The mite is able ...
Yun, Yeo-Tae; Chung, Chong-Tae; Lee, Young-Ju; Na, Han-Jung; Lee, Jae-Chul; Lee, Sun-Gye; Lee, Kwang-Won; Yoon, Young-Hwan; Kang, Ju-Won; Lee, Hyun-Sook; Lee, Jong-Yeol; Ahn, Sang-Nag
2016-12-01
Improved eating quality is a major breeding target in japonica rice due to market demand. Consequently, quantitative trait loci (QTL) for glossiness of cooked rice and amylose content associated with eating quality have received much research focus because of their importance in rice quality. In this study, QTL associated with 12 grain quality traits were identified using 96 introgression lines (IL) of rice developed from an interspecific cross between the Korean elite O. sativa japonica cultivar 'Hwaseong' and O. rufipogon over 7 years. QTL analyses indicated that QTL qDTH6 for heading date, detected on chromosome 6 is associated with variance in grain traits. Most QTLs detected in this study clustered near the qDTH6 locus on chromosome 6, suggesting the effect of qDTH6. O. rufipogon alleles negatively affected grain quality traits except for a few QTLs, including qGCR9 for glossiness of cooked rice on chromosome 9. To characterize the effect of the O. rufipogon locus harboring qGCR9, four lines with a single but different O. rufipogon segment near qGCR9 were compared to Hwaseong. Three lines (O. rufipopgon ILs) having O. rufipogon segment between RM242 and RM245 in common showed higher glossiness of cooked rice than Hwaseong and the other line (Hwaseong IL), indicating that qGCR9 is located in the 3.4-Mb region between RM242 and RM245. Higher glossiness of cooked rice conferred by the O. rufipogon allele might be associated with protein content considering that three lines had lower protein content than Hwaseong (P < 0.1). These three O. rufipogon ILs showed higher yield than Hwaseong and Hwaseong IL due to increase in spikelets per panicle and grain weight indicating the linkage of qGCR9 and yield component QTLs. The qGCR9 locus is of particular interest because of its independence from other undesirable grain quality traits in O. rufipogon. SSR markers linked to qGCR9 can be used to develop high-quality japonica lines and offer a starting point for map
Alnuheptanoid B: A new Cyclic Diarylheptanoid from Alnus japonica Stem Bark
Directory of Open Access Journals (Sweden)
Sabrin R.M. Ibrahim
2016-05-01
Full Text Available A new cyclic diarylheptanoid namely alnuheptanoid B (3, along with four known cyclic diarylheptanoids: myricanone (1, (+-S-myricanol (2, myricanone 5-O- b -D-glucopyranoside (4, and (+-S-myricanol 5-O- b -D-glucopyranoside (5 were isolated from Alnus japonica Steud (Betulaceae stem bark. Their structures were determined by spectroscopic analyses, including UV, IR, 1D ( 1H and 13C, 2D (COSY, HMQC, and HMBC, and HRESIMS, as well as optical rotation measurement. Compounds 1, 2, 4, and 5 are reported for the first time from the plant. All isolated compounds 1-5 were tested for their antioxidant and anti-inflammatory activities using DPPH assay and carrageenin induced rat paw edema model, respectively. They displayed significant antioxidant activity in relation to propyl gallate (positive control. Compound 2 demonstrated anti-inflammatory effect at a dose 10 mg/kg.
Short-term toxicity of polystryrene microplastics on mysid shrimps Neomysis japonica
Wang, Mingxin; Wang, Xiao; Luo, Xianxiang; Zheng, Hao
2017-04-01
Plastic debris especially microplastics (MPs) have become a global concern for the aggravating pollution in the oceans. In this study, the physico-chemical properties of fluorescently labeled polystyrene (PS) beads and the effects of PS-MPs on the survival of mysid shrimps (Neomysis japonica) were investigated. PS-MPs were identified to have spherical shape, uniform size and stable green fluorescence. The results showed that PS beads had little effects on the mortality of shrimps under a short-term (72 h) exposure with concentrations of 50 μg L-1 and 500 μg L-1. However, PS-MPs had severe short-term toxicity on the survival of mysid shrimps, resulting in 30% mortality especially in a 72 h exposure with the higher concentration of 1000 μg L-1. These findings provide new insights into the toxic effects of MPs on marine invertebrates.
Hu, Wen; Guo, Ting; Jiang, Wen-Jun; Dong, Guang-Li; Chen, Da-Wei; Yang, Shi-Lin; Li, He-Ran
2015-06-01
The present study was designed to establish and optimize a new method for extracting chlorogenic acid and cynaroside from Lonicera japonica Thunb. through orthogonal experimental designl. A new ultrahigh pressure extraction (UPE) technology was applied to extract chlorogenic acid and cynaroside from L. japonica. The influential factors, including solvent type, ethanol concentration, extraction pressure, time, and temperature, and the solid/liquid ratio, have been studied to optimize the extraction process. The optimal conditions for the UPE were developed by quantitative analysis of the extraction products by HPLC-DAD in comparison with standard samples. In addition, the microstructures of the medicinal materials before and after extraction were studied by scanning electron microscopy (SEM). Furthermore, the extraction efficiency of different extraction methods and the 2, 2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activities of the extracts were investigated. The optimal conditions for extracting chlorogenic acid and cynaroside were as follows: ethanol concentration, 60%; extraction pressure, 400 MPa; extraction time, 2 min; extraction temperature, 30 °C; and the solid/liquid ratio, 1 : 50. Under these conditions, the yields of chlorogenic acid and cynaroside were raised to 4.863% and 0.080%, respectively. Compared with other extraction methods, such as heat reflux extraction (HRE), ultrasonic extraction (UE), and Sohxlet extraction (SE), the UPE method showed several advantages, including higher extraction yield, shorter extraction time, lower energy consumption, and higher purity of the extracts. This study could help better utilize L. japonica flower buds as a readily accessible source of natural antioxidants in food and pharmaceutical industries. Copyright © 2015 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.
Wound repair and anti-inflammatory potential of Lonicera japonica in excision wound-induced rats.
Chen, Wei-Cheng; Liou, Shorong-Shii; Tzeng, Thing-Fong; Lee, Shiow-Ling; Liu, I-Min
2012-11-23
Lonicera japonica Thunb. (Caprifoliaceae), a widely used traditional Chinese medicinal plant, is used to treat some infectious diseases and it may have uses as a healthy food and applications in cosmetics and as an ornamental groundcover. The ethanol extract of the flowering aerial parts of L. japonica (LJEE) was investigated for its healing efficiency in a rat excision wound model. Excision wounds were inflicted upon three groups of eight rats each. Healing was assessed by the rate of wound contraction in skin wound sites in rats treated with simple ointment base, 10% (w/w) LJEE ointment, or the reference standard drug, 0.2% (w/w) nitrofurazone ointment. The effects of LJEE on the contents of hydroxyproline and hexosamine during healing were estimated. The antimicrobial activity of LJEE against microorganisms was also assessed. The in vivo anti-inflammatory activity of LJEE was investigated to understand the mechanism of wound healing. LJEE exhibited significant antimicrobial activity against Staphylococcus aureus, Staphylococcus epidermidis, Escherichia coli, Candida albicans, and Candida tropicalis. The ointment formulation prepared with 10% (w/w) LJEE exhibited potent wound healing capacity as evidenced by the wound contraction in the excision wound model. The contents of hydroxyproline and hexosamine also correlated with the observed healing pattern. These findings were supported by the histopathological characteristics of healed wound sections, as greater tissue regeneration, more fibroblasts, and angiogenesis were observed in the 10% (w/w) LJEE ointment-treated group. The results also indicated that LJEE possesses potent anti-inflammatory activity, as it enhanced the production of anti-inflammatory cytokines that suppress proinflammatory cytokine production. The results suggest that the antimicrobial and anti-inflammatory activities of LJEE act synergistically to accelerate wound repair.
Directory of Open Access Journals (Sweden)
Majerus Michael EN
2010-02-01
Full Text Available Abstract Background Endosymbionts that manipulate the reproduction of their hosts have been reported widely in invertebrates. One such group of endosymbionts is the male-killers. To date all male-killers reported are bacterial in nature, but comprise a diverse group. Ladybirds have been described as a model system for the study of male-killing, which has been reported in multiple species from widespread geographic locations. Whilst criteria of low egg hatch-rate and female-biased progenic sex ratio have been used to identify female hosts of male-killers, variation in vertical transmission efficiency and host genetic factors may result in variation in these phenotypic indicators of male-killer presence. Molecular identification of bacteria and screening for bacterial presence provide us with a more accurate method than breeding data alone to link the presence of the bacteria to the male-killing phenotype. In addition, by identifying the bacteria responsible we may find evidence for horizontal transfer between endosymbiont hosts and can gain insight into the evolutionary origins of male-killing. Phylogenetic placement of male-killing bacteria will allow us to address the question of whether male-killing is a potential strategy for only some, or all, maternally inherited bacteria. Together, phenotypic and molecular characterisation of male-killers will allow a deeper insight into the interactions between host and endosymbiont, which ultimately may lead to an understanding of how male-killers identify and kill male-hosts. Results A male-killer was detected in the Japanese coccinellid, Propylea japonica (Thunberg a species not previously known to harbour male-killers. Families produced by female P. japonica showed significantly female-biased sex ratios. One female produced only daughters. This male-killer trait was maternally inherited and antibiotic treatment produced a full, heritable cure. Molecular analysis identified Rickettsia to be associated
Directory of Open Access Journals (Sweden)
Božin Biljana
2017-01-01
Full Text Available Reynoutria japonica is on the IUCN list of the Worlds’100 worst invasive species, but it is also, especially its rhizome, an integral part of traditional chinese medicine. The objective of this study was to determine the amount of selected phenolic compounds in rhizome, stems, leaves and inflorescence methanol extracts of this plant, their antioxidant and anticholinesterase activity. The chemical profile of the examined extracts was obtained by a high-performance liquid chromatography. In vitro assays on DPPH, OH and NO radicals were used to estimate antioxidant potential and Ellman’s method was applied for the determination of anticholinesterase activity. Leaves and rhizome extracts were found to be rich in rosmarinic and chlorogenic acid, and selected flavonoids. Resveratrol was exclusively present in rhizome and stems extracts. All the investigated extracts expressed certain antioxidant activity, where leaves extract was the most active. However, rhizome extract was the strongest inhibitor of acetylcholinesterase. These findings indicate that there is a possibility of R. japonica exploitation for the isolation of biologically active phenolic compounds used in pharmaceutical and food industry.
Nainggolan, Frans H
2011-01-01
Frans H Nainggolan, 2008. Utilization of fermented tree tomato (Cyphomandra betacea) skin fruit flour to to performance of Quail (Coturnix-coturnix japonica). Under suvervision of Dr. Ir. Ristika Handarini, MP and Ir. Eniza Saleh, MS. The research caried out in Biological Labolatory, Department of Animal Husbandry, Faculty of Agriculture, North Sumatera University, started from 5 July 2007 until 16 August 2007. The purpose of this experiment was to observe the respon of utilization of ...
Directory of Open Access Journals (Sweden)
Hiroshi IKEHASHI
2009-03-01
Full Text Available On the bases of archaeological discoveries, the earliest domestication of rice has been confirmed in the middle and lower Changjiang River basin, while in the region wild rice populations are found in shallow swamps under a climate with freezing winter cold. These findings lead us re-examine the past ideas about domestication and differentiation of rice. Historically, in 1930s two sub-species, indica and japonica, were proposed on the basis of sterility in F1 hybrids between them. Soon after that, the two types were classified by the associations of a number of genetically independent traits. The characteristic associations of traits have been explained by the hybrid sterility or reproductive barriers which were assumed to comprise a set of duplicate recessive lethal genes and to be an inner genetic mechanism to lead to the varietal differentiations. In 1980s, the hybrid sterility between Indica and Japonica types was analyzed, and Indica, Japonica, and wide-compatibility type which gives fertile hybrids when cross to Indica and Japonica types, are proved to contain an allele, S5i, S5j and S5n, respectively at a locus on chromosome 6. And those gametes having S5j allele are found to be partially aborted in the hybrid genotypes of S5i/S5j while no gamete abortion occurs in S5i/S5n and S5j/S5n genotypes. Since then, the gene S5n has been used in hybrid rice breeding to obtain fertile and vigorous hybrids between subspecies, and the long-disputed problem of hybrid sterility has been solved. Also in such studies the characteristic association of traits found in each of varietal groups is better explained by founder effects. On the other hand, a large number of native cultivars of rice were surveyed with enzyme polymorphism in 1980s and later with molecular markers. As a result, profound genetic diversity is found in cultivated rice as well as in wild rice. These findings seem to lead us to the idea of multiple independent domestications of rice
Rice blast is a recurring and devastating disease in the USA and worldwide. In the USA, the blast-resistance (R) genes found in a tropical japonica cultivar, Katy, reduce blast damages from 1990 to present. The cultivar is still used as a principal donor of blast R genes in developing numerous elit...
Kang, Jin Woo; Chung, Ik Kyo
2018-04-01
Environmental challenges such as ocean acidification and eutrophication influence the physiology of kelp species. We investigated their interactive effects on Saccharina japonica (Laminariales, Phaeophyta) under two pH conditions [Low, 7.50; High (control), 8.10] and three NH4 +concentrations (Low, 4; Medium, 60; High, 120 μM). The degree of variation of pH values in the culture medium and inhibition rate of photosynthetic oxygen evolution by acetazolamide were affected by pH treatments. Relative growth rates, carbon, nitrogen, and the C:N ratio in tissue samples were influenced by higher concentrations of NH4 + . Rates of photosynthetic oxygen evolution were enhanced under elevated CO2 or NH4 +conditions, independently, but these two factors did not show an interactive effect. However, rates of NH4 +uptake were influenced by the interactive effect of increased CO2 under elevated NH4 +treatment. Although ocean acidification and eutrophication states had an impact on physiological performance, chlorophyll fluorescence was not affected by those conditions. Our results indicated that the physiological reactions by this alga were influenced to some extent by a rise in the levels of CO2 and NH4 + . Therefore, we expect that the biomass accumulation of S. japonica may well increase under future scenarios of ocean acidification and eutrophication.
Directory of Open Access Journals (Sweden)
Xiao-biao ZHU
2008-12-01
Full Text Available Distributions of pubescences on leaf blade and hull in japonica rice were observed under an optical microscope. Numbers of leaf and hull pubescences in P1, P2, F1, B1, B2 and F2 generations were investigated in three combinations of japonica rice (Sidao 10A/Wuyujing 3R, Wuyujing 3A/Sidao 10R and Liuyan 189A/HR-122, and genetic analysis for these two traits were conducted by using the joint analysis method of P1, P2, F1, B1, B2 and F2 generations with the mixed major gene plus polygene inheritance models. Leaf pubescences characterized by swollen base and fine tip distributed regularly on the boundary between dark green stripe and light green stripe of leaf blade. Hull pubescences with various lengths distributed irregularly on the whole hull. Numbers of leaf pubescences in the reciprocal combinations of Sidao 10A/Wuyujing 3R and Wuyujing 3A/Sidao 10R and numbers of hull pubescences in all the three combinations were controlled by one pair of additive major genes plus additive-dominant polygenes. In the combination of Liuyan 189A/HR-122, number of leaf pubescences was controlled by one pair of additive-dominant major genes plus additive-dominant polygenes. Both numbers of leaf and hull pubescences were mainly governed by major genes.
Directory of Open Access Journals (Sweden)
Jose Daniel Abacar
2016-01-01
Full Text Available To select elite germplasms, 112 mutants derived from japonica rice cultivar Wuyujing 3 were evaluated. The yield components such as panicle number per square meter, grain number per panicle, and grain weight were measured. The quality traits such as percentage of chalky grains (PCG, brown rice yield (BRY, milled rice yield (MRY, degree of milling (DM, amylose content (AC, protein content (PC, and relationships among traits were inverstigated. Results showed that grain yield ranged from 2.15 to 12.49 t/hm2 with a mean of 6.4 t/hm2 and number of grains per square meter contributed for 94.64% in grain yield variation. For quality traits, all rice mutants had short size (grain length ≤ 5.5 mm and bold shape (grain length to width ratio = 1.10–2.00. Most of rice mutants (87.5% had PCG values below 20%. All mutants had MRY values above 50%, AC values below 20%, and PC values below 10%. Percentage of chalky grains was significantly negatively correlated with MRY and positively correlated with DM. BRY and MRY were significantly negatively correlated with DM. PC was significantly and positively correlated with MRY and negatively correlated with DM, while AC had no significant correlation with these quality traits. It was concluded that there were 25 rice mutants which fulfilled the major requirements of Jiangsu standard japonica rice such as low percentage of chalky grains, low amylose content, optimal protein content, and which could be used as elite germplasms. Thus the mutants identified may lead to significant progress in improvement of rice quality.
Growth modeling of Cryptomeria japonica by partial trunk analysis
Directory of Open Access Journals (Sweden)
Vinícius Morais Coutinho
2017-06-01
Full Text Available This study aimed to evaluate the growth pattern of Cryptomeria japonica increment (L. F. D. Don. and to describe the probability distribution in stands stablished at the municipality of Rio Negro, Paraná State. Twenty trees were sampled in a 34 years-old stand, with 3 m x 2 m spacing. Wood disks were taken from each tree at 1.3 m above the ground (DBH to perform partial stem analysis. Diameter growth series without bark were used to generate the average cumulative growth curves for DBH (cm, mean annual increment (MAI and current annual increment (CAI. From the increment data, the frequency distribution was evaluated by means of probability density functions (pdfs. The mean annual increment for DBH was 0.78 cm year-1 and the age of intersection of CAI and MAI curves was between the 7th and 8th years. It was found that near 43% of the species increments are concentrated bellow 0.5 cm. The results are useful to define appropriate management strategies for the species for sites similar to the studying regions, defining for example ages of silvicultural intervention, such as thinning.
Yang, Jingwen; Xu, Yuchao; Xu, Ke; Ping, Hongling; Shi, Huilai; Lü, Zhenming; Wu, Changwen; Wang, Tianming
2017-08-01
Neuropeptide Y (NPY) has a pivotal role in the regulation of many physiological processes. In this study, the gene encoding a NPY receptor-like from the common Chinese cuttlefish Sepiella japonica (SjNPYR-like) was identified and characterized. The full-length SjNPYR-like cDNA was cloned containing a 492-bp of 5' untranslated region (UTR), 1 182 bp open reading frame (ORF) encoding a protein of 393 amino acid residues, and 228 bp of 3' UTR. The putative protein was predicted to have a molecular weight of 45.54 kDa and an isoelectric point (pI) of 8.13. By informatic analyses, SjNPYR-like was identified as belonging to the class A G protein coupled receptor (GPCR) family (the rhodopsin-type). The amino acid sequence contained 12 potential phosphorylation sites and five predicted N-linked glycosylation sites. Multiple sequence alignment and 3D structure modeling were conducted to clarify SjNPYR bioinformatics characteristics. Phylogenetic analysis identifies it as an NPYR with identity of 33% to Lymnaea stagnalis NPFR. Transmembrane properties of SjNPYR-like were demonstrated in vitro using HEK293 cells and the pEGFP-N1 plasmid. Relative quantification of SjNPYR-like mRNA level confirmed a high level expression and broad distribution of SjNPYR - like in various tissues of female S. japonica. In addition, the transcriptional profile of SjNPYR - like in the brain, liver, and ovary during gonadal development was analyzed. The results provide basic understanding on the molecular characteristics of SjNPYR-like and its potentially physical functions.
International Nuclear Information System (INIS)
Zhang Lei; Anhui Agricultural Univ., Hefei; Hu Fanrong; Zhang Linlin; Wang Xueyan; Wu Dianxing; Ma Chuanxi
2004-01-01
The effects of gamma irradiation on Agrobacterium-mediated genetic transformation were investigated in the current paper, using embryonic calli derived from the mature seeds of Japanese lawngrass (Zoysia japonica Steud.). The result indicated that the GUS transient expression rates were enhanced with the increasing doses when treated by doses lower than 4 Gy, however it would be decreased when treated by doses higher than 4 Gy. Based on the survival rate and GUS transient expression rate, 2 Gy is the optimal dose for Agrobacterium-mediated genetic transformation. Further observation found that 36 hours reculture after gamma irradiation is the most appropriate for agrobacterium infection. (authors)
Native eelgrass, Zostera marina, occupies a significant portion of marine-dominated intertidal and near-subtidal sectors of many coastal estuaries. In recent decades an invasive congener, Z. japonica, has become established in many Pacific Northwest estuaries. We measured the h...
Du, Chen-Zhao; Wu, Zhi-Sheng; Zhao, Na; Zhou, Zheng; Shi, Xin-Yuan; Qiao, Yan-Jiang
2016-10-01
To establish a rapid quantitative analysis method for online monitoring of chlorogenic acid in aqueous solution of Lonicera Japonica Flos extraction by using micro-electromechanical near infrared spectroscopy (MEMS-NIR). High performance liquid chromatography(HPLC) was used as reference method.Kennard-Stone (K-S) algorithm was used to divide sample sets, and partial least square(PLS) regression was adopted to establish the multivariate analysis model between the HPLC analysis contents and NIR spectra. The synergy interval partial least squares (SiPLS) was used to selected modeling waveband to establish PLS models. RPD was used to evaluate the prediction performance of the models. MDLs was calculated based on two types of error detection theory, on-line analytical modeling approach of Lonicera Japonica Flos extraction process was expressed scientifically by MDL. The result shows that the model established by multiplicative scatter correction(MSC) was the best, with the root mean square with cross validation(RMSECV), root mean square error of correction(RMSEC) and root mean square error of prediction(RMSEP) of chlorogenic acid as 1.707, 1.489, 2.362, respectively, the determination coefficient of the calibration model was 0.998 5, and the determination coefficient of the prediction was 0.988 1.The value of RPD is 9.468.The MDL (0.042 15 g•L⁻¹) selected by SiPLS is less than the original,which demonstrated that SiPLS was beneficial to improve the prediction performance of the model. In this study, a more accurate expression of the prediction performance of the model from the two types of error detection theory, to further illustrate MEMS-NIR spectroscopy can be used for on-line monitoring of Lonicera Japonica Flos extraction process. Copyright© by the Chinese Pharmaceutical Association.
Poo, Kyung-Min; Son, Eun-Bi; Chang, Jae-Soo; Ren, Xianghao; Choi, Yun-Jung; Chae, Kyu-Jung
2018-01-15
For the purpose of reusing wasted marine macro-algae generated during cultivation, harvesting, processing and selling processes, biochars derived from Saccharina japonica (known as kelp) and Sargassum fusiforme (known as hijikia) were characterized and their removal capacities for Cu, Cd, and Zn in aqueous solution were assessed. Feedstocks, S. japonica, S. fusiforme, and also pinewood sawdust as a control, were pyrolyzed at 250, 400, 500, 600 and 700 °C. In evaluating heavy metal removal capacities, SJB (S. japonica biochar) showed the best performance, with removal efficiencies of more than 98% for the three heavy metals when pyrolyzed at over 400 °C. SFB (S. fusiforme biochar) also showed good potential as an adsorbent, with removal efficiencies for the three heavy metals of more than 86% when pyrolyzed at over 500 °C. On the contrary, the maximum removal efficiencies of PSB (pinewood sawdust biochar) were 81%, 46%, and 47% for Cu, Cd, and Zn, respectively, even at 700 °C, the highest pyrolysis temperature. This demonstrates that marine macro-algae were advantageous in terms of production energy for removing heavy metals even at relatively low pyrolysis temperatures, compared with PSB. The excellent heavy metal adsorption capacities of marine macro-algae biochars were considered due to their higher pH and more oxygen-containing functional groups, although the specific surface areas of SJB and SFB were significantly lower than that of PSB. This research confirmed that the use of marine macro-algae as a heavy metal adsorbent was suitable not only in the removal of heavy metals, but also in terms of resource recycling and energy efficiency. Copyright © 2017 Elsevier Ltd. All rights reserved.
Chi, Xiaoyuan; Su, Peng; Bi, Dan; Tai, Zhao; Li, Yingying; Pang, Yue; Li, Qingwei
2018-04-01
The lamprey (Lampetra japonica), a representative of the jawless vertebrates, is the oldest extant species in the world. LIP-1, which has a jacalin-like domain and an aerolysin pore-forming domain, has previously been identified in Lampetra japonica. However, the structure and function of the LIP-1 protein have not been described. In this study, the LIP-1 gene was overexpressed in HeLa cells and H293T cells. The results showed that the overexpression of LIP-1 in HeLa cells significantly elevated LDH release (P HeLa cells, while it had no effect on H293T cell organelles. Array data indicated that overexpression of LIP-1 primarily upregulated P53 signaling pathways in HeLa cells. Cell cycle assay results confirmed that LIP-1 caused arrest in the G 2 /M phase of the cell cycle in HeLa cells. In summary, our findings provide insights into the function and characterization of LIP-1 genes in vertebrates and establish the foundation for further research into the biological function of LIP-1. Our observations suggest that this lamprey protein has the potential for use in new applications in the medical field. Copyright © 2018. Published by Elsevier Ltd.
Native eelgrass, Zostera marina, occupies a significant portion of marine-dominated intertidal and near-subtidal sectors of many coastal estuaries. In recent decades an invasive congener, Z. japonica, has become established in many Pacific Northwest estuaries. We measured the h...
Micro-PIXE study of whole otolith of Anguilla japonica at elver stage
International Nuclear Information System (INIS)
Zheng, Y.; Guo, H.; Wei, K.; Tang, W.; Satoh, T.; Ohkubo, T.; Yamazaki, A.; Takano, K.; Kamiya, T.; Shen, H.; Yang, M.; Mi, Y.
2010-01-01
Strontium and calcium contents, within the otolith of Anguilla japonica, were measured by external micro-PIXE. According to the measured metamorphic checks, each otolith was divided into three stages. Comparing with the Sr:Ca ratios in stage 2, the ratios in stage 1 had two different trends. Among these fish, it may reflect their maternal condition was not the same. The ratios in stage 3 which was corresponding to the estuarine habitat were smaller than that in any other stage which was corresponding to the ocean habitat in each otolith. Suggested by our results, the eels from the spawning site may separate into two groups when they are near to the south of Taiwan, and then move to the different estuaries in China. It could be proposed that, in general, the migration direction is from south to north along the east coast in China.
Micro-PIXE study of whole otolith of Anguilla japonica at elver stage
Energy Technology Data Exchange (ETDEWEB)
Zheng, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Guo, H.; Wei, K.; Tang, W. [Institute of Life Science, Shanghai Fisheries University, Shanghai 200090 (China); Satoh, T.; Ohkubo, T.; Yamazaki, A.; Takano, K.; Kamiya, T. [Takasaki Advanced Radiation Research Institute, JAEA, Gunma 370-1292 (Japan); Shen, H., E-mail: haoshen@fudan.edu.c [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Yang, M.; Mi, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China)
2010-06-15
Strontium and calcium contents, within the otolith of Anguilla japonica, were measured by external micro-PIXE. According to the measured metamorphic checks, each otolith was divided into three stages. Comparing with the Sr:Ca ratios in stage 2, the ratios in stage 1 had two different trends. Among these fish, it may reflect their maternal condition was not the same. The ratios in stage 3 which was corresponding to the estuarine habitat were smaller than that in any other stage which was corresponding to the ocean habitat in each otolith. Suggested by our results, the eels from the spawning site may separate into two groups when they are near to the south of Taiwan, and then move to the different estuaries in China. It could be proposed that, in general, the migration direction is from south to north along the east coast in China.
Evaluating the Effect of a Novel Molluscicide in the Endemic Schistosomiasis Japonica Area of China
Directory of Open Access Journals (Sweden)
Jing Xia
2014-10-01
Full Text Available Oncomelania hupensis is the sole intermediate host snail of Schistosoma japonicum in China. Snail control by molluscicide remains one of the most effective measures of schistosomiasis japonica control. A 50% wettable powder of niclosamide ethanolamine salt (WPN is widely used for snail control in China. However, WPN is costly and toxic to fish. A novel molluscicide named LDS, the salt of quinoid-2′, 5-dichloro-4′-nitrosalicylanilide from niclosamide, has been developed. To evaluate the effects of large-scale field application of LDS on field snail control, tests were conducted in 15 counties of Hubei Province, China. Active adult snails, were immersed in 0.2, 0.4, and 0.6 g/m3 of 10% LDS, 1.0 g/m3 of 50% WPN was used as the molluscicide control, and then the mortality rates of snails were investigated after 1, 2, and 3 days. In addition, four active concentrations of 10% LDS (0.4, 0.6, 0.8 and 1.0 g/m2 were applied by spraying and powdering in the field. 1.0 g/m2 of 50% WPN was used as the molluscicide control, and then the mortality rates of snails were observed after 1, 3, and 7 days. The results indicated that 0.4 g/m3 LDS applied by the immersion or 0.6 g/m2 LDS applied by spraying and powdering achieved the same molluscicidal effect as that of WPN, regardless of exposure time. By using different methods, the snail mortality rates in the molluscicide groups were related to exposure time and concentration, respectively. LDS costs less than WPN; thus, LDS is suitable and applicable for use as a molluscicide in schistosomiasis japonica epidemic areas.
Directory of Open Access Journals (Sweden)
Woong Sun Jang
2013-01-01
Full Text Available Laminaria japonica Areshoung, a widely consumed marine vegetable, has traditionally been used in Korean maternal health. The present study investigated the antiobesity effects of Laminaria japonica Areshoung ethanol extract (LE and its molecular mechanism in high-fat-diet-induced obese rats. Six-week-old Sprague-Dawley male rats were separately fed a normal diet or a high-calorie high-fat diet for 6 weeks; then they were treated with LE or tea catechin for another 6 weeks. LE administration significantly decreased the body weight gain, fat-pad weights, and serum and hepatic lipid levels in HD-induced obese rats. The histological analysis revealed that LE-treated group showed a significantly decreased number of lipid droplets and size of adipocytes compared to the HD group. To elucidate the mechanism of action of LE, the levels of genes and proteins involved in obesity were measured in the liver and skeletal muscle. LE treatment resulted in an increased expression of fatty acid oxidation and thermogenesis-related genes in obese rats. Conversely, the expression of the fat intake-related gene (ACC2 and lipogenesis-related genes was reduced by LE treatment. Additionally, LE treatment increased the phosphorylation of AMP-activated protein kinase and its direct downstream protein, acetyl coenzyme A carboxylase, which is one of the rate-limiting enzymes in fatty acid synthesis pathway. These findings demonstrate that LE treatment has a protective effect against a high-fat-diet-induced obesity in rats through regulation of expression of genes and proteins involved in lipolysis and lipogenesis.
Tsubomura, Miyoko; Kurita, Manabu; Watanabe, Atsushi
2016-05-01
The molecular mechanisms that control male strobilus development in conifers are largely unknown because the developmental stages and related genes have not yet been characterized. The determination of male strobilus developmental stages will contribute to genetic research and reproductive biology in conifers. Our objectives in this study were to determine the developmental stages of male strobili by cytological and transcriptome analysis, and to determine the stages at which aberrant morphology is observed in a male-sterile mutant of Cryptomeria japonica D. Don to better understand the molecular mechanisms that control male strobilus and pollen development. Male strobilus development was observed for 8 months, from initiation to pollen dispersal. A set of 19,209 expressed sequence tags (ESTs) collected from a male reproductive library and a pollen library was used for microarray analysis. We divided male strobilus development into 10 stages by cytological and transcriptome analysis. Eight clusters (7324 ESTs) exhibited major changes in transcriptome profiles during male strobili and pollen development in C. japonica Two clusters showed a gradual increase and decline in transcript abundance, respectively, while the other six clusters exhibited stage-specific changes. The stages at which the male sterility trait of Sosyun was expressed were identified using information on male strobilus and pollen developmental stages and gene expression profiles. Aberrant morphology was observed cytologically at Stage 6 (microspore stage), and differences in expression patterns compared with wild type were observed at Stage 4 (tetrad stage). © The Author 2016. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Radionuclide study on hepatic blood flow in Schistosomiasis Japonica
Energy Technology Data Exchange (ETDEWEB)
Okada, Junichi; Uchiyama, Guio; Hayakawa, Kazushige; Hayashi, Sanshin; Araki, Tsutomu; Arai, Takao; Iuchi, Masahiko
1986-11-01
Schistosomiasis Japonica is a regional disease found in elderly people who were living in once-endemic areas in Japan. Yamanashi was one of these areas until 1970, since when no newly infected patients were reported. The disease is characteristic of developing irreversible interstitial fibrosis of the liver, where parasites migrate and lay eggs. Portal hypertension, esophageal varices and hepatocellular carcinomas are the common features of the results. In order to estimate patient's hepatic blood flow, radionuclide angiography of the liver with the use of 10 - 15 millicuries of Tc-99m phytate were performed prior to the conventional multiview imaging. Twenty-two patients with schistosomiasis and twelve adults without evidence of liver disease were studied. A time-activity curve of the right lobe of the liver was generated by a computer, and the ratio of arterial blood flow to portal blood flow was calculated. As a result, a good correlation was found between the arterial to portal blood flow ratio and the grade of hepatic fibrosis verified by laparoscopic biopsy. The development of esophageal varices were likely to correlate well with the blood flow ratio rather than scores on the conventional static liver and spleen scintigram. The study was useful for evaluating patient's clinical stages and prognosis.
Radionuclide study on hepatic blood flow in Schistosomiasis Japonica
International Nuclear Information System (INIS)
Okada, Junichi; Uchiyama, Guio; Hayakawa, Kazushige; Hayashi, Sanshin; Araki, Tsutomu; Arai, Takao; Iuchi, Masahiko.
1986-01-01
Schistosomiasis Japonica is a regional disease found in elderly people who were living in once-endemic areas in Japan. Yamanashi was one of these areas until 1970, since when no newly infected patients were reported. The disease is characteristic of developing irreversible interstitial fibrosis of the liver, where parasites migrate and lay eggs. Portal hypertension, esophageal varices and hepatocellular carcinomas are the common features of the results. In order to estimate patient's hepatic blood flow, radionuclide angiography of the liver with the use of 10 - 15 millicuries of Tc-99m phytate were performed prior to the conventional multiview imaging. Twenty-two patients with schistosomiasis and twelve adults without evidence of liver disease were studied. A time-activity curve of the right lobe of the liver was generated by a computer, and the ratio of arterial blood flow to portal blood flow was calculated. As a result, a good correlation was found between the arterial to portal blood flow ratio and the grade of hepatic fibrosis verified by laparoscopic biopsy. The development of esophageal varices were likely to correlate well with the blood flow ratio rather than scores on the conventional static liver and spleen scintigram. The study was useful for evaluating patient's clinical stages and prognosis. (author)
Fast, large-scale hologram calculation in wavelet domain
Shimobaba, Tomoyoshi; Matsushima, Kyoji; Takahashi, Takayuki; Nagahama, Yuki; Hasegawa, Satoki; Sano, Marie; Hirayama, Ryuji; Kakue, Takashi; Ito, Tomoyoshi
2018-04-01
We propose a large-scale hologram calculation using WAvelet ShrinkAge-Based superpositIon (WASABI), a wavelet transform-based algorithm. An image-type hologram calculated using the WASABI method is printed on a glass substrate with the resolution of 65 , 536 × 65 , 536 pixels and a pixel pitch of 1 μm. The hologram calculation time amounts to approximately 354 s on a commercial CPU, which is approximately 30 times faster than conventional methods.
[Luring effect of the fermented Laminaria japonica to Oncomelania hupensis].
Ma, An-ning; Ni, Hong; Wang, Wan-xian; Zhang, Yun; Geng, Peng
2010-02-01
To study the attraction effect of the food attractants on Oncomelania hupensis. Oncomelania snail food was prepared with the fermented kelp (Laminaria japonica) mixed with corn starch. Snails were fed with the food and kept for 12, 24, 36, and 48 h at 15, 25, 35 degrees C respectively. Meanwhile, snail-killing effect was tested by granules containing jack-in-the-pulpit (Arisama heterophyllum) with or without the fermented kelp under the condition of 25 degrees C, 30% or 60% soil humidity. The snail-attracting rate of the fermented kelp was affected by the temperature, highest under 25 degrees C and lowest under 35 degrees C at any time point, with a rate of 80.3% in 48 h at 25 degrees C which was higher than that of the control (17.0%) (Pjack-in-the-pulpit with fermented kelp (85.3%) was higher than that of the group without fermented kelp (26.8%) (P<0.05). The mortality under 60% of soil humidity was higher than that under 30% humidity (P<0.01). The fermented kelp shows a strong luring effect to the Oncomelania snails.
Biological Activities of Extracts from Loquat (Eriobotrya japonica Lindl.: A Review
Directory of Open Access Journals (Sweden)
Yilong Liu
2016-12-01
Full Text Available Loquat (Eriobotrya japonica Lindl. is a subtropical fruit tree with high medicinal value native to China. Different organs of loquat have been used historically as folk medicines and this has been recorded in Chinese history for thousands of years. Research shows that loquat extracts contain many antioxidants, and different extracts exhibit bioactivity capable of counteracting inflammation, diabetes, cancer, bacterial infection, aging, pain, allergy and other health issues. Bioactive compounds such as phenolics and terpenoids have been isolated and characterized to provide a better understanding of the chemical mechanisms underlying the biological activities of loquat extracts. As the identification of compounds progresses, studies investigating the in vivo metabolism, bioavailability, and structure–activity relationships, as well as potential toxicity of loquat extracts in animal or cell models are receiving more attention. In addition, genetic studies and breeding of loquat germplasms for high contents of health-benefiting compounds may provide new insight for the loquat industry and research. This review is focused on the main medicinal properties reported and the possible pharmaceutically active compounds identified in different loquat extracts.
Spatial orientation in Japanese quails (Coturnix coturnix japonica.
Directory of Open Access Journals (Sweden)
Tim Ruploh
Full Text Available Finding a given location can be based on a variety of strategies, for example on the estimation of spatial relations between landmarks, called spatial orientation. In galliform birds, spatial orientation has been demonstrated convincingly in very young domestic chicks. We wanted to know whether adult Japanese quails (Coturnix coturnix japonica without food deprivation are also able to use spatial orientation. The quails had to learn the relation of a food location with four conspicuous landmarks which were placed in the corners of a square shaped arena. They were trained to find mealworms in three adjacent food cups in a circle of 20 such cups. The rewarded feeders were located during training between the same two landmarks each of which showed a distinct pattern. When the birds had learned the task, all landmarks were displaced clockwise by 90 degrees. When tested in the new situation, all birds redirected their choices with respect to the landmark shift. In subsequent tests, however, the previously correct position was also chosen. According to our results, quails are using conspicuous landmarks as a first choice for orientation. The orientation towards the previously rewarded location, however, indicates that the neuronal representation of space which is used by the birds also includes more fine grain, less conspicuous cues, which are probably also taken into account in uncertain situations. We also presume that the rare orientation towards never rewarded feeders may be due to a foraging strategy instead of being mistakes.
Patra, Jayanta Kumar; Das, Gitishree; Baek, Kwang-Hyun
2015-07-02
Laminaria japonica L. is among the most commonly consumed seaweeds in northeast Asia. In the present study, L. japonica essential oil (LJEO) was extracted by microwave-hydrodistillation and analyzed by gas chromatography and mass spectroscopy. LJEO contained 21 volatile compounds, comprising 99.76% of the total volume of the essential oil, primarily tetradeconoic acid (51.75%), hexadecanoic acid (16.57%), (9Z,12Z)-9,12-Octadecadienoic acid (12.09%), and (9Z)-hexadec-9-enoic acid (9.25%). Evaluation of the antibacterial potential against three foodborne pathogens, Bacillus cereus ATCC 10876, Escherichia coli O157:H7 ATCC 43890, and Staphylococcus aureus ATCC 49444, revealed that LJEO at a concentration of 25 mg/paper disc exerted high antibacterial activity against S. aureus (11.5 ± 0.58 mm inhibition zone) and B. cereus (10.5 ± 0.57 mm inhibition zone), but no inhibition of E. coli O157:H7. LJEO also displayed DPPH (1,1-diphenyl-2-picrylhydrazyl) free radical scavenging activity (80.45%), superoxide anion scavenging activity (54.03%), and ABTS (2,2'-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) radical and hydroxyl radical scavenging at 500 µg/mL. Finally, LJEO showed high inhibition of lipid peroxidation with strong reducing power. In conclusion, LJEO from edible seaweed is an inexpensive but favorable resource with strong antibacterial capacity as well as free radical scavenging and antioxidant activity; therefore, it has the potential for use in the food, cosmetics, and pharmaceutical industries.
International Nuclear Information System (INIS)
Sarla, N.
1988-01-01
The cross B. campestris ssp. japonica x B. oleracea var. botrytis fails due to incompatibility barrier at the stigma. To realize this cross, irradiated compatible pollen (mentor pollen) was used before the incompatible pollination. The presence of mentor pollen stimulated the incompatible pollen to germinate and effect fertilization and seed set. One hybrid was thus obtained. Most of the seeds were inviable. Of the 5 plants raised one was a hybrid and 4 resembled the female parent. 1 tab., 7 refs
Xu, Jun-Fang; Xu, Jing; Li, Shi-Zhu; Jia, Tia-Wu; Huang, Xi-Bao; Zhang, Hua-Ming; Chen, Mei; Yang, Guo-Jing; Gao, Shu-Jing; Wang, Qing-Yun; Zhou, Xiao-Nong
2013-01-01
Background The transmission of schistosomiasis japonica in a local setting is still poorly understood in the lake regions of the People's Republic of China (P. R. China), and its transmission patterns are closely related to human, social and economic factors. Methodology/Principal Findings We aimed to apply the integrated approach of artificial neural network (ANN) and logistic regression model in assessment of transmission risks of Schistosoma japonicum with epidemiological data collected from 2339 villagers from 1247 households in six villages of Jiangling County, P.R. China. By using the back-propagation (BP) of the ANN model, 16 factors out of 27 factors were screened, and the top five factors ranked by the absolute value of mean impact value (MIV) were mainly related to human behavior, i.e. integration of water contact history and infection history, family with past infection, history of water contact, infection history, and infection times. The top five factors screened by the logistic regression model were mainly related to the social economics, i.e. village level, economic conditions of family, age group, education level, and infection times. The risk of human infection with S. japonicum is higher in the population who are at age 15 or younger, or with lower education, or with the higher infection rate of the village, or with poor family, and in the population with more than one time to be infected. Conclusion/Significance Both BP artificial neural network and logistic regression model established in a small scale suggested that individual behavior and socioeconomic status are the most important risk factors in the transmission of schistosomiasis japonica. It was reviewed that the young population (≤15) in higher-risk areas was the main target to be intervened for the disease transmission control. PMID:23556015
Stefanowicz, Anna M; Stanek, Małgorzata; Nobis, Marcin; Zubek, Szymon
2017-01-01
Biological invasions are an important problem of human-induced changes at a global scale. Invasive plants can modify soil nutrient pools and element cycling, creating feedbacks that potentially stabilize current or accelerate further invasion, and prevent re-establishment of native species. The aim of this study was to compare the effects of Reynoutria japonica, Rudbeckia laciniata and Solidago gigantea, invading non-forest areas located within or outside river valleys, on soil physical and chemical parameters, including soil moisture, element concentrations, organic matter content and pH. Additionally, invasion effects on plant species number and total plant cover were assessed. The concentrations of elements in shoots and roots of invasive and native plants were also measured. Split-plot ANOVA revealed that the invasions significantly reduced plant species number, but did not affect most soil physical and chemical properties. The invasions decreased total P concentration and increased N-NO 3 concentration in soil in comparison to native vegetation, though the latter only in the case of R. japonica. The influence of invasion on soil properties did not depend on location (within- or outside valleys). The lack of invasion effects on most soil properties does not necessarily imply the lack of influence of invasive plants, but may suggest that the direction of the changes varies among replicate sites and there are no general patterns of invasion-induced alterations for these parameters. Tissue element concentrations, with the exception of Mg, did not differ between invasive and native plants, and were not related to soil element concentrations. Copyright © 2016 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Malachy T Campbell
2017-06-01
Full Text Available Salinity is a major factor limiting crop productivity. Rice (Oryza sativa, a staple crop for the majority of the world, is highly sensitive to salinity stress. To discover novel sources of genetic variation for salt tolerance-related traits in rice, we screened 390 diverse accessions under 14 days of moderate (9 dS·m-1 salinity. In this study, shoot growth responses to moderate levels of salinity were independent of tissue Na+ content. A significant difference in root Na+ content was observed between the major subpopulations of rice, with indica accessions displaying higher root Na+ and japonica accessions exhibiting lower root Na+ content. The genetic basis of the observed variation in phenotypes was elucidated through genome-wide association (GWA. The strongest associations were identified for root Na+:K+ ratio and root Na+ content in a region spanning ~575 Kb on chromosome 4, named Root Na+ Content 4 (RNC4. Two Na+ transporters, HKT1;1 and HKT1;4 were identified as candidates for RNC4. Reduced expression of both HKT1;1 and HKT1;4 through RNA interference indicated that HKT1;1 regulates shoot and root Na+ content, and is likely the causal gene underlying RNC4. Three non-synonymous mutations within HKT1;1 were present at higher frequency in the indica subpopulation. When expressed in Xenopus oocytes the indica-predominant isoform exhibited higher inward (negative currents and a less negative voltage threshold of inward rectifying current activation compared to the japonica-predominant isoform. The introduction of a 4.5kb fragment containing the HKT1;1 promoter and CDS from an indica variety into a japonica background, resulted in a phenotype similar to the indica subpopulation, with higher root Na+ and Na+:K+. This study provides evidence that HKT1;1 regulates root Na+ content, and underlies the divergence in root Na+ content between the two major subspecies in rice.
Xue, You-Lin; Miyakawa, Takuya; Sawano, Yoriko; Tanokura, Masaru
2012-02-01
Dioscorin, the major tuber storage protein of yam, has been shown to possess carbonic anhydrase, trypsin inhibitor, dehydroascorbate reductase, and monodehydroascorbate reductase activities. In the present study, dioscorin from Dioscorea japonica was confirmed as a glycoprotein using the enhanced concanavalin A-peroxidase staining method, and the protein was shown to have both N- and O-glycans. Following the gene cloning, four full-length isoforms of dioscorin were expressed in Escherichia coli and purified by affinity purification and anion-exchange chromatography for structural and biochemical experiments. It was clearly observed that the recombinant dioscorins had carbonic anhydrase, trypsin inhibitor, dehydroascorbate reductase, and monodehydroascorbate reductase activities. However, the dehydroascorbate reductase and monodehydroascorbate reductase activities were markedly decreased in recombinant dioscorins compared with native dioscorin. The decreased activities were closely related to the loss of the glycosylation from the protein. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Carlos Augusto Fernandes Oliveira
2007-02-01
Full Text Available O objetivo do presente trabalho foi estudar o efeito da fumonisina B1 (FB1 sobre o peso corpóreo e as vísceras (fígado, rim e coração de codorna poedeira japonesa (Coturnix coturnix japonica, devido ao escasso dado toxicológico nesta espécie. Quatro grupos, sendo cada um constituído de 32 codornas de linhagem comercial, receberam ração contendo FB1 nas concentrações de 0 (controle, 10, 50 e 250mg kg-1, durante 28 dias. Observou-se uma redução (P0,05, porém as aves do grupo 50 e 250mg kg-1 apresentaram aumento no peso relativo de fígado (PThis research was aimed at evaluating the effect of fumonisin B1 (FB1 on body weight and viscera (liver, kidney and heart of laying Japanese quail (Coturnix coturnix japonica, due to the little toxicological data on this species. Four experimental groups of 32 commercial quails were designed and exposed to ingestion test with feed containing 0 (controls, 10, 50 or 250mg FB1 kg-1 feed, during 28 days. Birds of group 250mg FB1 kg-1 showed lower body weight (P0.05 among treatments. However, the relative weight of liver increased (P<0.05 in quail of groups received 50 and 250mg FB1/kg. Histological changes were observed only in the liver of groups receiving 50 and 250mgFB1 kg-1, which caused moderate biliary duct hyperplasia and multiple foci of hepatic necrosis. The data indicated that AFB1 at levels above 50mg kg-1 in laying Japanese quail.
Directory of Open Access Journals (Sweden)
Renata Assis Casagrande
2011-11-01
Full Text Available Uma codorna japonesa (Coturnix coturnix japonica, fêmea, adulta com 2 anos apresentou parada de postura, emagrecimento, aumento de volume abdominal e morte. Ao exame macroscópico, observou-se ascite, pulmão esquerdo difusamente esbranquiçado, massas esbranquiçadas, de aproximadamente 1,0cm de diâmetro, na região caudal do lobo direito do fígado e na serosa da moela; massas de 0,1 a 0,5cm no mesentério e serosa intestinal; e uma massa de 5,0x2,0cm na fossa do sinsacro, que acometia 90% do parênquima renal e estendia-se ao ovário e oviduto. Na avaliação histopatológica da neoformação renal, observou-se proliferação de células epiteliais formando túbulos, que muitas vezes não apresentavam lúmen, sustentados por um estroma fibrovascular escasso associado à necrose multifocal. As células neoplásicas eram cuboidais, núcleos redondos a ovalados, nucléolos evidentes, citoplasma abundante e eosinofílico, pleomorfismo moderado e poucas figuras mitóticas. Metástases foram observadas de forma difusa no ovário, oviduto e pulmão esquerdo; multifocal na serosa do intestino e focal no fígado e camadas muscular e serosa da moela. Na avaliação imuno-histoquímica, as células tumorais foram positivas para a citoqueratina (clones AE1+AE3 e negativas para a citoqueratina 5/6, o CD10 e a fosfatase alcalina placentária. De acordo com a localização, achados morfológicos e o perfil imuno-histoquímico, conclui-se que o presente relato trata-se de um adenocarcinoma renal metastático.A 2-year-old Japanese quail (Coturnix coturnix japonica, female, which stopped egg production presented: weight loss, increased abdominal volume, and death. Macroscopically, it was observed: ascites, whitish left lung, whitish masses measuring 1.0cm in diameter in the caudal right lobe of the liver and in the gizzard serosa; 0.1-0.5cm masses in the mesentery and intestinal serosa; and a 5.0x2.0cm mass in synsacral area that encompassed 90% of the renal
International Nuclear Information System (INIS)
Motegi, Misako; Miyake, Sadaaki; Ohsawa, Takashi; Nakazawa, Kiyoaki; Izumo, Yoshiro
1998-01-01
Accumulation of 137 Cs in trefoil (leaf and stem), ''Mitsuba'', Cryptotaenia japonica Hassk, with or without root was investigated to prepare higher radioactive plant in hydroponic culture medium (140-150 Bq/ml). It was found that 137 Cs concentration in plant tissue was increased with time, as high as 1.6 times of that in the culture medium after 4 days. On the other hand, 137 Cs concentration was affected by carrier element (Cs>6 ppm) and coexistent elements in the medium. Radioactivity of the plant after 4 days was shown to be sufficient for successive experiments. (author)
Characteristic odor components of essential oils from Eurya japonica.
Motooka, Ryota; Usami, Atsushi; Nakahashi, Hiroshi; Koutari, Satoshi; Nakaya, Satoshi; Shimizu, Ryoyu; Tsuji, Kaoru; Marumoto, Shinsuke; Miyazawa, Mitsuo
2015-01-01
The chemical compositions of essential oils from the flower and aerial parts (i.e., leaf and branch) of Eurya japonica were determined and quantified using gas chromatography-mass spectrometry (GC-MS). A total of 87 and 50 compounds were detected in the oils from the flower and aerial parts, respectively. The main compounds of the flower oil were linalool (14.0%), (9Z)-tricosene (12.0%), and nonanal (7.4%). In the oil from the aerial parts, linalool (37.7%), α-terpineol (13.5%), and geraniol (9.6%) were detected. In the oils from the flower and aerial parts, 13 and 8 aroma-active compounds were identified by GC-olfactometry (GC-O) analysis, respectively. The key aroma-active compounds of the flower oil were heptanal [fatty, green, flavor dilution (FD) = 128, odor activity value (OAV) = 346], nonanal (sweet, citrus, FD = 128, OAV = 491), and eugenol (sweet, spicy, FD = 64, OAV = 62): in the oil from the aerial parts, the key aroma-active compounds were linalool (sweet, citrus, FD = 64, OAV = 95), (E)-β-damascenone (sweet, FD = 256, OAV = 4000), and (E)-β-ionone (floral, violet, FD = 128, OAV = 120). This study revealed that nonanal and eugenol impart the sweet, citrus, and spicy odor of the flower oil, while (E)-β-damascenone and (E)-β-ionone contribute the floral and sweet odor of the oil from the aerial parts.
Morfo-anatomia das folhas da nespereira Eriobotrya japonica Lindl., Rosaceae
Directory of Open Access Journals (Sweden)
W. M. de Souza
Full Text Available Eriobotrya japonica, Rosaceae, é uma espécie conhecida popularmente como nespereira, cujas folhas são empregadas na medicina tradicional como agente hipoglicemiante e no tratamento de doenças da pele. O presente trabalho objetivou caracterizar morfo-anatomicamente as folhas, a fim de fornecer subsídios farmacognósticos ao controle de qualidade da droga vegetal e taxonômicos à família. O material botânico foi fixado e submetido às técnicas usuais de microscopia ótica e eletrônica de varredura. As folhas são simples, alternas, lanceoladas, de limbo inteiro e margem denteada. A epiderme foliar é uniestratificada e revestida por cutícula espessada e levemente estriada. Tricomas tectores unicelulares longos são encontrados em ambas as faces, sendo numerosos na abaxial. A folha é hipoestomática, revelando estômatos anomocíticos. O mesofilo é dorsiventral e os feixes vasculares de pequeno porte são colaterais e podem apresentar extensão de bainha. A nervura principal possui formato biconvexo e o pecíolo circular, sendo ambos percorridos por feixes vasculares anficrivais. Foram observados idioblastos contendo cristais de oxalato de cálcio, mucilagem e compostos fenólicos.
Energy Technology Data Exchange (ETDEWEB)
Bae, Tae Woong; Song, In Ja; Kang, Hong Gyu; Jeong, Ok Cheol; Sun, Hyeon Jin; Ko, Suk Min; Lim, Pyung Ok; Song, Pill Soon; Song, Sung Jun; Lee, Hyo Yeon [Jeju National University, Jeju (Korea, Republic of)
2010-09-15
The aim of this study is selection of the male-sterile plant for inhibiting transgene flow through gamma-irradiation ({sup 60}Co) at the pollination and fertilization cycle of herbicide-tolerant genetically modified (GM) zoysiagrass (Zoysia japonica Steud.). High frequencies of plant mutations were obtained about 18% from M{sub 1} generation at the doses (10 to 50 Gy). We also found that some M{sub 1} plants showed male-sterile plants using de-husked seeds and comparison of stainable pollen using KI-I{sub 2} solution. Besides the effects of irradiation on pollination and fertilization cycle, various other mutation like dwarf, cold tolerance, increasing grains and mass were observed. Four of dwarfism plants were selected through comparison of morphological characteristic between control and mutants during 4 years. These results demonstrated that the gamma-irradiation on pollination and fertilization cycle is very effective to induce the various mutations, and the male-sterile mutants are useful for controlling transgene flow and developing of high quality turfgasses.
International Nuclear Information System (INIS)
Bae, Tae Woong; Song, In Ja; Kang, Hong Gyu; Jeong, Ok Cheol; Sun, Hyeon Jin; Ko, Suk Min; Lim, Pyung Ok; Song, Pill Soon; Song, Sung Jun; Lee, Hyo Yeon
2010-01-01
The aim of this study is selection of the male-sterile plant for inhibiting transgene flow through gamma-irradiation ( 60 Co) at the pollination and fertilization cycle of herbicide-tolerant genetically modified (GM) zoysiagrass (Zoysia japonica Steud.). High frequencies of plant mutations were obtained about 18% from M 1 generation at the doses (10 to 50 Gy). We also found that some M 1 plants showed male-sterile plants using de-husked seeds and comparison of stainable pollen using KI-I 2 solution. Besides the effects of irradiation on pollination and fertilization cycle, various other mutation like dwarf, cold tolerance, increasing grains and mass were observed. Four of dwarfism plants were selected through comparison of morphological characteristic between control and mutants during 4 years. These results demonstrated that the gamma-irradiation on pollination and fertilization cycle is very effective to induce the various mutations, and the male-sterile mutants are useful for controlling transgene flow and developing of high quality turfgasses
Directory of Open Access Journals (Sweden)
Han-Sung Lee
Full Text Available The bark of Ulmus davidiana var. japonica Nakai (Ulmaceae has been used in traditional Korean medicine for chronic inflammation in the gastrointestinal tract. Here we investigated the frequency and cytokine profile of the major immune cells in the small intestinal lamina propria (SI LP, spleen, and mesenteric lymph nodes (MLNs of mice treated orally with Ulmus davidiana var. japonica Nakai bark water extract (UDE to address the immunomodulatory role of this herb in intestinal homeostasis. B6 mice were given 5g/kg UDE once daily for 14 days. They were then sacrificed, and cells were isolated from the spleen, MLNs, and SI LP. The proportion of B versus T lymphocytes, CD4(+ versus CD8(+ T lymphocytes, Th1 and Th17 cells, and Foxp3(+ regulatory T cells in the spleen, MLNs, and SI LP were analyzed. The frequency of antigen-presenting cells (APCs, including dendritic cells, macrophages, and eosinophils in the SI LP and the expression of costimulatory molecules on APCs were also evaluated. The numbers and frequencies of Th1 and Th17 cells in the SI LP were significantly reduced in the UDE-treated mice compared with PBS controls. In addition, the proportion of IL-4-producing eosinophils in the SI LP was significantly elevated in the UDE-treated mice compared with controls. Taken together, these data indicate that UDE up-regulates the number and frequency of SI LP eosinophils, which can down-regulate the Th1 and Th17 responses via IL-4 secretion and contribute to intestinal homeostasis.
Directory of Open Access Journals (Sweden)
Yi-Chien Wu
2016-01-01
Full Text Available Typical japonica type rice is sensitive to high temperature. Pon-Lai rice is a special japonica type with adaptation to the subtropical climate in Taiwan. Facing climate change, rising temperatures would damage the yield and quality of rice production. This research was conducted using Pon-Lai rice in the field of a subtropical climate. We conducted 2 experiments, including a year-round experiment and collection of samples from different districts for building different temperature conditions. We analyzed the correlation between rising temperature and rice yield or quality. In our results, the critical period of temperature effect is 0–15 days after heading (H15. The threshold of high temperature damage in yield and appearance quality was 25–27 °C. Grain weight decreased about 2–6%, while the temperature of H15 was raised 1 °C above the thresholds. Perfect grain ratio and chalky grain ratio decreased and increased, respectively, while the temperature of H15 was raised above the thresholds. However, the high temperature in H15 affected the physicochemical characteristics. In addition, we found positive correlation between grain length to width ratio and perfect grain ratio. Grain length to width ratio could be an index of temperature effects for grain quality. In our study, when the temperature was below 30 °C, a rising temperature of H15 could damage rice yield and appearance quality, and change grain shape. Our results could provide reference for dealing with the warming future in other temperate rice-cultivated countries.
Directory of Open Access Journals (Sweden)
Jayanta Kumar Patra
2015-07-01
Full Text Available Laminaria japonica L. is among the most commonly consumed seaweeds in northeast Asia. In the present study, L. japonica essential oil (LJEO was extracted by microwave-hydrodistillation and analyzed by gas chromatography and mass spectroscopy. LJEO contained 21 volatile compounds, comprising 99.76% of the total volume of the essential oil, primarily tetradeconoic acid (51.75%, hexadecanoic acid (16.57%, (9Z,12Z-9,12-Octadecadienoic acid (12.09%, and (9Z-hexadec-9-enoic acid (9.25%. Evaluation of the antibacterial potential against three foodborne pathogens, Bacillus cereus ATCC 10876, Escherichia coli O157:H7 ATCC 43890, and Staphylococcus aureus ATCC 49444, revealed that LJEO at a concentration of 25 mg/paper disc exerted high antibacterial activity against S. aureus (11.5 ± 0.58 mm inhibition zone and B. cereus (10.5 ± 0.57 mm inhibition zone, but no inhibition of E. coli O157:H7. LJEO also displayed DPPH (1,1-diphenyl-2-picrylhydrazyl free radical scavenging activity (80.45%, superoxide anion scavenging activity (54.03%, and ABTS (2,2′-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid radical and hydroxyl radical scavenging at 500 µg/mL. Finally, LJEO showed high inhibition of lipid peroxidation with strong reducing power. In conclusion, LJEO from edible seaweed is an inexpensive but favorable resource with strong antibacterial capacity as well as free radical scavenging and antioxidant activity; therefore, it has the potential for use in the food, cosmetics, and pharmaceutical industries.
Huo, Liping; Bao, Miaomiao; Lv, Zhenming; Chi, Changfeng; Wang, Tianming; Liu, Huihui
2018-05-01
Myeloid differentiation factor 88 (MyD88) is an adaptor protein involved in the interleukin-1 receptor and Toll-like receptor-induced activation of nuclear factor-κB (NF-κB). In this study a novel isoform of MyD88 in Sepiella japonica (SjMyD88) was cloned and functionally characterized (GenBank accession no. AQY56781.1). The complete cDNA sequence of SjMyD88 was 1912 bp and contained a 1017 bp open reading frame encoding 338 amino acid residues, which was similar to its mollusk orthologues in the length. BLASTp analysis suggested the deduced amino acids sequence of SjMyD88 shared high identity to the known MyD88, for instance, 64% identity with Octopus bimaculoides. Sequence analysis revealed two conserved domains, the N-terminal DD and the C-terminal TIR domain appeared in SjMyD88, which was consistent with MyD88 proteins from other species. The fusion expression of SjMyD88 and green fluorescent protein (EGFP) in HEK293 cells was conducted and cytoplasm localization was detected. Meanwhile, the TIR-pmCherry fusion protein showed red fluorescence and mainly distributed in the cytoplasm. After cotransfection MyD88-EGFP and TIR-pmCherry red obviously overlapped and changed to yellowish green. The results suggested that there was the interaction between homologous TIR-pmcherry and MyD88-EGFP. Tissues expression profiles analysis showed that SjMyD88 ubiquitously expressed in all tested tissues with the highest expression in the gills and livers except reproductive related tissue, and it was significantly induced in livers under LPS stress. These data provide insight into the roles of SjMyD88 in the TLR signaling pathway of S. japonica in response to pathogenic bacteria. Copyright © 2018. Published by Elsevier Ltd.
Aoyama, J.; Hissmann, Karen; Yoshinaga, T.; Sasai, S.; Uto, T.; Ueda, H.
1999-01-01
Five hormone-treated female Japanese silver eels Anguilla japonica were tagged with ultrasonic transmitters and released by submersible in the West Pacific at seamounts of the West Mariana Ridge, their supposed spawning grounds. Four eels were tracked for 60 to 423 min in the vicinity of the seamounts. They did not settle at the seamounts but swam at a mean speed of 0.37 m s-1 into open water above deep ground. Their mean swimming depth ranged from 81 to 172 m. Experiments suggest that pre-ma...
Energy Technology Data Exchange (ETDEWEB)
Motegi, Misako; Miyake, Sadaaki; Ohsawa, Takashi; Nakazawa, Kiyoaki [Saitama Institute of Public Health, Urawa (Japan); Izumo, Yoshiro
1998-11-01
Accumulation of {sup 137}Cs in trefoil (leaf and stem), ``Mitsuba``, Cryptotaenia japonica Hassk, with or without root was investigated to prepare higher radioactive plant in hydroponic culture medium (140-150 Bq/ml). It was found that {sup 137}Cs concentration in plant tissue was increased with time, as high as 1.6 times of that in the culture medium after 4 days. On the other hand, {sup 137}Cs concentration was affected by carrier element (Cs>6 ppm) and coexistent elements in the medium. Radioactivity of the plant after 4 days was shown to be sufficient for successive experiments. (author)
Wang, Daijie; Du, Ning; Wen, Lei; Zhu, Heng; Liu, Feng; Wang, Xiao; Du, Jinhua; Li, Shengbo
2017-02-02
In this work, the n-butanol extract from leaves of Lonicera japonica Thunb. (L. japonica) was reacted with DPPH and subjected to a HPLC analysis for the guided screening antioxidants (DPPH-HPLC experiments). Then, nine antioxidants, including flavonoid glycosides and caffeoylquinic acid derivatives, were isolated and purified from leaves of L. japonica using high speed counter-current chromatography (HSCCC) and prep-HPLC. The n-butanol extract was firstly isolated by HSCCC using methyl tert-butyl ether/n-butanol/acetonitrile/water (0.5% acetic acid) (2:2:1:5, v/v), yielding five fractions F1, F2 (rhoifolin), F3 (luteoloside), F4 and F5 (collected from the column after the separation). The sub-fractions F1, F4 and F5 were successfully separated by prep-HPLC. Finally, nine compounds, including chlorogenic acid (1), lonicerin (2), rutin (3), rhoifolin (4), luteoloside (5), 3,4-Odicaffeoylquinic acid (6), hyperoside (7), 3,5-O-dicaffeoylquinic acid (8), and 4,5-O-dicaffeoylquinic acid (9) were obtained, respectively, with the purities over 94% as determined by HPLC. The structures were identified by electrospray ionization mass spectrometry (ESI-MS), 1H- and 13C-NMR. Antioxidant activities were tested, and the isolated compounds showed strong antioxidant activities.
Yılmaz S; Tatli Seven P; Kaya E
2017-01-01
This study discovers the possible effect propolis, royal jelly, bee pollen and Ronozyme supplementation in diets that can be beneficial for Japanese quails (Coturnix coturnix japonica). Total one hundred and sixty Japanese quails at 43 days of age were used and divided randomly into 4 replicate groups each containing 32 animals. The experimental groups as follows: control group was feed a basal diet, royal jelly group was added to the water with 500 mg/kg diet, propolis group was feed orally ...
Directory of Open Access Journals (Sweden)
Damian Chmura
2016-09-01
Full Text Available Nitrate reductase activity (NRA was studied in the invasive alien plant F. japonica (Japanese knotweed during the vegetation season and among natural, semi-natural, and human-made habitats and compared with NRA in selected native species. NRA was measured directly in the field from the beginning of May until the beginning of October. NRA was much higher than in the plant’s native range, i.e., East Asia, and showed a high degree of variation over time with the highest values being reached at the stage of fast vegetative growth and at the beginning of fruiting. NRA was highest on dumping sites probably due to the high nitrogen input into soils and near traffic and the emission of NOx by vehicles. A comparison of the enzyme activity in four selected native plant species indicated that NRA in F. japonica was the highest with the exception of Urtica dioica, which exhibited a similar activity of the enzyme. A detailed comparison with this species showed that differences between these species on particular dates were influenced by differences in the phenology of both plants. The initial results that were obtained suggest that nitrogen pollution in an environment can contribute to habitat invasibility and a high level of NRA, which in addition to the many plant traits that are commonly accepted as characteristic of invasiveness features, may be an important factor that enhances invasion success.
Breeding of Hangtian 36-an early-maturing variety of japonica rice by space mutation technique
International Nuclear Information System (INIS)
Wang Junmin; Luo Rongting; Bao Genliang; Zhang Mingxian; Xu Jianlong; Wu Wei
2007-01-01
Hangtian 36; an early-maturing late Japonica rice variety with high grain quality and disease resistance was developed from the mutagenesis progeny of Bing 1067 carried by the recoverable satellite. Hangtian 36 has advantages over the original variety Bing 1067 in mature duration, grain quality and blast resistance. It has strong tolerant ability to late sow, varying from sowing date of single cropping to the end of July. So it is an ideal variety suitable for the use of emergency situation, such as in the natural disaster year resulting from typhoon. This variety was officially registered by Zhejiang Committee on Variety Registration in 2006, and is adaptable in the region of Zhejiang province and the Yangtze River delta. The successful breeding of Hangtian 36 showed that space mutation is an effective method of simultaneous improvement for multiple traits of rice. (authors)
Hozumi, Akitaka; Bera, Subhankar; Fujiwara, Daiki; Obayashi, Takeshi; Yokoyama, Ryusuke; Nishitani, Kazuhiko; Aoki, Koh
2017-11-01
Stem parasitic plants (Cuscuta spp.) develop a specialized organ called a haustorium to penetrate their hosts' stem tissues. To reach the vascular tissues of the host plant, the haustorium needs to overcome the physical barrier of the cell wall, and the parasite-host interaction via the cell wall is a critical process. However, the cell wall components responsible for the establishment of parasitic connections have not yet been identified. In this study, we investigated the spatial distribution patterns of cell wall components at a parasitic interface using parasite-host complexes of Cuscuta campestris-Arabidopsis thaliana and Cuscuta japonica-Glycine max. We focused on arabinogalactan proteins (AGPs), because AGPs accumulate in the cell walls of searching hyphae of both C. campestris and C. japonica. We found more AGPs in elongated haustoria than in pre haustoria, indicating that AGP accumulation is developmentally regulated. Using in situ hybridization, we identified five genes in C. campestris that encode hyphal-expressed AGPs that belong to the fasciclin-like AGP (FLA) family, which were named CcFLA genes. Three of the five CcFLA genes were expressed in the holdfast, which develops on the Cuscuta stem epidermis at the attachment site for the host's stem epidermis. Our results suggest that AGPs are involved in hyphal elongation and adhesion to host cells, and in the adhesion between the epidermal tissues of Cuscuta and its host. © The Author 2017. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Protective Effect of Laminaria japonica with Probiotics on Murine Colitis
Directory of Open Access Journals (Sweden)
Seok-Jae Ko
2014-01-01
Full Text Available Inflammatory bowel disease (IBD is a chronically relapsing inflammatory disorder of the gastrointestinal tract. Most IBD treatments are unsatisfactory; therefore, various dietary supplements have emerged as promising interventions. Laminaria japonica (LJ is an edible seaweed used to regulate digestive symptoms. Probiotics have been reported to improve digestive problems and their simultaneous administration with seaweeds has been shown to produce synergistic therapeutic effects. Here, we investigated the effect of LJ combination with probiotics on dextran sodium sulfate-induced colitis model in mice. Aqueous LJ extracts (LJE at doses from 100 to 300 mg/kg and probiotics at a dose of 300 mg/kg were orally administered for 7 days. Body weight, colon length, histological score, macroscopic damage, and the levels of cytokines IFN-γ, IL-1β, IL-6, IL-10, IL-12 (P40, IL-12 (P70, IL-17, and TNF-α were assessed. LJE alone caused a significant improvement of colitis signs such as colon length, histological score, and IL-1β and IL-6 production. LJE and probiotics demonstrated a synergistic effect by the histological score and levels of IL-1β, IL-6, and IL-12 (P40 but not IFN-γ, IL-10, and IL-12 (P70. In conclusion, LJE was effective in inducing protection against colitis in mice and acted synergistically with probiotics.
Directory of Open Access Journals (Sweden)
Luhua Zhang
Full Text Available Currently, the purity of hybrid seed is a crucial limiting factor when developing hybrid japonica rice (Oryza sativa L.. To chemically control hybrid seed purity, we transferred an improved atrazine chlorohydrolase gene (atzA from Pseudomonas ADP into hybrid japonica parental lines (two maintainers, one restorer, and Nipponbare, by using Agrobacterium-mediated transformation. We subsequently selected several transgenic lines from each genotype by using PCR, RT-PCR, and germination analysis. In the presence of the investigated atrazine concentrations, particularly 150 µM atrazine, almost all of the transgenic lines produced significantly larger seedlings, with similar or higher germination percentages, than did the respective controls. Although the seedlings of transgenic lines were taller and gained more root biomass compared to the respective control plants, their growth was nevertheless inhibited by atrazine treatment compared to that without treatment. When grown in soil containing 2 mg/kg or 5 mg/kg atrazine, the transgenic lines were taller, and had higher total chlorophyll contents than did the respective controls; moreover, three of the strongest transgenic lines completely recovered after 45 days of growth. After treatment with 2 mg/kg or 5 mg/kg of atrazine, the atrazine residue remaining in the soil was 2.9-7.0% or 0.8-8.7% respectively, for transgenic lines, and 44.0-59.2% or 28.1-30.8%, respectively, for control plants. Spraying plants at the vegetative growth stage with 0.15% atrazine effectively killed control plants, but not transgenic lines. Our results indicate that transgenic atzA rice plants show tolerance to atrazine, and may be used as parental lines in future hybrid seed production.
Directory of Open Access Journals (Sweden)
Wijaya Edward
2010-01-01
Full Text Available Abstract Background The transcriptional regulatory network involved in low temperature response leading to acclimation has been established in Arabidopsis. In japonica rice, which can only withstand transient exposure to milder cold stress (10°C, an oxidative-mediated network has been proposed to play a key role in configuring early responses and short-term defenses. The components, hierarchical organization and physiological consequences of this network were further dissected by a systems-level approach. Results Regulatory clusters responding directly to oxidative signals were prominent during the initial 6 to 12 hours at 10°C. Early events mirrored a typical oxidative response based on striking similarities of the transcriptome to disease, elicitor and wounding induced processes. Targets of oxidative-mediated mechanisms are likely regulated by several classes of bZIP factors acting on as1/ocs/TGA-like element enriched clusters, ERF factors acting on GCC-box/JAre-like element enriched clusters and R2R3-MYB factors acting on MYB2-like element enriched clusters. Temporal induction of several H2O2-induced bZIP, ERF and MYB genes coincided with the transient H2O2 spikes within the initial 6 to 12 hours. Oxidative-independent responses involve DREB/CBF, RAP2 and RAV1 factors acting on DRE/CRT/rav1-like enriched clusters and bZIP factors acting on ABRE-like enriched clusters. Oxidative-mediated clusters were activated earlier than ABA-mediated clusters. Conclusion Genome-wide, physiological and whole-plant level analyses established a holistic view of chilling stress response mechanism of japonica rice. Early response regulatory network triggered by oxidative signals is critical for prolonged survival under sub-optimal temperature. Integration of stress and developmental responses leads to modulated growth and vigor maintenance contributing to a delay of plastic injuries.
Qiu, Yongfu; Guo, Jianping; Jing, Shengli; Zhu, Lili; He, Guangcun
2012-02-01
The brown planthopper (Nilaparvata lugens Stål; BPH) has become a severe constraint on rice production. Identification and pyramiding BPH-resistance genes is an economical and effective solution to increase the resistance level of rice varieties. All the BPH-resistance genes identified to date have been from indica rice or wild species. The BPH12 gene in the indica rice accession B14 is derived from the wild species Oryza latifolia. Using an F(2) population from a cross between the indica cultivar 93-11 and B14, we mapped the BPH12 gene to a 1.9-cM region on chromosome 4, flanked by the markers RM16459 and RM1305. In this population, BPH12 appeared to be partially dominant and explained 73.8% of the phenotypic variance in BPH resistance. A near-isogenic line (NIL) containing the BPH12 locus in the background of the susceptible japonica variety Nipponbare was developed and crossed with a NIL carrying BPH6 to generate a pyramid line (PYL) with both genes. BPH insects showed significant differences in non-preference in comparisons between the lines harboring resistance genes (NILs and PYL) and Nipponbare. BPH growth and development were inhibited and survival rates were lower on the NIL-BPH12 and NIL-BPH6 plants compared to the recurrent parent Nipponbare. PYL-BPH6 + BPH12 exhibited 46.4, 26.8 and 72.1% reductions in population growth rates (PGR) compared to NIL-BPH12, NIL-BPH6 and Nipponbare, respectively. Furthermore, insect survival rates were the lowest on the PYL-BPH6 + BPH12 plants. These results demonstrated that pyramiding different BPH-resistance genes resulted in stronger antixenotic and antibiotic effects on the BPH insects. This gene pyramiding strategy should be of great benefit for the breeding of BPH-resistant japonica rice varieties.
Yun, Kil-Young
2010-01-25
Background: The transcriptional regulatory network involved in low temperature response leading to acclimation has been established in Arabidopsis. In japonica rice, which can only withstand transient exposure to milder cold stress (10C), an oxidative-mediated network has been proposed to play a key role in configuring early responses and short-term defenses. The components, hierarchical organization and physiological consequences of this network were further dissected by a systems-level approach.Results: Regulatory clusters responding directly to oxidative signals were prominent during the initial 6 to 12 hours at 10C. Early events mirrored a typical oxidative response based on striking similarities of the transcriptome to disease, elicitor and wounding induced processes. Targets of oxidative-mediated mechanisms are likely regulated by several classes of bZIP factors acting on as1/ocs/TGA-like element enriched clusters, ERF factors acting on GCC-box/JAre-like element enriched clusters and R2R3-MYB factors acting on MYB2-like element enriched clusters.Temporal induction of several H2O2-induced bZIP, ERF and MYB genes coincided with the transient H2O2spikes within the initial 6 to 12 hours. Oxidative-independent responses involve DREB/CBF, RAP2 and RAV1 factors acting on DRE/CRT/rav1-like enriched clusters and bZIP factors acting on ABRE-like enriched clusters. Oxidative-mediated clusters were activated earlier than ABA-mediated clusters.Conclusion: Genome-wide, physiological and whole-plant level analyses established a holistic view of chilling stress response mechanism of japonica rice. Early response regulatory network triggered by oxidative signals is critical for prolonged survival under sub-optimal temperature. Integration of stress and developmental responses leads to modulated growth and vigor maintenance contributing to a delay of plastic injuries. 2010 Yun et al; licensee BioMed Central Ltd.
Tsurui, Kaori; Honma, Atsushi; Nishida, Takayoshi
2010-07-06
Colour-marking polymorphism is widely distributed among cryptic species. To account for the adaptive significance of such polymorphisms, several hypotheses have been proposed to date. Although these hypotheses argue over the degree of camouflage effects of marking morphs (and the interactions between morphs and their microhabitat backgrounds), as far as we know, most empirical evidence has been provided under unnatural conditions (i.e., using artificial prey). Tetrix japonica, a pygmy grasshopper, is highly polymorphic in colour-markings and occurs in both sand and grass microhabitats. Even within a microhabitat, T. japonica is highly polymorphic. Using humans as dummy predators and printed photographs in which various morphs of grasshoppers were placed against different backgrounds, we addressed three questions to test the neutral, background heterogeneity, and differential crypsis hypotheses in four marking-type morphs: 1) do the morphs differ in the degree of crypsis in each microhabitat, 2) are different morphs most cryptic in specific backgrounds of the microhabitats, and 3) does the morph frequency reflect the degree of crypsis? The degree of camouflage differed among the four morphs; therefore, the neutral hypothesis was rejected. Furthermore, the order of camouflage advantage among morphs differed depending on the two types of backgrounds (sand and grass), although the grass background consistently provided greater camouflage effects. Thus, based on our results, we could not reject the background heterogeneity hypothesis. Under field conditions, the more cryptic morphs comprised a minority of the population. Overall, our results demonstrate that the different morphs were not equivalent in the degree of crypsis, but the degree of camouflage of the morphs was not consistent with the morph frequency. These findings suggest that trade-offs exist between the camouflage benefit of body colouration and other fitness components, providing a better understanding of
Directory of Open Access Journals (Sweden)
Kaori Tsurui
2010-07-01
Full Text Available Colour-marking polymorphism is widely distributed among cryptic species. To account for the adaptive significance of such polymorphisms, several hypotheses have been proposed to date. Although these hypotheses argue over the degree of camouflage effects of marking morphs (and the interactions between morphs and their microhabitat backgrounds, as far as we know, most empirical evidence has been provided under unnatural conditions (i.e., using artificial prey.Tetrix japonica, a pygmy grasshopper, is highly polymorphic in colour-markings and occurs in both sand and grass microhabitats. Even within a microhabitat, T. japonica is highly polymorphic. Using humans as dummy predators and printed photographs in which various morphs of grasshoppers were placed against different backgrounds, we addressed three questions to test the neutral, background heterogeneity, and differential crypsis hypotheses in four marking-type morphs: 1 do the morphs differ in the degree of crypsis in each microhabitat, 2 are different morphs most cryptic in specific backgrounds of the microhabitats, and 3 does the morph frequency reflect the degree of crypsis?The degree of camouflage differed among the four morphs; therefore, the neutral hypothesis was rejected. Furthermore, the order of camouflage advantage among morphs differed depending on the two types of backgrounds (sand and grass, although the grass background consistently provided greater camouflage effects. Thus, based on our results, we could not reject the background heterogeneity hypothesis. Under field conditions, the more cryptic morphs comprised a minority of the population. Overall, our results demonstrate that the different morphs were not equivalent in the degree of crypsis, but the degree of camouflage of the morphs was not consistent with the morph frequency. These findings suggest that trade-offs exist between the camouflage benefit of body colouration and other fitness components, providing a better
Directory of Open Access Journals (Sweden)
Stanisław Pelc
2014-01-01
Full Text Available The outer and inner structure of wild apple (Malus silvestris Mill., common pear (Pyrus communis L. and Chaenomeles japonica (Thunb. Lindl. seeds was investigated. It was found that the outer structure exhibits good diagnostic features expressed in the first place in the relief of the seed coat and further in the arrangement and appearance of the site of attachment of the free end of the funiculus and the shape of the seeds. In ripe seeds there is, under the thick seed coat, an endosperm layer completely surrounding the embryo which has large cotyledons and a thick rootlet.
Influence of cooking on anthocyanins in black rice (Oryza sativa L. japonica var. SBR).
Hiemori, Miki; Koh, Eunmi; Mitchell, Alyson E
2009-03-11
The composition and thermal stability of anthocyanins in black rice (Oryza sativa L. japonica var. SBR) produced in California were investigated. Six anthocyanin pigments were identified and quantified by high performance liquid chromatography using photo diode-array detection (HPLC-PDA) and electrospray ionization mass spectrometry [LC-(ESI)MS/MS]. The predominant anthocyanins are cyanidin-3-glucoside (572.47 microg/g; 91.13% of total) and peonidin-3-glucoside (29.78 microg/g; 4.74% of total). Minor constituents included three cyanidin-dihexoside isomers and one cyanidin hexoside. Thermal stability of anthocyanins was assessed in rice cooked using a rice cooker, pressure cooker, or on a gas range. All cooking methods caused significant (P rice cooker (74.2%) and gas range (65.4%). Conversely, levels of protocatechuic acid increased 2.7 to 3.4 times in response to all cooking methods. These findings indicate that cooking black rice results in the thermal degradation of cyanidin-3-glucoside and concomitant production of protocatechuic acid.
New flavonol glycosides from the leaves of Triantha japonica and Tofieldia nuda.
Iwashina, Tsukasa; Tamura, Minoru N; Murai, Yoshinori; Kitajima, Junichi
2013-09-01
Two new flavonol glycosides were isolated from the leaves of Triantha japonica, together with eight known flavonols, kaempferol 3-O-sophoroside, kaempferol 3-O-sambubioside, kaempferol 3-O-glucosyl-(1 --> 2)-[glucosyl-(1 --> 6)-glucoside], quercetin 3-O-sophoroside, quercetin 3-O-sambubioside, isorhamnetin 3-O-glucoside, isorhamnetin 3-O-sophoroside and isorhamnetin 3-O-sambubioside. The new compounds were identified as kaempferol 3-O-beta-xylopyranosyl-(1 --> 2)-[beta-glucopyranosyl-(1 --> 6)-beta-glucopyranoside] (1) and isorhamnetin 3-O-beta-xylopyranosyl-(1 --> 2)-[beta-glucopyranosyl-(1 --> 6)-beta-glucopyranoside] (3) by UV, LC-MS, acid hydrolysis, and 1H and 13C NMR spectroscopy. Another two new flavonol glycosides were isolated from theleaves of Tofieldia nuda, and identified as kaempferol 3-O-beta-glucopyranosyl-(1 --> 2)-[beta-glucopyranosyl-(1 --> 6)-beta-galactopyranoside] (4) and quercetin 3-O-beta-glucopyranosyl-(1 --> 2)-[beta-glucopyranosyl-(1 --> 6)-beta-galactopyranoside] (5). Though the genera Triantha and Tofieldia were treated as Tofieldia sensu lato, they were recently divided into two genera. It was shown by this survey that their flavonoid composition were also different to each other.
Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki
2017-11-01
The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.
Directory of Open Access Journals (Sweden)
Luciana Vallorani
2004-01-01
Full Text Available Crude proteins and their amino acid composition, -carotene, vitamins B1, B2, B6, niacin and minerals were determined in two edible brown marine algae (Phaeophyceae, Wakame (Undaria pinnatifida and Kombu (Laminaria digitata japonica. The amino acid scores for five key essential amino acids, frequently deficient in mixed human diet, and essential amino acid index were calculated. The results have shown the presence of all essential amino acids. The values of essential amino acid ratios of analysed algae exceed the ratios of reference proteins suggested by FAO/WHO/UNU, except for tryptophan, the first limiting amino acid in both analysed algae. Iodine, the most important component of sea vegetables is present in high amounts as well as the vitamins B1, B2, B6, niacin and β-carotene. The content of minerals was found high, while the presence of heavy metals was negligible.
National Oceanic and Atmospheric Administration, Department of Commerce — Two species of eelgrass can be found in Padilla Bay, Washington (Zostera japonica and Zostera marina) and act as a bioindicators of ecosystem health. Many factors...
Park, J. H.; Kang, S. N.; Shin, D.; Hur, I. C.; Kim, I. S.; Jin, S. K.
2013-01-01
Influence of Achyranthes japonica Nakai Extract (AJNE) on properties of pork sausages were studied in the present investigation. AJNE was added to sausages alone or in combination with ascorbic acid to obtain a comparative analysis on properties of control and ascorbic acid added-sausages. Results showed that addition of 0.05% AJNE led to a decrease in color L* and whiteness (W), and an increase in color b* of pork sausage samples (psausages containing AJNE was not significantly different, ascorbic acid added-sausages were highest amongst other treatments (pSausages containing AJNE had lower non-heme iron values and peroxide value (POV) than control sausages (psausages (psausages (psausages. Free radical scavenging analysis showed that AJNE did not affect 1,1-diphenyl -2-picrylhydrazyl (DPPH) activity of sausages, whereas ascorbic acid added-sausages showed relatively higher activity among the samples (psausages. In sensory evaluation, AJNE treatment had significant effects on color (psausages, and appears to be particularly effective in inducing changes in non-heme iron concentration, POV value and nitrosomyglobin content. PMID:25049789
Kawamoto, M; Mikage, M
1999-01-01
The rhizome of Coptis plant of the family ranunculaceae has been used in traditional Chinese medicine as a crude drug (Huanglian in present Chinese). In Japan, the rhizome of Coptis japonica Makino (the botanical name of which is "Ohren" in modern Japanese) has been utilized as a crude drug since the Nara era. The Japanese name in those days was "Kakumakusa based on descriptions in old books written in the Heian era. It changed to "Kakumikusa" early in the Edo era, and then changed again to Kakumakusa later in the Edo era. Through this herbological study, it was conjectured as follows: The resemblance between Chinese characters (or MA) and (or MI) in cursive style caused mis-copying of the character. After the "Honzo-wamyo, written in the Heian era, was revised in the late Edo era, and on which the name was accurately written as Kakumakusa, the mistake was corrected.
Tejakhod, Sujittra; Hammond, John P.; Ellis, Richard H.
2018-01-01
Flooding damages rice crops and its incidence is increasing. Foliar spray applications of molybdenum (100, 600 or 3000 mg Mo L-1), abscisic acid (ABA, 50 μM), or deionised water (control) were made to pot-grown plants of the Japonica rice cv. Gleva at flag leaf appearance to determine their effects on seed yield and pre-harvest sprouting after flooding. Plants were submerged , to simulate flooding, for four days from 20 or 30 days after anthesis (DAA). Seed yield per plant, seed weight, and p...
Three synonymous genes encode calmodulin in a reptile, the Japanese tortoise, Clemmys japonica
Directory of Open Access Journals (Sweden)
Kouji Shimoda
2002-01-01
Full Text Available Three distinct calmodulin (CaM-encoding cDNAs were isolated from a reptile, the Japanese tortoise (Clemmys japonica, based on degenerative primer PCR. Because of synonymous codon usages, the deduced amino acid (aa sequences were exactly the same in all three genes and identical to the aa sequence of vertebrate CaM. The three cDNAs, referred to as CaM-A, -B, and -C, seemed to belong to the same type as CaMI, CaMII, and CaMIII, respectively, based on their sequence identity with those of the mammalian cDNAs and the glutamate codon biases. Northern blot analysis detected CaM-A and -B as bands corresponding to 1.8 kb, with the most abundant levels in the brain and testis, while CaM-C was detected most abundantly in the brain as bands of 1.4 and 2.0 kb. Our results indicate that, in the tortoise, CaM protein is encoded by at least three non-allelic genes, and that the ‘multigene-one protein' principle of CaM synthesis is applicable to all classes of vertebrates, from fishes to mammals.
Tsurui, Kaori; Honma, Atsushi; Nishida, Takayoshi
2010-01-01
Background Colour-marking polymorphism is widely distributed among cryptic species. To account for the adaptive significance of such polymorphisms, several hypotheses have been proposed to date. Although these hypotheses argue over the degree of camouflage effects of marking morphs (and the interactions between morphs and their microhabitat backgrounds), as far as we know, most empirical evidence has been provided under unnatural conditions (i.e., using artificial prey). Methodology/Principal Findings Tetrix japonica, a pygmy grasshopper, is highly polymorphic in colour-markings and occurs in both sand and grass microhabitats. Even within a microhabitat, T. japonica is highly polymorphic. Using humans as dummy predators and printed photographs in which various morphs of grasshoppers were placed against different backgrounds, we addressed three questions to test the neutral, background heterogeneity, and differential crypsis hypotheses in four marking-type morphs: 1) do the morphs differ in the degree of crypsis in each microhabitat, 2) are different morphs most cryptic in specific backgrounds of the microhabitats, and 3) does the morph frequency reflect the degree of crypsis? Conclusions/Significance The degree of camouflage differed among the four morphs; therefore, the neutral hypothesis was rejected. Furthermore, the order of camouflage advantage among morphs differed depending on the two types of backgrounds (sand and grass), although the grass background consistently provided greater camouflage effects. Thus, based on our results, we could not reject the background heterogeneity hypothesis. Under field conditions, the more cryptic morphs comprised a minority of the population. Overall, our results demonstrate that the different morphs were not equivalent in the degree of crypsis, but the degree of camouflage of the morphs was not consistent with the morph frequency. These findings suggest that trade-offs exist between the camouflage benefit of body colouration
Mochizuki, Tomoki; Amagai, Takashi; Tani, Akira
2018-04-11
Monoterpenes emitted from plants contribute to the formation of secondary pollution and affect the climate system. Monoterpene emission rates may be affected by environmental changes such as increasing CO 2 concentration caused by fossil fuel burning and drought stress induced by climate change. We measured monoterpene emissions from Cryptomeria japonica clone saplings grown under different CO 2 concentrations (control: ambient CO 2 level, elevated CO 2 : 1000μmolmol -1 ). The saplings were planted in the ground and we did not artificially control the SWC. The relationship between the monoterpene emissions and naturally varying SWC was investigated. The dominant monoterpene was α-pinene, followed by sabinene. The monoterpene emission rates were exponentially correlated with temperature for all measurements and normalized (35°C) for each measurement day. The daily normalized monoterpene emission rates (E s0.10 ) were positively and linearly correlated with SWC under both control and elevated CO 2 conditions (control: r 2 =0.55, elevated CO 2 : r 2 =0.89). The slope of the regression line of E s0.10 against SWC was significantly higher under elevated CO 2 than under control conditions (ANCOVA: P<0.01), indicating that the effect of CO 2 concentration on monoterpene emission rates differed by soil water status. The monoterpene emission rates estimated by considering temperature and SWC (Improved G93 algorithm) better agreed with the measured monoterpene emission rates, when compared with the emission rates estimated by considering temperature alone (G93 algorithm). Our results demonstrated that the combined effects of SWC and CO 2 concentration are important for controlling the monoterpene emissions from C. japonica clone saplings. If these relationships can be applied to the other coniferous tree species, our results may be useful to improve accuracy of monoterpene emission estimates from the coniferous forests as affected by climate change in the present and
Directory of Open Access Journals (Sweden)
Simon M. Dittami
2017-11-01
Full Text Available Modern genome sequencing strategies are highly sensitive to contamination making the detection of foreign DNA sequences an important part of analysis pipelines. Here we use Taxoblast, a simple pipeline with a graphical user interface, for the post-assembly detection of contaminating sequences in the published genome of the kelp Saccharina japonica. Analyses were based on multiple blastn searches with short sequence fragments. They revealed a number of probable bacterial contaminations as well as hybrid scaffolds that contain both bacterial and algal sequences. This or similar types of analysis, in combination with manual curation, may thus constitute a useful complement to standard bioinformatics analyses prior to submission of genomic data to public repositories. Our analysis pipeline is open-source and freely available at http://sdittami.altervista.org/taxoblast and via SourceForge (https://sourceforge.net/projects/taxoblast.
An accelerated hologram calculation using the wavefront recording plane method and wavelet transform
Arai, Daisuke; Shimobaba, Tomoyoshi; Nishitsuji, Takashi; Kakue, Takashi; Masuda, Nobuyuki; Ito, Tomoyoshi
2017-06-01
Fast hologram calculation methods are critical in real-time holography applications such as three-dimensional (3D) displays. We recently proposed a wavelet transform-based hologram calculation called WASABI. Even though WASABI can decrease the calculation time of a hologram from a point cloud, it increases the calculation time with increasing propagation distance. We also proposed a wavefront recoding plane (WRP) method. This is a two-step fast hologram calculation in which the first step calculates the superposition of light waves emitted from a point cloud in a virtual plane, and the second step performs a diffraction calculation from the virtual plane to the hologram plane. A drawback of the WRP method is in the first step when the point cloud has a large number of object points and/or a long distribution in the depth direction. In this paper, we propose a method combining WASABI and the WRP method in which the drawbacks of each can be complementarily solved. Using a consumer CPU, the proposed method succeeded in performing a hologram calculation with 2048 × 2048 pixels from a 3D object with one million points in approximately 0.4 s.
Isolation of antiosteoporotic compounds from seeds of Sophora japonica.
Directory of Open Access Journals (Sweden)
Hossam M Abdallah
Full Text Available Chemical investigation of Sophora japonica seeds resulted in the isolation of seven metabolites identified as: genistin (1, sophoricoside (2, sophorabioside (3, sophoraflavonoloside (4, genistein 7,4'-di-O-β-D-glucopyransoide (5, kaempferol 3-O-α-L-rhamnopyranosyl(1 → 6β-D-glucopyranosyl(1 → 2β-D-glucopyranoside (6 and rutin (7. Compounds 1, 2 and 5 showed significant estrogenic proliferative effect in MCF-7 cell in sub-cytotoxic concentration range. Compounds 1 and 2 showed minimal cell membrane damaging effect using LDH leakage assay. Accordingly, compound 2 (sophoricoside, (SPH was selected for further in-vivo studies as a potential anti-osteoporosis agent. The anti-osteoporotic effect of SPH was assessed in ovarectomized (OVX rats after oral administration (15 mg/kg and 30 mg/kg for 45 days compared to estradiol (10 µg/kg as a positive control. Only in a dose of 30 mg/kg, SPH regained the original mechanical bone hardness compared to normal non-osteoporotic group. However, SPH (15 mg/kg significantly increased the level of alkaline phosphatase (ALP to normal level. Treatment with SPH (30 mg/kg increased the level of ALP to be higher than normal group. SPH (15 mg/kg did not significantly increase the serum level of osteocalcin (OC compared to OVX group. On the other hand, treatment with SPH (30 mg/kg significantly increased the level of OC to 78% higher than normal non-ovarectomized animals group. In addition, SPH (15 mg/kg decreased the bone resorption marker, acid phosphatase (ACP to normal level and SPH (30 mg/kg further diminished the level of serum ACP. Histopathologically, sophoricoside ameliorated the ovarectomy induced osteoporosis in a dose dependent manner. The drug showed thicker bony trabeculae, more osteoid, and more osteoblastic rimming compared to OVX group.
Directory of Open Access Journals (Sweden)
Ai-Li Guo
2014-10-01
Full Text Available Lonicera japonica flos is widely used as a pharmaceutical resource and a commonly-employed ingredient in healthy food, soft beverages and cosmetics in China. Sometimes, sulfur fumigation is used during post-harvest handling. In this study, a comprehensive comparison of the chemical profile between sun-dried and sulfur-fumigated samples was conducted by HPLC fingerprints and simultaneous quantification of nine constituents, including secologanic acid, along with another eight usually-analyzed markers. Secologanic acid was destroyed, and its sulfonates were generated, whereas caffeoylquinic acids were protected from being oxidized. The residual sulfur dioxide in sulfur-fumigated samples was significantly higher than that in sun-dried samples, which might increase the potential incidence of toxicity to humans. Meanwhile, compared with sun-dried samples, sulfur-fumigated samples have significantly stronger antioxidant activity, which could be attributed to the joint effect of protected phenolic acids and flavonoids, as well as newly-generated iridoid sulfonates.
Directory of Open Access Journals (Sweden)
Santin Elizabeth
2003-01-01
Full Text Available This study aimed at evaluating the use of scanning electron microscopy in the study of the post-vaccinal respiratory reaction of the tracheal epithelium of quails (Coturnix coturnix japonica immunized against Newcastle disease. A number of 36 quails were distributed into four groups: T1 fraction three-quarters control birds (non-vaccinated; T2 fraction three-quarters birds vaccinated with Ulster 2C strain; t3 fraction three-quarters birds vaccinated with B1 strain; t4 fraction three-quarters birds vaccinated with LaSota strain. Regardless the experimental group, birds did not show detectable clinical signs of post-vaccinal respiratory reaction. However, the analysis of tracheal fragments by scanning electron microscopy showed that birds vaccinated with B1 and LaSota strains developed epithelial sloughing of the trachea, whereas those vaccinated Ulster 2C strain did not develop this change, demonstrating intact tracheal epithelium, similar to the control group.
Effect of laminaria japonica polysaccharides (LJP) on radiation damage of testis tissue in male rats
International Nuclear Information System (INIS)
Ren Shicheng; Luo Qiong; Yang Mingliang; Yang Jiajuan; Yan Jun; Li Zhuoneng; Wang Lihong; Cui Xiaoyan
2007-01-01
Objective: To observe the effect of laminaria japonica polysaccharides (LJP) on local radiation damage of testis tissue in male rats. Methods: The Wistar rats were randomly divided into 4 groups: the normal group, the model group, positive control group and LJP treatment group (50 mg·kg -1 ·d -1 ). LJP was applied to the treatment group for 10 d before local irradiation with γ-ray (6.0 Gy). The morphological change of the testis, organ index of testis and epididymides, sperm count, motility rate, superoxide dismutase (SOD) activity and malonic aldehyde (MDA) contents were measured. Results: LJP could make the damaged testis recover to near normal, elevate the organ index of testis and epididymides, promote the sperm count and motility rate, increase the activity of SOD and decrease the contents of MDA in testis tissue. Conclusions: LJP could inhibit testis tissue damage induced by local radiation, hence enhance the significant radioprotective effect to testis tissue. LJP has the conspicuous protective effect on radiation damage of testis tissue. (authors)
International Nuclear Information System (INIS)
Wang, Y.; Deng, Q.; Zeng, J.; Zhang, J.
2017-01-01
Loquat (Eriobotrya japonica Lindl.) is an important subtropical fruit; however, loquat fruitlets are vulnerable to cold injury in winter, which significantly decreases loquat yield in most production regions. In the present study, two loquat cultivars ('Dawuxing' and '4-1-5') and one wild loquat (E. bengalensis Hook., Bengal loquat), were used for interspecific hybridization to produce hybrids with characteristics of spring blooming to avoid cold injury of fruitlets. Hybrid seedlings were derived from direct cross (loquat as female parent and Bengal loquat as male parent) and reciprocal cross. The authenticity of 47 hybrid seedlings was confirmed using inter-simple sequence repeat (ISSR) molecular markers; and leaf morphological characteristics of the hybrid offspring and parents were preliminarily studied and compared. The results suggested that 23 true direct cross hybrids and 12 true reciprocal cross hybrids were obtained, with hybrid authenticity rates of 100 and 50.0%, respectively. Thus, a novel method of distant hybridization for loquat breeding was developed, and with their various genetic and morphological characteristics these hybrids could be valuable germplasms for horticultural use. (author)
Directory of Open Access Journals (Sweden)
Jia Yulin
2007-06-01
Full Text Available Abstract Background Plants respond to low temperature through an intricately coordinated transcriptional network. The CBF/DREB-regulated network of genes has been shown to play a prominent role in freeze-tolerance of Arabidopsis through the process of cold acclimation (CA. Recent evidence also showed that the CBF/DREB regulon is not unique to CA but evolutionarily conserved between chilling-insensitive (temperate and chilling-sensitive (warm-season plants. In this study, the wide contrast in chilling sensitivity between indica and japonica rice was used as model to identify other regulatory clusters by integrative analysis of promoter architecture (ab initio and gene expression profiles. Results Transcriptome analysis in chilling tolerant japonica rice identified a subset of 121 'early response' genes that were upregulated during the initial 24 hours at 10°C. Among this group were four transcription factors including ROS-bZIP1 and another larger sub-group with a common feature of having as1/ocs-like elements in their promoters. Cold-induction of ROS-bZIP1 preceded the induction of as1/ocs-like element-containing genes and they were also induced by exogenous H2O2 at ambient temperature. Coordinated expression patterns and similar promoter architectures among the 'early response' genes suggest that they belong to a potential regulon (ROS-bZIP – as1/ocs regulatory module that responds to elevated levels of ROS during chilling stress. Cultivar-specific expression signatures of the candidate genes indicate a positive correlation between the activity of the putative regulon and genotypic variation in chilling tolerance. Conclusion A hypothetical model of an ROS-mediated regulon (ROS-bZIP – as1/ocs triggered by chilling stress was assembled in rice. Based on the current results, it appears that this regulon is independent of ABA and CBF/DREB, and that its activation has an important contribution in configuring the rapid responses of rice seedlings
Crystallization and preliminary X-ray crystallographic analysis of dioscorin from Dioscorea japonica
International Nuclear Information System (INIS)
Xue, You-Lin; Miyakawa, Takuya; Sawano, Yoriko; Tanokura, Masaru
2012-01-01
Dioscorin from D. japonica was expressed, purified and crystallized using the sitting-drop vapour-diffusion method. The dioscorin crystal diffracted X-rays to 2.11 Å resolution. Dioscorin, the major tuber storage protein in yam, has been reported to possess carbonic anhydrase, trypsin inhibitor, angiotensin-converting enzyme (ACE) inhibitor, free-radical scavenger, dehydroascorbate reductase and monodehydroascorbate reductase activities. Recent research has also found that dioscorin can enhance immune modulation via the toll-like receptor 4 (TLR-4) signal transduction pathway in RAW 264.7 cells, murine bone-marrow cells and human monocytes ex vivo. Resolving the structure of dioscorin would help in better understanding its activities and would provide clues to understanding the mechanism of its multiple functions. The full-length protein (residues 1–246) with an additional His 6 tag at the N-terminus was expressed in Escherichia coli Rosetta (DE3) cells. After His-tag cleavage and purification, the protein was crystallized by the sitting-drop vapour-diffusion method at 278 K. An X-ray diffraction data set was collected to a resolution of 2.11 Å using a synchrotron X-ray source. The crystal belonged to space group C222 1 , with unit-cell parameters a = 83.5, b = 156.8, c = 83.6 Å, and was estimated to contain two protein molecules per asymmetric unit
McGary, S.; Henry, P.F.P.; Ottinger, M.A.
2001-01-01
The impact of endocrine-disrupting chemicals (EDCs) has been demonstrated in mammalian models, but less research is available for avian species. The effects of vinclozolin (VIN), an antiandrogenic fungicide, on sexual differentiation and maturation were investigated in Japanese quail (Coturnix coturnix japonica). On day 4 of incubation, embryos were exposed to no treatment, oil, or 25, 50, or 100 ppm of VIN. Endpoints measured included adult male reproductive behavior, hypothalamic gonadotropin-releasing hormone I (GnRH-I) content in hatchlings and adults, plasma steroid levels in hatchlings and adults, proctodeal gland growth during maturation, and relative testicular weight at seven weeks of age. Results showed that exposure to VIN significantly (p < 0.05) altered GnRH-I in male hatchlings, whereas GnRH-I levels in females remained unaffected. Although steroid levels were unaltered by any VIN treatment, the display of male reproductive behavior seemed delayed, with the number of mounts and the number of cloacal contacts being significantly (p < 0.05) lower in the VIN-treated males. This could have an extreme negative impact on wild avian species that are routinely exposed to similar EDCs.
Studies on Schistosomiasis japonica and Saponins
Directory of Open Access Journals (Sweden)
Edito Garcia
1980-01-01
Full Text Available The molluscicidal activity of the bark of Entada phaseoloides and extracts from tubers of its related specie, Entada parvifolia against Oncomelania quadrasi, the snail intermediate host of Shistosoma japonicum in the Philippines were determined.The commercial gogo bark applied to waters with O. quadrasi, in the proportion of 2 gms/liter will kill 100% of snails within 24 hours. At this concentration miracidia and cercariae of S. japonicum in the same waters will die within one hour, thus, making the water safe or noninfective for some time. At the dose 100 gms/sqm of water-covered terrestial snail habitats, provided previously cleared of vegetations, at least 90% of O. quadrasi will die within 24 hours. These measures can be practical on a self-help basis by inhabitants of schistosomiasis endemic areas where gogo plant grows or where its bark is marketed.At dilution of 1:5,000 saponin extracted from tubers of E. parvifolia killed at least 90% of snails after 24 hours exposure while ethanol (crude saponin and other extracts require at least 1:2,000 concentration to kill at least 90% of O. quadrasi. At these concentrations and the expenses and time involved in the preparation of these extracts, they are not economical or practical for large scale use of molluscicides.It is suggested that methods of extraction and purification which require little time of preparation and a cheaper but of higher recovery rate of molluscicidal principles be developed.Surveys of barrios in three towns of Leyte, endemic for Schistosomiasis japonica using the circum oval-precipitin test (COPT and stool examination in the same subjects were undertaken. Findings show that the use of blood COPT method is advantageous over that of the stool examination in schistosomiasis surveys as its prescribed procedure is simple, specific and more sensitive. Moreover, the prevalence rate it determined was higher than that obtained by the stool examination in all three towns studied with
Okuno, Yoshiharu; Marumoto, Shinsuke; Miyazawa, Mitsuo
2017-11-01
The compositions of the essential oils from three kinds of Cryptotaenia japonica Hassk ("Mitsuba" in Japanese, Kirimitsuba (KM), Nemitsuba (NM), and Itomitsuba (IM)) were investigated by capillary GC/GC-MS. The oils contained 53 volatile components, of which 95% were terpenoids. The major constituents were sesquiterpenoids, which were α-selinene (KM: 39.1%; NM: 38.4%; IM: 13.2%), β-selinene (15.5%, 15.2%, 4.8%), germacrene D (12.1%, 7.2%, 24.1%), trans-farnesene (11.1%, 6.0%, 10.9%), β-elemene (2.9%, 2.9%, 6.8%), and trans-caryophyllene (1.7%, 1.7%, 2.6%). The main sesquiterpene found in KM and NM was α-selinene and in IM was germacrene D. The major monoterpenes found were β-myrcene (3.8%, 6.7%, and 3.5%) and β-pinene (2.8%, 0.2%, and 1.4%).
Directory of Open Access Journals (Sweden)
Constâncio Bernardo dos Santos
2000-01-01
Full Text Available Cryptomeria japonica (L. F. D. Don. is a species of great potential for planting in elevated and cold regions of Brazil. It is remarkable for its fast growth, good adaptation to the climate and soil of Southern Brazil, and it also shows a good response to silvicultural technologies. In addition, it is notable for the quality and diversity of its raw material usage for the industries of pulp and paper, plywood, construction of houses, furniture, boats, ships, etc. The experimental plan was bifactorial in the entirely randomized design with 8 treatments, 5 repetitions with 40 seedlings per treatment. The results indicated that for the production of seedlings of this species, the substrate soil + vermiculite showed the best development of the seedlings in 120 cm3 containers.
Barbot, Yann Nicolas; Thomsen, Claudia; Thomsen, Laurenz; Benz, Roland
2015-09-18
The cultivation of macroalgae to supply the biofuel, pharmaceutical or food industries generates a considerable amount of organic residue, which represents a potential substrate for biomethanation. Its use optimizes the total resource exploitation by the simultaneous disposal of waste biomaterials. In this study, we explored the biochemical methane potential (BMP) and biomethane recovery of industrial Laminaria japonica waste (LJW) in batch, continuous laboratory and pilot-scale trials. Thermo-acidic pretreatment with industry-grade HCl or industrial flue gas condensate (FGC), as well as a co-digestion approach with maize silage (MS) did not improve the biomethane recovery. BMPs between 172 mL and 214 mL g(-1) volatile solids (VS) were recorded. We proved the feasibility of long-term continuous anaerobic digestion with LJW as sole feedstock showing a steady biomethane production rate of 173 mL g(-1) VS. The quality of fermentation residue was sufficient to serve as biofertilizer, with enriched amounts of potassium, sulfur and iron. We further demonstrated the upscaling feasibility of the process in a pilot-scale system where a CH₄ recovery of 189 L kg(-1) VS was achieved and a biogas composition of 55% CH₄ and 38% CO₂ was recorded.
International Nuclear Information System (INIS)
Kim, Kang Ho; Choi, Seung Hyun; Lee, Thomas S.; Oh, Won Keun; Kim, Dong Sun; Kim, Jae Bum
2006-01-01
Liver X receptors (LXRs) are nuclear hormone receptors that behave as lipid sensors of cellular cholesterol and fatty acid. Although LXR activation can alleviate hypercholesterolemia by inducing cholesterol efflux, it also results in undesirable effects of fatty acid synthesis, resulting in hepatic steatosis and hyperlipidemia. Therefore, it is critical to identify LXRα inhibitory agents that would repress fatty acid synthesis and hepatic lipid accumulation. In current study, screening of plant extracts used for traditional oriental medicine resulted in the identification of two candidates demonstrating selective LXRα inhibitory activity. These were whole leaf methanol extracts of Parthenocissua tricuspidata (MEH184) and Euscaphis japonica (MEH185). Both MEH184 and MEH185 decreased transcriptional activity of LXRα and the expression of LXRα target genes, such as FAS and ADD1/SREBP1c. Additionally, MEH184 and MEH184 significantly reduced lipogenesis and adipocyte differentiation. Together, the data imply that MEH184 and MEH185 possess selective antagonistic properties on LXRα to downregulate lipogenesis
Directory of Open Access Journals (Sweden)
Guo-zhen ZHAO
2009-09-01
Full Text Available The response of grain quality traits to cold-water irrigation and its correlation with cold tolerance were studied in 11 japonica rice varieties from Yunnan Province, China. The results indicated that the response of grain quality traits to the cold-water stress varied with rice varieties and grain quality traits. Under the cold-water stress, grain width, chalky rice rate, whiteness, 1000-grain weight, brown rice rate, taste meter value, peak viscosity, trough viscosity, breakdown viscosity and final viscosity significantly decreased, whereas grain length-width ratio, head rice rate, alkali digestion value, protein content and setback viscosity markedly increased. However, the other traits such as grain length, amylose content, milled rice rate, peak viscosity time and pasting temperature were not significantly affected by the cold-water stress. Significant correlations were discovered between phenotypic acceptability and cold response indices of taste meter value, protein content, peak viscosity and breakdown viscosity. Therefore, it would be very important to improve the cold tolerance of Yunnan rice varieties in order to stabilize and improve their eating quality.
Pinciroli, M; Domínguez-Perles, R; Abellán, A; Guy, A; Durand, T; Oger, C; Galano, J M; Ferreres, F; Gil-Izquierdo, A
2017-10-11
Phytoprostanes and phytofurans (PhytoPs and PhytoFs, respectively) are nonenzymatic lipid peroxidation products derived from α-linolenic acid (C18:3 n-3), considered biomarkers of oxidative degradation in plant foods. The present work profiled these compounds in white and brown grain flours and rice bran from 14 rice cultivars of the subspecies indica and japonica by ultrahigh performance liquid chromatography coupled to electrospray ionization and triple quadrupole mass spectrometry. For PhytoPs, the average concentrations were higher in rice bran (0.01-9.35 ng g -1 ) than in white and brown grain flours (0.01-1.17 ng g -1 ). In addition, the evaluation of rice flours for the occurrence PhytoFs evidenced average values 1.77, 4.22, and 10.30 ng g -1 dw in rice bran, brown grain flour, and white grain flour, respectively. A significant correlation was observed between total and individual compounds. The concentrations retrieved suggest rice bran as a valuable source of PhytoPs and PhytoFs that should be considered in further studies on bioavailability and bioactivity of such compounds.
International Nuclear Information System (INIS)
Chen Pingping; Zhang Xiaoming; Ye Shenghai; Zhao Ningchun; Lu Yanting; Liu Heqin; Jin Qingsheng; Yang Ling
2010-01-01
A lesion mimic mutant,obtained by radiation mutagenesis on the seeds of a japonica rice variety Zhejing 22, exhibited a lesion mimic phenotype during the whole growth stage under different environments. Genetic analysis indicated that the mutant trait was controlled by a single recessive gene named spl (t). Relying on simple sequence repeat (SSR) and recessive class analysis method to map the spl (t) gene with a F 2 population was constructed by crossing the mutant spl (t) with Zhenshan 97B.spl (t) was mapped in the interval of 0.8cM between RM7195 and RM27929 near centromere region on the short arm of chromosome 12.Blue trypan dye analyses indicated that the lesion mimic trait of the mutant was caused by the programmer cell death. Further study showed that the programmer cell death was caused by H 2 O 2 oxidative burst. By inoculation of bacterial leaf blight and blast strains, the resistances of the mutant were similar to the wild variety Zhejing 22. (authors)
Directory of Open Access Journals (Sweden)
Bruno P. Berto
2014-06-01
Full Text Available Antibacterial, anti-inflammatory and antiparasitic properties have been associated with the extract of pomegranate (Punica granatum in several animals and conditions. The Japanese quail (Coturnix japonica, originated from North Africa, Europe and Asia, is used worldwide as an experimental animal and model for aviculture. The current study investigated the effects of the pomegranate pericarp aqueous extract on the shedding, viability and morphometry of three Eimeria spp. from Japanese quails, besides the weight gain and genotoxic activity. Although the pomegranate is recognized by multiple properties, including anti-coccidial, in the current study the results are contrary. The treated group shed greater amount of oocysts; the sporulation times and viability were similar in both groups; despite some morphometric differences, these were not expressive; weight gains were similar; and the pomegranate had insignificant effect genotoxic. Finally, these results suggest that the pomegranate pericarp extract did not influence on Eimeira spp. from Japanese quails; therefore, the pomegranate pericarp extract is not suggested in the prevention/treatment of coccidiosis in Japanese quails, or at least not using methods of preparation and administration applied in this study.
Directory of Open Access Journals (Sweden)
Xiaojun Chen
Full Text Available Schistosomiasis is a helminthic disease that affects more than 200 million people. An effective vaccine would be a major step towards eliminating the disease. Studies suggest that T follicular helper (Tfh cells provide help to B cells to generate the long-term humoral immunity, which would be a crucial component of successful vaccines. Thus, understanding the biological characteristics of Tfh cells in patients with schistosomiasis, which has never been explored, is essential for vaccine design.In this study, we investigated the biological characteristics of peripheral memory Tfh cells in schistosomiasis patients by flow cytometry. Our data showed that the frequencies of total and activated peripheral memory Tfh cells in patients were significantly increased during Schistosoma japonicum infection. Moreover, Tfh2 cells, which were reported to be a specific subpopulation to facilitate the generation of protective antibodies, were increased more greatly than other subpopulations of total peripheral memory Tfh cells in patients with schistosomiasis japonica. More importantly, our result showed significant correlations of the percentage of Tfh2 cells with both the frequency of plasma cells and the level of IgG antibody. In addition, our results showed that the percentage of T follicular regulatory (Tfr cells was also increased in patients with schistosomiasis.Our report is the first characterization of peripheral memory Tfh cells in schistosomasis patients, which not only provides potential targets to improve immune response to vaccination, but also is important for the development of vaccination strategies to control schistosomiasis.
Barbot, Yann Nicolas; Thomsen, Claudia; Thomsen, Laurenz; Benz, Roland
2015-01-01
The cultivation of macroalgae to supply the biofuel, pharmaceutical or food industries generates a considerable amount of organic residue, which represents a potential substrate for biomethanation. Its use optimizes the total resource exploitation by the simultaneous disposal of waste biomaterials. In this study, we explored the biochemical methane potential (BMP) and biomethane recovery of industrial Laminaria japonica waste (LJW) in batch, continuous laboratory and pilot-scale trials. Thermo-acidic pretreatment with industry-grade HCl or industrial flue gas condensate (FGC), as well as a co-digestion approach with maize silage (MS) did not improve the biomethane recovery. BMPs between 172 mL and 214 mL g−1 volatile solids (VS) were recorded. We proved the feasibility of long-term continuous anaerobic digestion with LJW as sole feedstock showing a steady biomethane production rate of 173 mL g−1 VS. The quality of fermentation residue was sufficient to serve as biofertilizer, with enriched amounts of potassium, sulfur and iron. We further demonstrated the upscaling feasibility of the process in a pilot-scale system where a CH4 recovery of 189 L kg−1 VS was achieved and a biogas composition of 55% CH4 and 38% CO2 was recorded. PMID:26393620
Directory of Open Access Journals (Sweden)
Yann Nicolas Barbot
2015-09-01
Full Text Available The cultivation of macroalgae to supply the biofuel, pharmaceutical or food industries generates a considerable amount of organic residue, which represents a potential substrate for biomethanation. Its use optimizes the total resource exploitation by the simultaneous disposal of waste biomaterials. In this study, we explored the biochemical methane potential (BMP and biomethane recovery of industrial Laminaria japonica waste (LJW in batch, continuous laboratory and pilot-scale trials. Thermo-acidic pretreatment with industry-grade HCl or industrial flue gas condensate (FGC, as well as a co-digestion approach with maize silage (MS did not improve the biomethane recovery. BMPs between 172 mL and 214 mL g−1 volatile solids (VS were recorded. We proved the feasibility of long-term continuous anaerobic digestion with LJW as sole feedstock showing a steady biomethane production rate of 173 mL g−1 VS. The quality of fermentation residue was sufficient to serve as biofertilizer, with enriched amounts of potassium, sulfur and iron. We further demonstrated the upscaling feasibility of the process in a pilot-scale system where a CH4 recovery of 189 L kg−1 VS was achieved and a biogas composition of 55% CH4 and 38% CO2 was recorded.
Zhang, D; Miyase, T; Kuroyanagi, M; Umehara, K; Ueno, A
1996-04-01
Five new oleanane-type saponins, polygalasaponins XXVIII-XXXII, along with one known saponin, polygalasaponin XXIV, and one known acylated sucrose, tenuifoliside C, were isolated from the root of Polygala japonica. The structures of these new compounds were elucidated as 3-O-beta-D-glucopyranosyl pesenegenin 28-O-beta-D-xylopyranosyl (1-->4)-alpha-L-rhamnopyranosyl (1-->2)-beta-D-fucopyranosyl ester, 3-O-beta-D-glucopyranosyl presenegenin 28-O-beta-D-galactopyranosyl (1-->5)-beta-D-apiofuranosyl (1-->4)-beta-D-xylopyranosyl (1-->4)-alpha-L-rhamno-pyranosyl (1-->2)-beta-D-fucopyranosyl ester, 3-O-beta-D-glucopyranosyl presenegenin 28-O-beta-D-galactopyranosyl (1-->4)-beta-D-xylopyranosyl (1-->4)-alpha-L-rhamnopyranosyl (1-->2)-[4-O-p-methoxycinnamoyl]-[beta-D-glucopyranosyl (1-->3)]-beta-D-fucopyranosyl ester, 3-O-beta-D-glucopyranosyl presenegenin 28-O-alpha-L-arabinopyranosyl (1-->3)-beta-D-xylopyranosyl (1-->4)-[beta-D-apiofuranosyl (1-->3)]-alpha-L-rhamnopyranosyl (1-->2)-[4-O-3,4,5-trimethoxycinnamoyl]-beta-D-fucopyranosyl ester, 3-O-beta-D-glucopyranosyl persenegenin 28-O-alpha-L-arabinopyranosyl (1-->3)-beta-D-xylopyranosyl (1-->4)-[beta-D-apiofuranosyl (1-->3)-alpha-L-rhamnopyranosyl (1-->2)-[4-O-p-methoxycinnamoyl]-[alpha-L-rhamnopyranosyl (1-->3)-beta-D-fucopyranosyl ester, respectively, on the basis of spectroscopic and chemical evidence.
Energy Technology Data Exchange (ETDEWEB)
Mazaroni, Bruno Henrique Silveira; Turco, Jose Eduardo Piteli; Coan, Ruchele Marchiori; Gerolineto, Eduardo [Universidade Estadual Paulista (FCAV/UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias. Dept. de Engenharia Rural
2009-07-01
This study analyzed the cost of energy (electrical and diesel) in the irrigated cultivation of zoysiagrass (Zoysia japonica Steud.) The research was conducted at Green-Park Farm, located in Pitangueiras, SP. It measured the consumption of diesel oil from a diesel engine, brand MWM, turbinate, 6 cylinder, and model D-229. The price of diesel oil was obtained from the Agencia Nacional do Petroleo (ANP). We studied the economic subtracting the result from the sale of zoysiagrass, the cost of consumption of diesel oil. It estimated the consumption of electric energy of a three-phase induction motor of 175 CV, WEG brand, coupled to a centrifugal pump Mark Peerless brand, model XHE-5A. To determine the energy expenditure was obtained the value of the rate with the Companhia Paulista de Forca e Luz (CPFL). A comparison of costs was performed by subtracting the economic result from the sale of grass in the cost of energy consumption. The 'Sistema Tarifario Grupo A Horo-Sazonal Verde e/ ou Azul', with special discount for irrigating at night was the lowest cost of electricity and by comparing the result of the economic costs of energy, the electrical system was more efficient in the use of fuel (diesel). (author)
International Nuclear Information System (INIS)
Hsue, S.Y.; Xu, S.T.; He, Y.X.; Shi, F.H.; Shen, W.; Hsue, H.F.; Osborne, J.W.; Clarke, W.R.
1984-01-01
Vaccination of Chinese bovines (cattle and buffaloes) against Schistosomiasis japonica with 36 kR gamma-irradiated schistosomula was done for laboratory challenge and for field trials in China. Altogether, 61 bovines were used. All experimental animals were vaccinated 2-3 times with 10,000 irradiated schistosomula per time. For the laboratory challenge, all experimental and control cattle were challenged with 500 normal cercariae and each buffalo, with 2,000 cercariae. The laboratory-challenged bovines were killed after 54-57 days of challenge; the bovines for the field trial in the lightly endemic area, after 5 months in the field; and the bovines for the field trial in the heavily endemic area, after 58-63 days. When the animals were killed, the number of mature worms in the vaccinated (experimental) and non-vaccinated (control) animals was recorded and the percentage of worm reduction in each group was calculated. The first group, consisting of three vaccinated and three non-vaccinated cattle, was given a laboratory challenge; the worm reduction was 71.6%. The second group, consisting of two vaccinated and three non-vaccinated buffaloes, was also given a laboratory challenge; the worm reduction was 74.4%. The third group, consisting of seven vaccinated and eight non-vaccinated buffaloes, was utilized in a field trial in a lightly endemic area; the worm reduction was 75.6%. The fourth group, consisting of eight vaccinated and nine non-vaccinated cattle, and the fifth group, consisting of nine vaccinated and nine non-vaccinated buffaloes, were pastured in a heavily endemic area. The worm reduction was 65.1% in the fourth group and 75.7% in the fifth group
Uemura, Yuka; Sugimoto, Sachiko; Matsunami, Katsuyoshi; Otsuka, Hideaki; Takeda, Yoshio; Kawahata, Masatoshi; Yamaguchi, Kentaro
2013-03-01
From the branches of Microtropis japonica (Celastraceae), nine aliphatic glucosides, named microtropins A-I, were isolated. The 6-position of glucose was esterified with (2S,3R)-2-ethyl-2,3-dihydroxybutyric acid. Microtropins A-D contained a rare natured product nitrile functional group in their aglycones. The absolute structures of the (2S,3R)-2-ethyl-2,3-dihydroxybutyric acid moiety and aglycone of microtropin A were determined by an X-ray crystallographic method. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Longfei Zhao
2015-12-01
Full Text Available Abstract A total of 48 endophytic bacteria were isolated from surface-sterilized tissues of the medicinal plant Lonicera japonica, which is grown in eastern China; six strains were selected for further study based on their potential ability to promote plant growth in vitro (siderophore and indoleacetic acid production. The bacteria were characterized by phylogenetically analyzing their 16S rRNA gene similarity, by examining their effect on the mycelial development of pathogenic fungi, by testing their potential plant growth-promoting characteristics, and by measuring wheat growth parameters after inoculation. Results showed that the number of endophytic bacteria in L. japonica varied among different tissues, but it remained relatively stable in the same tissues from four different plantation locations. Among the three endophytic strains, strains 122 and 124 both had high siderophore production, with the latter showing the highest phosphate solubilization activity (45.6 mg/L and aminocyclopropane-1-carboxylic acid deaminase activity (47.3 nmol/mg/h. Strain 170 had the highest indoleacetic acid (IAA production (49.2 mg/L and cellulase and pectinase activities. After inoculation, most of the six selected isolates showed a strong capacity to promote wheat growth. Compared with the controls, the increase in the shoot length, root length, fresh weight, dry weight, and chlorophyll content was most remarkable in wheat seedlings inoculated with strain 130. The positive correlation between enzyme (cellulose and pectinase activity and inhibition rate on Fusarium oxysporum, the IAA production, and the root length of wheat seedlings inoculated with each tested endophytic strain was significant in regression analysis. Deformity of pathogenic fungal mycelia was observed under a microscope after the interaction with the endophytic isolates. Such deformity may be directly related to the production of hydrolytic bacterial enzymes (cellulose and pectinase. The six
Lee, Jong Seok; Jung, Woo Chul; Park, Seok Jae; Lee, Keun Eok; Shin, Won Cheol; Hong, Eock Kee
2013-04-01
In this study, the liquid culture conditions were optimized for maximal production of mycelial biomass and exo-polysaccharide by Paecilomyces japonica. The effects of medium composition, C/N ratio and physical parameters were investigated. From these experiments, 30 g glucose, 20 g yeast extract, 0.5 g KH2PO4, and 0.1 g CuCl2 2H2O in 1-l distilled water were found to be the most suitable carbon, nitrogen, and mineral sources, respectively. The optimal temperature, initial pH, agitation, and aeration were determined to be 27°C, uncontrolled pH, 400 rpm, and 1.0 vvm, respectively. Under these optimal conditions, the maximum mycelial growth and polysaccharides production were 23.1 g/l and 2.5 g/l, respectively. Copyright © 2012 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Shen, Jin-Jing; Gong, Xing-Chu; Pan, Jian-Yang; Qu, Hai-Bin
2017-03-01
Design space approach was applied in this study to optimize the lime milk precipitation process of Lonicera Japonica (Jinyinhua) aqueous extract. The evaluation indices for this process were total organic acid purity and amounts of 6 organic acids obtained from per unit mass of medicinal materials. Four critical process parameters (CPPs) including drop speed of lime milk, pH value after adding lime milk, settling time and settling temperature were identified by using the weighted standardized partial regression coefficient method. Quantitative models between process evaluation indices and CPPs were established by a stepwise regression analysis. A design space was calculated by a Monte-Carlo simulation method, and then verified. The verification test results showed that the operation within the design space can guarantee the stability of the lime milk precipitation process. The recommended normal operation space is as follows: drop speed of lime milk of 1.00-1.25 mL•min⁻¹, pH value of 11.5-11.7, settling time of 1.0-1.2 h, and settling temperature of 10-20 ℃.. Copyright© by the Chinese Pharmaceutical Association.
Istiqomah, L.; Sakti, A. A.; Suryani, A. E.; Karimy, M. F.; Anggraeni, A. S.; Herdian, H.
2017-12-01
The objective of this study was to evaluate the effect of feed supplement (FS) contained earthworm meal (EWM) on production performance of laying quails. Twenty weeks-old of 360 Coturnix coturnix japonica quails were used in a Completely Randomized Design (CRD) with three dietary treatments A = CD (control without FS), B = CD + 0.250 % of FS, and C = CD + 0.375 % of FS during 6 weeks of experimental period. Each treatment in 4 equal replicates in which 30 quails were randomly allocated into 12 units of cages. Variable measured were feed intake, feed conversion ratio, feed efficiency, mortality rate, hen day production, egg weight, and egg uniformity. Data were statistically analyzed by One Way ANOVA and the differences among mean treatments are analysed using Duncan’s Multiple Range Test (DMRT). The results showed that administration of 0.375% FS based on earthworm meal, fermented rice bran, and skim milk impaired the feed conversion ratio and increased the feed efficiency. The experimental treatments did not effect on feed intake, mortality, hen day production, egg weight, and egg uniformity of quail. It is concluded that administration of feed supplement improved the growth performance of quail.
Directory of Open Access Journals (Sweden)
Sukarman Hadi jaya Putra
2014-12-01
Full Text Available The purpose of this study was to determine the triglyceride profile of Japanese quail (Coturnix coturnix japonica after being given the parameters of turmeric (Curcuma longa powder; feed intake, profiles of liver triglycerides, profiles of serum triglycerides and profiles of meat triglycerides. This study uses an experimental method with A Completely Randomized Design Pattern. Test animals used were 45 female Japanese quails were divided into 3 groups, namely; P0: quail were not given turmeric powder, P1: quail were given turmeric powder a dose of 54 mg/quail/day, P3: quail were given turmeric powder a dose of 108 mg/quail/day. Each group with 5 replications. Each repeat consists of 3 Japanese quails. Provision of treatment every day for 30 days starting from the age of 14 days. Data were analyzed using analysis of variance (ANOVA followed by Duncan's test with 95% confidence interval (α = 0.05 level. Analysis of the data used is software Minitab software 16. Results showed that the levels of turmeric powder are given in Japanese quail significant (P˂0.05 on liver triglyceride levels, serum and Japanese quail meat but had no significant effect (P˃0.05 on consumption feed. The results showed that the optimal dose of turmeric powder to lower triglyceride levels of Japanese quail is 108 mg/quail/day as evidenced by the highest decrease in liver triglyceride profiles, profiles of serum triglycerides and triglyceride profiles of Japanese quail meat compared with other treatments.
Directory of Open Access Journals (Sweden)
Dimo PENKOV
2016-02-01
Full Text Available An investigation of Vemo Herb® additive on the forage consumption rate in Japanese quail (Pharaoh breed has been conducted. The experiment was carried out for 10 weeks with 52 female and 16 male sexually matured Japanese quails (Coturnix coturnix japonica distributed in four groups: control group (without additive, first experimental group - 4 mg*kg-1 of live weight for 10 weeks; second experimental group - 10 mg*kg-1 of live weight during the first five weeks of the study (after that the product was no more supplemented and third experimental group - 10 mg*kg-1 of live weight during the whole study period. It was observed, a tendency of decreasing of the forage consumption rate for the whole experimental period (no statistical significance for all the experimental groups compared to the control group, but some of the weekly differences are significant.
The role of silicon in physiology of the medicinal plant (Lonicera japonica L.) under salt stress
Gengmao, Zhao; Shihui, Li; Xing, Sun; Yizhou, Wang; Zipan, Chang
2015-08-01
Silicon(Si) is the only element which can enhance the resistance to multiple stresses. However, the role of silicon in medicinal plants under salt stress is not yet understood. This experiment was conducted to study the effects of silicon addition on the growth, osmotic adjustments, photosynthetic characteristics, chloroplast ultrastructure and Chlorogenic acid (CGA) production of Honeysuckle plant (Lonicera japonica L.) under salt-stressed conditions. Salinity exerted an adverse effect on the plant fresh weight and dry weight, whilst 0.5 g L-1 K2SiO3·nH2O addition obviously improved the plant growth. Although Na+ concentration in plant organs was drastically increased with increasing salinity, higher levels of K+/Na+ ratio was obtained after K2SiO3·nH2O addition. Salinity stress induced the destruction of the chloroplast envelope; however, K2SiO3·nH2O addition counteracted the adverse effect by salinity on the structure of the photosynthetic apparatus. K2SiO3·nH2O addition also enhanced the activities of superoxide dismutase and catalase. To sum up, exogenous Si plays a key role in enhancing its resistance to salt stresses in physiological base, thereby improving the growth and CGA production of Honeysuckle plant.
Taxonomy Icon Data: North Pacific right whale [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available North Pacific right whale Eubalaena japonica Chordata/Vertebrata/Mammalia/Theria/Eu...theria/Cetacea Eubalaena_japonica_L.png Eubalaena_japonica_NL.png Eubalaena_japonica_S.png Eubalaena_japonic...a_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Eubalaena+japonica&t=L http://biosciencedbc.jp/tax...onomy_icon/icon.cgi?i=Eubalaena+japonica&t=NL http://biosciencedbc.jp/taxonomy_ic...on/icon.cgi?i=Eubalaena+japonica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Eubalaena+japonica&t=NS ...
Energy Technology Data Exchange (ETDEWEB)
Baumgartner, J [Vyskumny Ustav Chovu a Slachtenia Hydiny, Laboratorim Genetiky, Ivanka pri Dunaji (Czechoslovakia)
1978-01-01
An analysis of the mutability of developmental stages of male gametes of the japanese quail (Coturnix coturnix japonica), after irradiation with /sup 60/Co exposures (5.16; 15.48; and 30.96)x10/sup -2/C kg/sup -1/, i.e. 200, 600 and 1200 R, at an exposure rate of 8.59x10/sup -5/C kg/sup -1/s/sup -1/, i.e. O.33 R s/sup -1/, has shown that the rate of overall induced dominant lethality as well as the rate of mutation were highest in spermatocytes of the second order at all exposures. Starting from an exposure of 200 R the following values were found for lethal interference per 1 gamete for 1 R: spermatozoa 2.0x10/sup -3/, spermatides 1.95x10/sup -3/, spermatocytes II 6.1x10/sup -3/, spermatocytes I 4.06x10/sup -3/, spermatogonia in the process of differentiation 6.8x10/sup -3/. When analysing overall embryonic lethality, according to early and late lethality, dominant lethal mutations mainly manifested themsel--ves in the oviductal and germinal developmental periods, so that these periods can be considered as sensitive indices of genetic changes. The spermatogenic epithelium of the japanese quail was found to be greatly radioresistant since not even an exposure to 1200 R caused complete and permanent sterility.
Itoh, Takeshi; Tanaka, Tsuyoshi; Barrero, Roberto A.; Yamasaki, Chisato; Fujii, Yasuyuki; Hilton, Phillip B.; Antonio, Baltazar A.; Aono, Hideo; Apweiler, Rolf; Bruskiewich, Richard; Bureau, Thomas; Burr, Frances; Costa de Oliveira, Antonio; Fuks, Galina; Habara, Takuya; Haberer, Georg; Han, Bin; Harada, Erimi; Hiraki, Aiko T.; Hirochika, Hirohiko; Hoen, Douglas; Hokari, Hiroki; Hosokawa, Satomi; Hsing, Yue; Ikawa, Hiroshi; Ikeo, Kazuho; Imanishi, Tadashi; Ito, Yukiyo; Jaiswal, Pankaj; Kanno, Masako; Kawahara, Yoshihiro; Kawamura, Toshiyuki; Kawashima, Hiroaki; Khurana, Jitendra P.; Kikuchi, Shoshi; Komatsu, Setsuko; Koyanagi, Kanako O.; Kubooka, Hiromi; Lieberherr, Damien; Lin, Yao-Cheng; Lonsdale, David; Matsumoto, Takashi; Matsuya, Akihiro; McCombie, W. Richard; Messing, Joachim; Miyao, Akio; Mulder, Nicola; Nagamura, Yoshiaki; Nam, Jongmin; Namiki, Nobukazu; Numa, Hisataka; Nurimoto, Shin; O’Donovan, Claire; Ohyanagi, Hajime; Okido, Toshihisa; OOta, Satoshi; Osato, Naoki; Palmer, Lance E.; Quetier, Francis; Raghuvanshi, Saurabh; Saichi, Naomi; Sakai, Hiroaki; Sakai, Yasumichi; Sakata, Katsumi; Sakurai, Tetsuya; Sato, Fumihiko; Sato, Yoshiharu; Schoof, Heiko; Seki, Motoaki; Shibata, Michie; Shimizu, Yuji; Shinozaki, Kazuo; Shinso, Yuji; Singh, Nagendra K.; Smith-White, Brian; Takeda, Jun-ichi; Tanino, Motohiko; Tatusova, Tatiana; Thongjuea, Supat; Todokoro, Fusano; Tsugane, Mika; Tyagi, Akhilesh K.; Vanavichit, Apichart; Wang, Aihui; Wing, Rod A.; Yamaguchi, Kaori; Yamamoto, Mayu; Yamamoto, Naoyuki; Yu, Yeisoo; Zhang, Hao; Zhao, Qiang; Higo, Kenichi; Burr, Benjamin; Gojobori, Takashi; Sasaki, Takuji
2007-01-01
We present here the annotation of the complete genome of rice Oryza sativa L. ssp. japonica cultivar Nipponbare. All functional annotations for proteins and non-protein-coding RNA (npRNA) candidates were manually curated. Functions were identified or inferred in 19,969 (70%) of the proteins, and 131 possible npRNAs (including 58 antisense transcripts) were found. Almost 5000 annotated protein-coding genes were found to be disrupted in insertional mutant lines, which will accelerate future experimental validation of the annotations. The rice loci were determined by using cDNA sequences obtained from rice and other representative cereals. Our conservative estimate based on these loci and an extrapolation suggested that the gene number of rice is ∼32,000, which is smaller than previous estimates. We conducted comparative analyses between rice and Arabidopsis thaliana and found that both genomes possessed several lineage-specific genes, which might account for the observed differences between these species, while they had similar sets of predicted functional domains among the protein sequences. A system to control translational efficiency seems to be conserved across large evolutionary distances. Moreover, the evolutionary process of protein-coding genes was examined. Our results suggest that natural selection may have played a role for duplicated genes in both species, so that duplication was suppressed or favored in a manner that depended on the function of a gene. PMID:17210932
Directory of Open Access Journals (Sweden)
M. Albuquerque
Full Text Available ABSTRACT Often, in pet birds, any stimulus to lay eggs is unwanted in order to reduce reproductive diseases and disorders. The objectives of this study were: to determine the time necessary to promote ovary involution after an eight hour photoperiod using laying Japanese quails (Coturnix coturnix japonica; to connect the ovarian radiographic measurements with egg production; and to compare these measurements with direct ovary data obtained at necropsy. Birds were separated into three groups: 12h/24d (control group - 12h photoperiod for 24 days, 8h/24d and 8h/36d (8h photoperiod for 24 and 36 days. After euthanasia, all cadavers were x-rayed to measure ovary length and height. Birds were necropsied to measure ovarian length and weight. Results: radiographic ovary length demonstrated strong and positive correlation (r=0.96 with direct ovary length of all three groups; laying quails showed higher ovary height (p=0.025 and length (p=0.009 than non-laying quails; eight hours of artificial light per day promotes ovary length (p=0.025 and weight (p=0.009 reduction. Conclusions: radiography can estimate the ovary measure and indicate posture; an eight hour photoperiod of 24 days is not enough to promote ovarian regression, while the use of reduced photoperiod for 36 days promotes significant ovary involution.
Energy Technology Data Exchange (ETDEWEB)
Matsui, T.; Matsushita, Y.; Sugamoto, K.; Tokuda, Y. [Miyazaki University, Miyazaki (Japan). Faculty of Engineering; Kodama, K.; Nakata, K.; Oda, M.; Yamauchi, H. [Miyazaki Prefectural Institute of Industrial Technology, Miyazaki (Japan)
2000-01-10
The material balance of carbonization products (wood-gas, wood-vinegar, wood-tar and charcoal) prepared from the sapwood and the heartwood of Sugi (Cryptomeria japonica D. Don) at various temperatures was determined. The evolution of both carbon monoxide and carbon dioxide mainly occurred at the carbonization temperature below 600 degree C and that of hydrogen and methane at 600-800 degree C. Total yield of the wood-vinegar and the wood-tar was almost constant at 500-800 degree C. On the other hand, the yield of the charcoal decreased because of the evolution of the wood gas with an increase in carbonization temperature. The wood-vinegars prepared at the temperature over 400 degree C were found to consist of carboxylic acids such as acetic acid and propionic acid, methanol, acetone, furans, alkylphenols, guaiacols, cyclotene and maltol by capillary gas chromatography. Since the constituent varieties and contents of the wood-vinegars prepared at both 400 degree C and 800 degree C were very similar each other, the wood-vinegar of Sugi wood chiefly produced below 400 degree C. FT-IR spectra of the charcoals showed the generation of carbonyl and olefin groups at 300-400 degree C and then the formation of aromatic rings along with the disappearance of carbonyl groups over 600 degree C. The production of radical species in the charcoals carbonized at 300-600 degree C was observed by ESR, on the contrary, the charcoals carbonized over 700 degree C were inactive. The specific surface area and the pore volume of the charcoal of Sugi sapwood increased with an increase in carbonization temperature. The pH of charcoal-dispersed aqueous solution increased with an increase in carbonization temperature. The high adsorptive activity of the charcoal carbonized at 400 degree C for ammonia gas and that at 800 degree C for hydrogen sulfide gas seemed to be dependent on acidic and basic properties of the charcoals, respectively. (author)
Souza, Marcy J; Redig, Patrick; Cox, Sherry K
2017-06-01
Aspergillosis is a common fungal infection in both wild and pet birds. Although effective antifungal medications are available, treatment of aspergillosis can require months of medication administration, which entails stressful handling one or more times per day. This study examined the delivery of the antifungal drugs itraconazole, voriconazole, and terbinafine to Japanese quail ( Coturnix japonica ) via an impregnated implant. Implants contained 0.5, 3, 8, or 24 mg of itraconazole, voriconazole, or terbinafine. The implants were administered subcutaneously over the dorsum and between the scapulae. Blood was collected from birds before and 2, 7, 21, 42, and 56 days after implant placement. Plasma was analyzed by high-performance liquid chromatography for concentrations of itraconazole, voriconazole, or terbinafine, as appropriate. During the course of the study, targeted terbinafine concentrations were achieved in some birds at various time points, but concentrations were inconsistent. Itraconazole and voriconazole concentrations were also inconsistent and did not reach targeted concentrations. Currently, the implant examined in this study cannot be recommended for treatment of aspergillosis in avian species.
Fang, Qingkui; Shi, Yanhong; Cao, Haiqun; Tong, Zhou; Xiao, Jinjing; Liao, Min; Wu, Xiangwei; Hua, Rimao
2017-03-01
The degradation dynamics and dietary risk assessments of thiamethoxam and thiacloprid during Lonicera japonica planting, drying, and tea brewing processes were systematically investigated using high-performance liquid chromatography. The half-lives of thiamethoxam and thiacloprid were 1.0-4.1 d in the honeysuckle flowers and leaves, with degradation rate constants k ranging from -0.169 to -0.696. The safety interval time was 7 d. The sun- and oven-drying (70 °C) percent digestions were 59.4-81.0% for the residues, which were higher than the shade- and oven-drying percentages at lower temperatures (30, 40, 50, and 60 °C, which ranged from 37.7% to 57.0%). The percent transfers of thiamethoxam and thiacloprid were 0-48.4% and 0-25.2%, respectively, for the different tea brewing conditions. On the basis of the results of this study, abiding by the safety interval time is important, and using reasonable drying methods and tea brewing conditions can reduce the transfer of thiamethoxam and thiacloprid to humans.
Li, Xia; Dai, Chuan-Chao; Jiao, De-Mao; Foyer, Christine H
2006-06-01
To study the nature and mechanisms of resistance of rice plants to chilling stress, the effects of low temperature treatment (8 degrees C) on the photosynthetic rate and some important compounds forming redox cycles were measured. The rice varieties used are two japonica rice varieties, i.e., Taipei 309 and Wuyujing; three indica rice varieties, i.e., IR64, Pusa and CA212; and one intermediate type, i.e., Shanyou 63. Three types of varieties were studied by comparing. The light intensity-photosynthesis curves, CO2-photosynthesis curves, primary photochemical efficiency (Fv/Fm), active oxygen species (AOS) (O2*- and H2O2), glutathione (both oxidized and reduced forms) and ascorbate contents in their six-week old seedlings were measured before and after chilling treatment. The results showed that relative to the rice varieties chilling tolerance such as Taipei 309 and Wuyujing, the sensitive ones indica IR64, Pusa and CA212 exhibited a stronger inhibition of maximum photosynthetic rate (Pmax) (Figs.1 and 2) and a decrease in Fv/Fm (Fig.3), which led to the accumulation of AOS (Fig.6). It was found that the glutathione disulphide (GSSG) content in glutathione pool and that of dehydroascorbate (DHA) in ascorbate pool of the leaves of these sensitive ones under chilling were induced to increase obviously (Table 3). The correlation coefficient between the increases in GSSG, DHA and the decrease of Chl content were -0.701**, -0.656** respectively (Table 4). This indicated that the regeneration of reduced glutathione (GSH) and ascorbate was inhibited, resulting in accumulations of AOS and the reduction of Chl content (Fig.4) and the inhibition of photosynthetic activity (Fig.1 and Fig.2). The changes in japonica Taibei 309 and Wuyujing were small. And the changes in indica hybrid were lying between the above-mentioned types. Particularly, the ratio of AsA/DHA and GSH/GSSG (Fig.7) showed similar changes as those in Chl content (Fig.4). The correlation coefficient among Chl
Ye, Jing; Niu, Xiaojun; Yang, Yaolong; Wang, Shan; Xu, Qun; Yuan, Xiaoping; Yu, Hanyong; Wang, Yiping; Wang, Shu; Feng, Yue; Wei, Xinghua
2018-01-01
The heading date is a vital factor in achieving a full rice yield. Cultivars with particular flowering behaviors have been artificially selected to survive in the long-day and low-temperature conditions of Northeast China. To dissect the genetic mechanism responsible for heading date in rice populations from Northeast China, association mapping was performed to identify major controlling loci. A genome-wide association study (GWAS) identified three genetic loci, Hd1 , Ghd7 , and DTH7 , using general and mixed linear models. The three genes were sequenced to analyze natural variations and identify their functions. Loss-of-function alleles of these genes contributed to early rice heading dates in the northern regions of Northeast China, while functional alleles promoted late rice heading dates in the southern regions of Northeast China. Selecting environmentally appropriate allele combinations in new varieties is recommended during breeding. Introducing the early indica rice's genetic background into Northeast japonica rice is a reasonable strategy for improving genetic diversity.
Energy Technology Data Exchange (ETDEWEB)
Mazaroni, Bruno Henrique Silveira; Turco, Jose Eduardo Pitelli; Coan, Ruchele Marchiori; Gerolineto, Eduardo [Universidade Estadual Paulista (FCAV/UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias
2008-07-01
This work aim to analyse the consumption and cost of diesel oil on cultivation of zoysiagrass (Zoysia japonica Steud.) irrigated by aspersion canyon, submitted of to two irrigation handling: T1 - irrigated when the tensiometer reading is equal - 0,5 atmospheres and T2 - irrigated by grass growers methodology. The research was carried on Green-Park Farm, in the city of Pitangueiras, SP. Consumption of diesel oil was measured from a diesel engine, brand MWM, turbined with 6 cylinders, type D-229 for zoysiagrass production. The diesel price was gotten from Petroleum National Agency (ANP), being an average price in Sao Paulo State, in February 2007, converted into the commercial dollar. Economical result was studied, subtracting the selling value of the grass, by the cost of the fuel consumed, for both T1 and T2 treatments. The treatment made by tensiometer showed greater diesel consumption, related to treatment T2, where the handling was made by the grass grower. (author)
International Nuclear Information System (INIS)
Lee, Hae June; Moon, Chang Jong; Kim, Jong Choon; Kim Sung Ho; Jung, Uhee; Jo, Sung Kee; Jang, Jong Sik
2012-01-01
To evaluate the ability of Dongchongxiacao (Paecilomyces japonica ) extract (PJE) to protect the skin from photo damage, the gross and microscopic changes in the skin of hairless mice and PJE-treated mice exposed chronically to ultraviolet (UV) were examined. The skin of the UV-irradiated mice showed characteristic signs of photo aging, such as deep wrinkles across the back. PJE-treated mice showed a significantly decreased wrinkling score. By the 22nd week, 88.9% (i.p. with saline) or 44.4% (topical administration with cream base) of the UV-irradiated mice developed at least one tumor. PJE delayed tumor onset significantly. PJE (i.p.) was also effective in reducing the occurrence of UV radiation-induced skin tumors and reduced the number of tumors per mouse. After 22 weeks of treatment, 80.0% (i.p.) and 75.0% (topical) of the mice treated with PJE were tumor-free. Tumor multiplicity was reduced by 96.2% (i.p.) in the PJE treated groups. It is noted that skin that is chronically exposed to UV is subject to photo aging and photo carcinogenesis and regular use of PJE would prevent these photo damaging effects of UV.
Directory of Open Access Journals (Sweden)
Yong Joon Jeong
Full Text Available Osteoarthritis (OA is a degenerative chronic disease that affects various tissues surrounding the joints, such as the subchondral bone and articular cartilage. The onset of OA is associated with uncontrolled catabolic and anabolic remodeling processes of the joints, including the cartilage and subchondral bone, to adapt to local biological and biochemical signals. In this study, we determined whether 70% ethanolic (EtOH extract of Litsea japonica fruit (LJFE had beneficial effects on the articular cartilage, including structural changes in the tibial subchondral bone, matrix degradation, and inflammatory responses, in OA by using a rat model of monosodium iodoacetate-induced OA. Our results showed that administration of LJFE increased the bone volume and cross-section thickness, but the mean number of objects per slice in this group was lower than that in the OA control (OAC group. In addition, the LJFE decreased the expression of inflammatory cytokines. Compared to the OAC group, the group treated with high doses of LJFE (100 and 200 mg/kg showed a more than 80% inhibition of the expression of matrix metalloproteinases and tissue inhibitors of metalloproteinases. Our results suggest that LJFE can be used as a potential anti-osteoarthritic agent.
You, Cuicui; Chen, Lin; He, Haibing; Wu, Liquan; Wang, Shaohua; Ding, Yanfeng; Ma, Chuanxi
2017-06-07
Large-panicle rice varieties often fail to achieve their yield potential due to poor grain filling of late-flowering inferior spikelets (IS). The physiological and molecular mechanisms of poor IS grain filling, and whether an increase in assimilate supply could regulate protein abundance and consequently improve IS grain filling for japonica rice with large panicles is still partially understood. A field experiment was performed with two spikelet removal treatments at anthesis in the large-panicle japonica rice line W1844, including removal of the top 1/3 of spikelets (T1) and removal of the top 2/3 of spikelets (T2), with no spikelet removal as a control (T0). The size, weight, setting rate, and grain filling rate of IS were significantly increased after spikelet removing. The biological functions of the differentially expressed proteins (DEPs) between superior and inferior spikelets as well as the response of IS to the removal of superior spikelets (SS) were investigated by using iTRAQ at 10 days post anthesis. A total of 159, 87, and 28 DEPs were identified from group A (T0-SS/T0-IS), group B (T0-SS/T2-IS), and group C (T2-IS/T0-IS), respectively. Among these, 104, 63, and 22 proteins were up-regulated, and 55, 24, and 6 proteins were down-regulated, respectively. Approximately half of these DEPs were involved in carbohydrate metabolism (sucrose-to-starch metabolism and energy metabolism) and protein metabolism (protein synthesis, folding, degradation, and storage). Reduced endosperm cell division and decreased activities of key enzymes associated with sucrose-starch metabolism and nitrogen metabolism are mainly attributed to the poor sink strength of IS. In addition, due to weakened photosynthesis and respiration, IS are unable to obtain a timely supply of materials and energy after fertilization, which might be resulted in the stagnation of IS development. Finally, an increased abundance of 14-3-3 protein in IS could be involved in the inhibition of starch
2010-08-18
Spectral domain response calculated • Time domain response obtained through inverse transform Approach 4: WASABI Wavelet Analysis of Structural Anomalies...differences at unity scale! Time Function Transform Apply Spectral Domain Transfer Function Time Function Inverse Transform Transform Transform mtP
Wu, Jui-Pin; Chen, Hon-Cheng; Li, Mei-Hui
2011-12-01
Free-living freshwater planarians are considered to have the potential for development as an experimental model for toxicological studies on xenobiotics, including metals. However, little was known about the distribution patterns of metals in the body of treated planarians. This study was conducted to determine the tissue distribution patterns of cadmium (Cd) in different body portions of the treated planarian, Dugesia japonica. Results showed that Cd accumulated in the head of planarians at a significantly higher concentration than in the tail. After examining the level of metallothionein (MT), we suggested that the tissue distribution pattern of Cd might be related to MT induction patterns. In contrast, in planarians treated with copper (Cu), neither the tissue accumulation of Cu nor the multiples of induction of MTs significantly differed between different portions. Furthermore, a higher Cd accumulation rate in the head of planarians caused more-severe oxidative stress to appear in this portion and also a higher susceptibility to a lethal concentration of Cd. Finally, both in vitro and in vivo acetylcholinesterase activities in both body portions of planarians were inhibited by Cd. The present study provides the first report that different metals are distributed in various body portions with different patterns in the planarian.
Taxonomy Icon Data: Planaria [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available Planaria Dugesia japonica Platyhelminthes Dugesia_japonica_L.png Dugesia_japonica_NL.png Dugesia_jap...onica_S.png Dugesia_japonica_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Dugesia+jap...onica&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Dugesia+japonica&t=NL http://biosciencedbc.j...p/taxonomy_icon/icon.cgi?i=Dugesia+japonica&t=S http://biosciencedbc.jp/taxonomy_...icon/icon.cgi?i=Dugesia+japonica&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=124 ...
Sun, Taohua; Zhang, Xinhui; Miao, Ying; Zhou, Yang; Shi, Jie; Yan, Meixing; Chen, Anjin
2018-06-01
The antiviral activity in vitro and in vivo and the effect of the immune system of two fucoidan fractions with low molecular weight and different sulfate content from Laminaria japonica (LMW fucoidans) were investigated in order to examine the possible mechanism. In vitro, I-type influenza virus, adenovirus and Parainfluenza virus I were used to infect Hep-2, Hela and MDCK cells, respectively. And 50% tissue culture infective dose was calculated to detect the antiviral activity of two LMW fucoidans. The results indicated that compared with the control group, 2 kinds of LMW fucoidans had remarkable antiviral activity in vitro in middle and high doses, while at low doses, the antiviral activity of 2 kinds of LMW fucoidans was not statistically different from that in the blank control group. And there was no statistically difference between two LMW fucoidans in antiviral activity. In vivo, LMW fucoidans could prolong the survival time of virus-infected mice, and could improve the lung index of virus-infected mice significantly, which have statistical differences with the control group significantly ( p 0.05). In this study, it was shown that both of two LMW fucoidans (LF1, LF2) could increase the thymus index, spleen index, phagocytic index, phagocytosis coefficient and half hemolysin value in middle and high doses, which suggested that LMW fucoidans could play an antiviral role by improving the quality of immune organs, improving immune cell phagocytosis and humoral immunity.
Energy Technology Data Exchange (ETDEWEB)
Ouyang Jianming, E-mail: toyjm@jnu.edu.cn [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Institute of Biomineralization and Lithiasis Research, Jinan University, Guangzhou 510632 (China); Wang Miao; Lu Peng; Tan Jin [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Institute of Biomineralization and Lithiasis Research, Jinan University, Guangzhou 510632 (China)
2010-08-30
Sulfated polysaccharide (LPS) extracted from alga Laminaria japonica was degraded by hydrogen peroxide (H{sub 2}O{sub 2}). The average molecular weight of LPS was apparently decreased from 172,000 to 9550 after degradation, while the proportion of sulfate groups (-OSO{sub 3}{sup -}) and carboxylic groups (-COO{sup -}) in the molecular chains of LPS were slightly decreased from 4.5% and 5.20% to 3.9% and 4.64%, respectively. The effects of degraded and natural LPS on formation of calcium oxalate (CaOxa) crystals were investigated in vitro using X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), scanning electron microscopy (SEM), zeta-potential, and atomic absorption spectroscopy. LPS could increase the concentration of soluble Ca{sup 2+} ions in the solution, decrease the weight of precipitated CaOxa, and increase the negative value of zeta-potential of CaOxa crystals. LPS also inhibits the formation of thermodynamically stable calcium oxalate monohydrate (COM) crystals, while inducing and stabilizing metastable calcium oxalate dihydrate (COD) crystals. These results suggested that both degraded and natural LPS could decrease CaOxa crystallization, but the inhibition efficiency of the degraded LPS was clearly superior to that of the natural LPS. We expected this investigation would provide encouragement for further exploration into new drugs for the prevention and treatment of urolithiasis.
Directory of Open Access Journals (Sweden)
Constâncio Bernardo dos Santos
2009-10-01
Full Text Available Normal 0 21 false false false MicrosoftInternetExplorer4 A Cryptomeria japonica (L.F. D. Don. é uma espécie de grande potencial para plantios nas regiões altas e frias do Brasil. Destaca-se pelo seu rápido crescimento, boa adaptação ao clima e solo do sul do País, e boa resposta às tecnologias silviculturais, associada à qualidade e diversidade de utilização de sua matéria-prima para fábricas de celulose e papel, chapas, construções de casas, móveis, barcos e navios, entre outras. Neste trabalho, buscou-se avaliar o desenvolvimento das mudas produzidas em diferentes tipos de tubetes e de substratos. Usou-se um experimento bifatorial no delineamento inteiramente casualizado com oito tratamentos em cinco repetições com quarenta mudas por tratamento. Os resultados indicaram que, para a produção de mudas desta espécie, o substrato de solo + vermiculita foi o que apresentou melhor crescimento das plantas, em recipiente de 120 cm3.
Taxonomy Icon Data: Japanese tree frog [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available Japanese tree frog Hyla japonica Chordata/Vertebrata/Amphibia Hyla_japonica_L.png Hyla_jap...onica_NL.png Hyla_japonica_S.png Hyla_japonica_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+jap...onica&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+japonica&t=NL http://biosciencedbc....jp/taxonomy_icon/icon.cgi?i=Hyla+japonica&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Hyla+jap
Directory of Open Access Journals (Sweden)
Longmei Wu
2017-05-01
Full Text Available Low solar radiation caused by industrial development and solar dimming has become a limitation in crop production in China. It is widely accepted that low solar radiation influences many aspects of plant development, including slender, weak stems and susceptibility to lodging. However, the underlying mechanisms are not well understood. To clarify how low solar radiation affects stem mechanical strength formation and lodging resistance, the japonica rice cultivars Wuyunjing23 (lodging-resistant and W3668 (lodging-susceptible were grown under field conditions with normal light (Control and shading (the incident light was reduced by 60% with a black nylon net. The yield and yield components, plant morphological characteristics, the stem mechanical strength, cell wall components, culm microstructure, gene expression correlated with cellulose and lignin biosynthesis were measured. The results showed that shading significantly reduced grain yield attributed to reduction of spikelets per panicles and grain weight. The stem-breaking strength decreased significantly under shading treatment; consequently, resulting in higher lodging index in rice plant in both varieties, as revealed by decreased by culm diameter, culm wall thickness and increased plant height, gravity center height. Compared with control, cell wall components including non-structural carbohydrate, sucrose, cellulose, and lignin reduced quite higher. With histochemical straining, shading largely reduced lignin deposition in the sclerenchyma cells and vascular bundle cells compared with control, and decreased cellulose deposition in the parenchyma cells of culm tissue in both Wuyunjing23 and W3668. And under shading condition, gene expression involved in secondary cell wall synthesis, OsPAL, OsCOMT, OsCCoAOMT, OsCCR, and OsCAD2, and primary cell wall synthesis, OsCesA1, OsCesA3, and OsCesA8 were decreased significantly. These results suggest that gene expression involved in the reduction of
Wu, Longmei; Zhang, Wujun; Ding, Yanfeng; Zhang, Jianwei; Cambula, Elidio D; Weng, Fei; Liu, Zhenghui; Ding, Chengqiang; Tang, She; Chen, Lin; Wang, Shaohua; Li, Ganghua
2017-01-01
Low solar radiation caused by industrial development and solar dimming has become a limitation in crop production in China. It is widely accepted that low solar radiation influences many aspects of plant development, including slender, weak stems and susceptibility to lodging. However, the underlying mechanisms are not well understood. To clarify how low solar radiation affects stem mechanical strength formation and lodging resistance, the japonica rice cultivars Wuyunjing23 (lodging-resistant) and W3668 (lodging-susceptible) were grown under field conditions with normal light (Control) and shading (the incident light was reduced by 60%) with a black nylon net. The yield and yield components, plant morphological characteristics, the stem mechanical strength, cell wall components, culm microstructure, gene expression correlated with cellulose and lignin biosynthesis were measured. The results showed that shading significantly reduced grain yield attributed to reduction of spikelets per panicles and grain weight. The stem-breaking strength decreased significantly under shading treatment; consequently, resulting in higher lodging index in rice plant in both varieties, as revealed by decreased by culm diameter, culm wall thickness and increased plant height, gravity center height. Compared with control, cell wall components including non-structural carbohydrate, sucrose, cellulose, and lignin reduced quite higher. With histochemical straining, shading largely reduced lignin deposition in the sclerenchyma cells and vascular bundle cells compared with control, and decreased cellulose deposition in the parenchyma cells of culm tissue in both Wuyunjing23 and W3668. And under shading condition, gene expression involved in secondary cell wall synthesis, OsPAL, OsCOMT, OsCCoAOMT, OsCCR , and OsCAD2 , and primary cell wall synthesis, OsCesA1, OsCesA3 , and OsCesA8 were decreased significantly. These results suggest that gene expression involved in the reduction of lignin and
Main: Nucleotide Analysis [KOME
Lifescience Database Archive (English)
Full Text Available Nucleotide Analysis Japonica genome blast search result Result of blastn search against jap...onica genome sequence kome_japonica_genome_blast_search_result.zip kome_japonica_genome_blast_search_result ...
3D-TV Rendering on a Multiprocessor System on a Chip
Van Eijndhoven, J.T.J.; Li, X.
2006-01-01
This thesis focuses on the issue of mapping 3D-TV rendering applications to a multiprocessor platform. The target platform aims to address tomorrow's multi-media consumer market. The prototype chip, called Wasabi, contains a set of TriMedia processors that communicate viaa shared memory, fast
NCBI nr-aa BLAST: CBRC-OSAT-11-0000 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-11-0000 dbj|BAF31946.1| putative ammonium transporter AMT2 [Cryptomeria jap...onica] dbj|BAF31947.1| putative ammonium transporter AMT2 [Cryptomeria japonica] dbj|BAF31948.1| putative ...ammonium transporter AMT2 [Cryptomeria japonica] dbj|BAF31949.1| putative ammonium transporter AMT2 [Cryptomeria jap...onica] dbj|BAF31950.1| putative ammonium transporter AMT2 [Cryptomeria jap...onica] dbj|BAF31951.1| putative ammonium transporter AMT2 [Cryptomeria japonica] dbj|BAF31952.1| putative a
Genome-wide association mapping of root traits in a japonica rice panel.
Directory of Open Access Journals (Sweden)
Brigitte Courtois
Full Text Available Rice is a crop prone to drought stress in upland and rainfed lowland ecosystems. A deep root system is recognized as the best drought avoidance mechanism. Genome-wide association mapping offers higher resolution for locating quantitative trait loci (QTLs than QTL mapping in biparental populations. We performed an association mapping study for root traits using a panel of 167 japonica accessions, mostly of tropical origin. The panel was genotyped at an average density of one marker per 22.5 kb using genotyping by sequencing technology. The linkage disequilibrium in the panel was high (r(2>0.6, on average, for 20 kb mean distances between markers. The plants were grown in transparent 50 cm × 20 cm × 2 cm Plexiglas nailboard sandwiches filled with 1.5 mm glass beads through which a nutrient solution was circulated. Root system architecture and biomass traits were measured in 30-day-old plants. The panel showed a moderate to high diversity in the various traits, particularly for deep (below 30 cm depth root mass and the number of deep roots. Association analyses were conducted using a mixed model involving both population structure and kinship to control for false positives. Nineteen associations were significant at P<1e-05, and 78 were significant at P<1e-04. The greatest numbers of significant associations were detected for deep root mass and the number of deep roots, whereas no significant associations were found for total root biomass or deep root proportion. Because several QTLs for different traits were co-localized, 51 unique loci were detected; several co-localized with meta-QTLs for root traits, but none co-localized with rice genes known to be involved in root growth. Several likely candidate genes were found in close proximity to these loci. Additional work is necessary to assess whether these markers are relevant in other backgrounds and whether the genes identified are robust candidates.
Sugahara, Michio; Izutsu, Kazunari; Nishimura, Yasuichiro; Sakamoto, Fumio
2013-02-01
The flower of the oriental orchid Cymbidium floribundum is known to attract the Japanese honeybee Apis cerana japonica. This effect is observed not only in workers but also drones and queens; that is, it attracts even swarming and absconding bees. A mixture of 3-hydroxyoctanoic acid (3-HOAA) and 10-hydroxy-(E)-2-decenoic acid (10-HDA) was identified as the active principles from the orchid flower, whereas these compounds individually have no such activity. Both compounds are also mandibular gland components of worker honeybees with related compounds. This strongly supports the idea that orchid flowers mimic bee secretions, although the ecological consequences of this relationship remain unknown. Because the flower is used to capture swarms, the present identification may contribute to the development of new techniques in traditional beekeeping for Japanese bees as well as A. cerana in Southeast Asia.
Mills, A D; Jones, R B; Faure, J M
1995-05-01
Divergent lines of Japanese quail Coturnix japonica showing high (HSR) or low (LSR) levels of social reinstatement (SR) behaviour (as measured in a treadmill apparatus) have been developed. However, it was not known if selection had influenced social reinstatement tendencies in a general or a species-specific fashion. Therefore, the present study compared the SR behaviour of quail chicks of the HSR and LSR lines and of a Control line when the goal box of the treadmill was empty or when it contained small, same-species groups of either Japanese quail, domestic fowl or Guinea fowl chicks. The results clearly demonstrated that the SR behaviour of Japanese quail chicks is species-specific and that this specificity has not been influenced during genetic selection, over sixteen generations, of the HSR and LSR lines. The HSR chicks showed more locomotor activity in the treadmill than did those of the other lines regardless of the nature of the goal-box stimulus. The results are discussed in terms of general activity, underlying fearfulness and social motivation.
Energy Technology Data Exchange (ETDEWEB)
Duan, C.M.; Inui, Y. (Univ. of Tokyo (Japan))
1990-08-01
Effects of growth hormone (GH) on the synthesis of mucopolysaccharide by ceratobranchial cartilages of the Japanese eel, Anguilla japonica, were examined by monitoring the in vitro uptake of ({sup 35}S)sulfate. The ({sup 35}S)sulfate uptake decreased rapidly to one-third of the initial level during the first 3 days after hypophysectomy, and decreased gradually thereafter. When hypophysectomized eels were injected intramuscularly with recombinant eel GH (2 micrograms/g), the plasma GH concentrations increased maximally after 6 hr, and declined rapidly thereafter. On the other hand, the sulfate uptake increased significantly after 12 hr, and high levels were maintained until 48 hr. The stimulating effect of GH was dose dependent (0.02-2 micrograms/g). However, the addition of eel GH (0.05-5 micrograms/ml) to the culture medium did not affect the sulfate uptake by hypophysectomized eel cartilages, suggesting that the stimulative action of GH on the sulfate uptake by the cartilages is indirect.
Ruby, E G; Nealson, K H
1976-12-01
Isolation of bacteria from the luminous organ of the fish Monocentris japonica has revealed that the organ contains a pure culture of luminous bacteria. For the four fish examined, all contained Photobacterium fischeri as their luminous bacterial symbiont. This is the first time that P. fischeri has been identified in a symbiotic association. A representative isolate (MJl) of the light organ population was selected for in vivo studies of its luminous system. Several physiological features suggest adaptation for symbiotic existence. First, MJl has been shown to produce and respond to an inducer of luciferase that could accumulate in the light organ. Secondly, the specific activity of light production was seen to be maximal under low, growth-limiting concentrations of oxygen. Thirdly, unlike another luminous species (Beneckea harveyi), synthesis of the light production system of these bacteria is not catabolite repressed by glucose--a possible source of nutrition in the light organ. Fourthly, when grown aerobically on glucose these bacteria excrete pyruvic acid into the medium. This production of pyruvate is a major process, accounting for 30-40% of the glucose utilized and may serve as a form of regulatory and nutritional communication with the host.
Sensitivity of spore germination and germ tube elongation of Saccharina japonica to metal exposure.
Han, Taejun; Kong, Jeong-Ae; Kang, Hee-Gyu; Kim, Seon-Jin; Jin, Gyo-Sun; Choi, Hoon; Brown, Murray T
2011-11-01
The sensitivity of early life stages of the brown seaweed Saccharina japonica to six metals (Cd, Cu, Hg, Ni, Pb, Zn) and two waste-water samples were investigated and a new toxicity bioassay developed. The two endpoints used were spore germination and germ tube elongation with an exposure time of 24 h. Optimal test conditions determined for photon irradiance, pH, salinity and temperature were darkness, pH 8, 35‰ and 15°C, respectively. The toxicity ranking of five metals was: Hg (EC(50) of 41 and 42 μg l(-1)) > Cu (120 and 81 μg l(-1)) > Ni (2,009 and 1,360 μg l(-1)) > Zn (3,024 and 3,897 μg l(-1)) > Pb (4,760 and 4,429 μg l(-1)) > Cd (15,052 and 7,541 μg l(-1)) for germination and germ tube elongation, respectively. The sensitivities to Cd, Cu and Ni were greater in germ tube elongation than in germination process. When tested against two different waste-water samples (processed animal and printed circuit board waste-water) values of EC(50) were between 21.29 and 32.02% for germination and between 5.33 and 8.98% for germ tube elongation. Despite differences in their chemical composition, the toxic effects of waste-water samples, as indicated by EC(50) values, did not differ significantly for the same endpoints. The CV range for both germination and germ tube elongation was between 4.61 and 37.69%, indicating high levels of precision of the tests. The results compare favourably with those from more established test procedures employing micro- and macroalgae. The advantages and potential limitations of the bioassay for the assessment of anthropogenic impacts on coastal ecosystems and commercial cultivation areas in near-shore environments are discussed.
Yashiro, Yuichiro; Lee, Na-Yeon M; Ohtsuka, Toshiyuki; Shizu, Yoko; Saitoh, Taku M; Koizumi, Hiroshi
2010-07-01
Quantification of carbon budgets and cycling in Japanese cedar (Cryptomeria japonica D. Don) plantations is essential for understanding forest functions in Japan because these plantations occupy about 20% of the total forested area. We conducted a biometric estimate of net ecosystem production (NEP) in a mature Japanese cedar plantation beneath a flux tower over a 4-year period. Net primary production (NPP) was 7.9 Mg C ha(-1) year(-1) and consisted mainly of tree biomass increment and aboveground litter production. Respiration was calculated as 6.8 (soil) and 3.3 (root) Mg C ha(-1) year(-1). Thus, NEP in the plantation was 4.3 Mg C ha(-1) year(-1). In agreement with the tower-based flux findings, this result suggests that the Japanese cedar plantation was a strong carbon sink. The biometric-based NEP was higher among most other types of Japanese forests studied. Carbon sequestration in the mature plantation was characterized by a larger increment in tree biomass and lower mortality than in natural forests. Land-use change from natural forest to Japanese cedar plantation might, therefore, stimulate carbon sequestration and change the carbon allocation of NPP from an increment in coarse woody debris to an increase in tree biomass.
Moon, Minho; Jeong, Hyun Uk; Choi, Jin Gyu; Jeon, Seong Gak; Song, Eun Ji; Hong, Seon-Pyo; Oh, Myung Sook
2016-09-15
It is generally accepted that functional and structural changes within the hippocampus are involved in learning and memory and that adult neurogenesis in this region may modulate cognition. The extract of Cuscuta japonica Choisy (CJ) is a well-known traditional Chinese herbal medicine that has been used since ancient times as a rejuvenation remedy. The systemic effects of this herb are widely known and can be applied for the treatment of a number of physiological diseases, but there is a lack of evidence describing its effects on brain function. Thus, the present study investigated whether CJ would enhance memory function and/or increase hippocampal neurogenesis using mice orally administered with CJ water extract or vehicle for 21days. Performance on the novel object recognition and passive avoidance tests revealed that treatment with CJ dose-dependently improved the cognitive function of mice. Additionally, CJ increased the Ki-67-positive proliferating cells and the number of doublecortin-stained neuroblasts in the dentate gyrus (DG) of the hippocampus, and double labeling with 5-bromo-2-deoxyuridine and neuronal specific nuclear protein showed that CJ increased the number of mature neurons in the DG. Finally, CJ resulted in the upregulated expression of neurogenic differentiation factor, which is essential for the maturation and differentiation of granule cells in the hippocampus. Taken together, the present findings indicate that CJ stimulated neuronal cell proliferation, differentiation, and maturation, which are all processes associated with neurogenesis. Additionally, these findings suggest that CJ may improve learning and memory via the enhancement of adult hippocampal neurogenesis. Copyright © 2016 Elsevier B.V. All rights reserved.
Wei, Zehong; Yi, Lina; Xu, Wei; Zhou, Huihui; Zhang, Yanjiao; Zhang, Wenbing; Mai, Kangsen
2015-11-01
A 9-week feeding trial was conducted to investigate the effects of dietary nucleotides (NT) on growth, immune response and disease resistance of sea cucumber Apostichopus japonicas (initial weight: 5.87 ± 0.03 g). Four graded levels of dietary NT were designed as 0, 150, 375 and 700 mg/kg, respectively. After the feeding trial, sea cucumbers were challenged with Vibrio splendidus for the determination of disease resistance. The results showed that the specific growth rates were significantly higher in sea cucumber fed the diet with 375 mg/kg NT than those fed the basal diet without NT supplementation (P sea cucumber fed diets with nucleotides (≥ 375 mg/kg) had significantly higher phagocytic activities in coelomic fluid (P 0.05). After being challenged with V. splendidus, the cumulative mortalities of sea cucumber fed diets with 150 and 375 mg/kg NT were significantly lower than that in the treatment without dietary nucleotide supplementation (P sea cucumber in vivo. In conclusion, it was showed that dietary NT does increase the growth performance, non-specific immunity and disease resistance of sea cucumber. The optimum dietary NT supplementation level for sea cucumber was found to be 375 mg/kg. The application of dietary NT may present a novel strategy for health management in sea cucumber's aquaculture. Copyright © 2015 Elsevier Ltd. All rights reserved.
Lee, Seung-Mi; Asaduzzaman, A K M; Chun, Byung-Soo
2012-07-01
Lecithin was isolated and characterized from anchovy (Engraulis japonica) deoiled residues using supercritical carbon dioxide (SC-CO(2)) at a semibatch flow extraction process and an organic solvent (hexane) extraction. SC-CO(2) extraction was carried out to extract oil from anchovy at different temperatures (35 to 45 °C) and pressures (15 to 25 MPa). Extraction yield of oil was influenced by physical properties of SC-CO(2) with temperature and pressure changes. The major phospholipids of anchovy lecithin were quantitatively analyzed by high-performance liquid chromatography. Phosphatidylcholine (PC) (68%± 1.00%) and phosphatidylethanolamine (PE) (29%± 0.50%) were the main phospholipids. Thin layer chromatography was performed to purify the individual phospholipids. The fatty acid compositions of lecithin, PC, and PE were analyzed by gas chromatography. A significant amount of eicosapentaenoic acid and docosahexaenoic acid were present in both phospholipids of PC and PE. Emulsions of lecithin in water were prepared through the use of a homogenizer. Oxidative stability of anchovy lecithin was high in spite of its high concentration of long-chain polyunsaturated fatty acids. Lecithin can be totally metabolized by humans, so is well tolerated by humans and nontoxic when ingested. Lecithin from anchovy contain higher amounts of ω-3 fatty acids especially EPA and DHA, it may have positive outcome to use in food and pharmaceutical industries. © 2012 Institute of Food Technologists®
Chen, Anjin; Zhang, Fang; Shi, Jie; Zhao, Xue; Yan, Meixing
2016-10-01
Several studies have indicated that fucoidan fractions with low molecular weight and different sulfate content from Laminaria japonica could inhibit the activation of platelets directly by reducing the platelet aggregation. To explore the direct effect of LMW fucoidan on the platelet system furthermore and examine the possible mechanism, the endothelial protection and inhibits platelet activation effects of two LMW fucoidan were investigated. In the present study, Endothelial injury model of rats was made by injection of adrenaline (0.4 mg kg-1) and human umbilical vein endothelial cells were cultured. vWF level was be investigated in vivo and in vitro as an important index of endothelial injury. LMW fucoidan could significantly reduce vWF level in vascular endothelial injury rats and also significantly reduce vWF level in vitro. The number of EMPs was be detected as another important index of endothelial injury. The results showed that LMW fucoidan reduced EMPs stimulated by tumor necrosis factor. In this study, it was found that by inhibiting platelet adhesion, LMW fucoidan played a role in anti-thrombosis and the specific mechanism of action is to inhibit the flow of extracellular Ca2+. All in a word, LMW fucoidan could inhibit the activation of platelets indirectly by reducing the concentration of EMPs and vWF, at the same time; LMW fucoidan inhibited the activation of platelets directly by inhibiting the flow of extracellular Ca2+.
Saravanakumar, Arthanari; Peng, Mei Mei; Ganesh, Mani; Jayaprakash, Jayabalan; Mohankumar, Murugan; Jang, Hyun Tae
2017-09-01
Low cost and eco-friendly green synthesis of silver nanoparticles (AgNPs) from silver nitrate (AgNO 3 ) using Prunus japonica leaves extract as reducing agent by a simple method at room temperature. The biosynthesized nanoparticles (NPs) were characterized by UV-Vis, tunneling electron microscopy (HR-TEM), scanning electron microscopy (SEM) coupled with X-ray energy dispersive spectrophotometer (EDAX), X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FTIR). In UV-Vis spectroscopy results, the λ max was observed at 441 nm. The AgNPs synthesized were spherical, hexagonal, and irregular in shapes. The EDAX and XRD spectrum confirmed the presence of silver ions and crystalline nature of synthesized AgNPs. FTIR showed the functional groups such as C = O, N-H and C-N groups involved in the reduction of Ag + to Ag. 2, 2-Diphenyl-1-picrylhydrazyl (DPPH) radical scavenging assay was performed and it showed the percentage inhibition in concentration-dependent manner. The synthesized AgNPs showed antibacterial activity against Escherichia coli, Proteus vulgaris, Staphylococcus aureus and Bacillus cereus to different extents and the higher activity was observed in Proteus vulgaris.
Li, W J; Zhang, B; Huang, G W; Kang, G P; Liang, M Z; Chen, L B
2012-12-17
We analyzed chloroplast DNA (cpDNA) polymorphism and phylogenic relationships between 6 typical indica rice, 4 japonica rice, 8 javanica rice, and 12 Asian common wild rice (Oryza rufipogon) strains collected from different latitudes in China by comparing polymorphism at 9 highly variable regions. One hundred and forty-four polymorphic bases were detected. The O. rufipogon samples had 117 polymorphic bases, showing rich genetic diversity. One hundred and thirty-one bases at 13 sites were identified with indica/japonica characteristics; they showed differences between the indica and japonica subspecies at these sites. The javanica strains and japonica shared similar bases at these 131 polymorphic sites, suggesting that javanica is closely related to japonica. On the basis of length analyses of the open reading frame (ORF)100 and (ORF)29-tRNA-Cys(GCA) (TrnC(GCA)) fragments, the O. rufipogon strains were classified into indica/japonica subgroups, which was consistent with the results of the phylogenic tree assay based on concatenated datasets. These results indicated that differences in indica and japonica also exist in the cpDNA genome of the O. rufipogon strains. However, these differences demonstrated a certain degree of primitiveness and incompleteness, as an O. rufipogon line may show different indica/ japonica attributes at different sites. Consequently, O. rufipogon cannot be simply classified into the indica/japonica types as O. sativa. Our data support the hypothesis that Asian cultivated rice, O. indica and O. japonica, separately evolved from Asian common wild rice (O. rufipogon) strains, which have different indica-japonica differentiation trends.
Liao, Jianqing; Qu, Baida; Liu, Da; Zheng, Naiqin
2015-11-01
A new method has been proposed for enhancing extraction yield of rutin from Sophora japonica, in which a novel ultrasonic extraction system has been developed to perform the determination of optimum ultrasonic frequency by a two-step procedure. This study has systematically investigated the influence of a continuous frequency range of 20-92 kHz on rutin yields. The effects of different operating conditions on rutin yields have also been studied in detail such as solvent concentration, solvent to solid ratio, ultrasound power, temperature and particle size. A higher extraction yield was obtained at the ultrasonic frequency of 60-62 kHz which was little affected under other extraction conditions. Comparative studies between existing methods and the present method were done to verify the effectiveness of this method. Results indicated that the new extraction method gave a higher extraction yield compared with existing ultrasound-assisted extraction (UAE) and soxhlet extraction (SE). Thus, the potential use of this method may be promising for extraction of natural materials on an industrial scale in the future. Copyright © 2015 Elsevier B.V. All rights reserved.
Wu, Meihua; Sugimura, Yuya; Iwata, Kyoko; Takaya, Noriko; Takamatsu, Daisuke; Kobayashi, Masaru; Taylor, DeMar; Kimura, Kiyoshi; Yoshiyama, Mikio
2014-01-01
Abstract European foulbrood is a contagious bacterial disease of honey bee larvae. Studies have shown that the intestinal bacteria of insects, including honey bees, act as probiotic organisms. Microbial flora from the gut of the Japanese honey bee, Apis cerana japonica F. (Hymenoptera: Apidae) , were characterized and evaluated for their potential to inhibit the growth of Melissococcus plutonius corrig. (ex White) Bailey and Collins (Lactobacillales: Enterococcaceae) , the causative agent of European foulbrood. Analysis of 16S rRNA gene sequences from 17 bacterial strains isolated by using a culture-dependent method revealed that most isolates belonged to Bacillus, Staphylococcus, and Pantoea. The isolates were screened against the pathogenic bacterium M. plutonius by using an in vitro growth inhibition assay, and one isolate (Acja3) belonging to the genus Bacillus exhibited inhibitory activity against M. plutonius. In addition, in vivo feeding assays revealed that isolate Acja3 decreased the mortality of honey bee larvae infected with M plutonius, suggesting that this bacterial strain could potentially be used as a probiotic agent against European foulbrood. PMID:25368073
Paudyal, Hari; Pangeni, Bimala; Inoue, Katsutoshi; Kawakita, Hidetaka; Ohto, Keisuke; Ghimire, Kedar Nath; Alam, Shafiq
2013-11-01
A green seaweed, Ulva japonica, was modified by loading multivalent metal ions such as Zr(IV) and La(III) after CaCl2 cross-linking to produce metal loaded cross-linked seaweed (M-CSW) adsorbents, which were characterized by elemental analysis, functional groups identification, and metal content determination. Maximum sorption potential for fluoride was drastically increased after La(III) and Zr(IV) loading, which were evaluated as 0.58 and 0.95 mmol/g, respectively. Loaded fluoride was quantitatively desorbed by using dilute alkaline solution for its regeneration. Mechanism of fluoride adsorption was inferred in terms of ligand exchange reaction between hydroxyl ion on co-ordination sphere of the loaded metal ions of M-CSW and fluoride ion in aqueous solution. Application of M-CSW for the treatment of actual waste plating solution exhibited successful removal of fluoride to clear the effluent and environmental standards in Japan, suggesting high possibility of its application for the treatment of fluoride rich waste water. Copyright © 2013 Elsevier Ltd. All rights reserved.
Lifescience Database Archive (English)
Full Text Available E00598 Woodwardia unigemmata, Woodwardia japonica rhizome Crude drug ... Woodwardia u...nigemmata [TAX:120732], Woodwardia japonica [TAX:120728] ... Blechnaceae Woodwardia unigemmata, Woodwardia japonica rhizome ...
Lifescience Database Archive (English)
Full Text Available E00442 Prunus humilis, Prunus japonica seed Crude drug ... Prunus humilis [TAX:434060], Prunus jap...onica [TAX:97319] ... Rosaceae (rose family) Prunus humilis, Prunus japonica mature seed (dried) ...
Directory of Open Access Journals (Sweden)
Ueno Saneyoshi
2012-04-01
Full Text Available Abstract Background Microsatellites or simple sequence repeats (SSRs in expressed sequence tags (ESTs are useful resources for genome analysis because of their abundance, functionality and polymorphism. The advent of commercial second generation sequencing machines has lead to new strategies for developing EST-SSR markers, necessitating the development of bioinformatic framework that can keep pace with the increasing quality and quantity of sequence data produced. We describe an open scheme for analyzing ESTs and developing EST-SSR markers from reads collected by Sanger sequencing and pyrosequencing of sugi (Cryptomeria japonica. Results We collected 141,097 sequence reads by Sanger sequencing and 1,333,444 by pyrosequencing. After trimming contaminant and low quality sequences, 118,319 Sanger and 1,201,150 pyrosequencing reads were passed to the MIRA assembler, generating 81,284 contigs that were analysed for SSRs. 4,059 SSRs were found in 3,694 (4.54% contigs, giving an SSR frequency lower than that in seven other plant species with gene indices (5.4–21.9%. The average GC content of the SSR-containing contigs was 41.55%, compared to 40.23% for all contigs. Tri-SSRs were the most common SSRs; the most common motif was AT, which was found in 655 (46.3% di-SSRs, followed by the AAG motif, found in 342 (25.9% tri-SSRs. Most (72.8% tri-SSRs were in coding regions, but 55.6% of the di-SSRs were in non-coding regions; the AT motif was most abundant in 3′ untranslated regions. Gene ontology (GO annotations showed that six GO terms were significantly overrepresented within SSR-containing contigs. Forty–four EST-SSR markers were developed from 192 primer pairs using two pipelines: read2Marker and the newly-developed CMiB, which combines several open tools. Markers resulting from both pipelines showed no differences in PCR success rate and polymorphisms, but PCR success and polymorphism were significantly affected by the expected PCR product size
2012-01-01
Background Microsatellites or simple sequence repeats (SSRs) in expressed sequence tags (ESTs) are useful resources for genome analysis because of their abundance, functionality and polymorphism. The advent of commercial second generation sequencing machines has lead to new strategies for developing EST-SSR markers, necessitating the development of bioinformatic framework that can keep pace with the increasing quality and quantity of sequence data produced. We describe an open scheme for analyzing ESTs and developing EST-SSR markers from reads collected by Sanger sequencing and pyrosequencing of sugi (Cryptomeria japonica). Results We collected 141,097 sequence reads by Sanger sequencing and 1,333,444 by pyrosequencing. After trimming contaminant and low quality sequences, 118,319 Sanger and 1,201,150 pyrosequencing reads were passed to the MIRA assembler, generating 81,284 contigs that were analysed for SSRs. 4,059 SSRs were found in 3,694 (4.54%) contigs, giving an SSR frequency lower than that in seven other plant species with gene indices (5.4–21.9%). The average GC content of the SSR-containing contigs was 41.55%, compared to 40.23% for all contigs. Tri-SSRs were the most common SSRs; the most common motif was AT, which was found in 655 (46.3%) di-SSRs, followed by the AAG motif, found in 342 (25.9%) tri-SSRs. Most (72.8%) tri-SSRs were in coding regions, but 55.6% of the di-SSRs were in non-coding regions; the AT motif was most abundant in 3′ untranslated regions. Gene ontology (GO) annotations showed that six GO terms were significantly overrepresented within SSR-containing contigs. Forty–four EST-SSR markers were developed from 192 primer pairs using two pipelines: read2Marker and the newly-developed CMiB, which combines several open tools. Markers resulting from both pipelines showed no differences in PCR success rate and polymorphisms, but PCR success and polymorphism were significantly affected by the expected PCR product size and number of SSR
Yang, Yue; Wang, Lei; Wu, Yongjiang; Liu, Xuesong; Bi, Yuan; Xiao, Wei; Chen, Yong
2017-07-01
There is a growing need for the effective on-line process monitoring during the manufacture of traditional Chinese medicine to ensure quality consistency. In this study, the potential of near infrared (NIR) spectroscopy technique to monitor the extraction process of Flos Lonicerae Japonicae was investigated. A new algorithm of synergy interval PLS with genetic algorithm (Si-GA-PLS) was proposed for modeling. Four different PLS models, namely Full-PLS, Si-PLS, GA-PLS, and Si-GA-PLS, were established, and their performances in predicting two quality parameters (viz. total acid and soluble solid contents) were compared. In conclusion, Si-GA-PLS model got the best results due to the combination of superiority of Si-PLS and GA. For Si-GA-PLS, the determination coefficient (Rp2) and root-mean-square error for the prediction set (RMSEP) were 0.9561 and 147.6544 μg/ml for total acid, 0.9062 and 0.1078% for soluble solid contents, correspondingly. The overall results demonstrated that the NIR spectroscopy technique combined with Si-GA-PLS calibration is a reliable and non-destructive alternative method for on-line monitoring of the extraction process of TCM on the production scale.
Samsur, Mohamad; Takatani, Tomohiro; Yamaguchi, Yasunaga; Sagara, Takefumi; Noguchi, Tamao; Arakawa, Osamu
2007-02-01
The paralytic shellfish poison (PSP)-producing dinoflagellate Gymnodinium catenatum (Gc) was fed to the short-necked clam Tapes japonica, and the accumulation, transformation and elimination profiles of PSP were investigated by means of high-performance liquid chromatography with postcolumn fluorescence derivatization (HPLC-FLD). The short-necked clams ingested most of the Gc cells (4 x 10(6) cells) supplied as a bolus at the beginning of the experiment, and accumulated a maximal amount of toxin (181 nmol/10 clams) after 12 hr. The rate of toxin accumulation at that time was 16%, which rapidly decreased thereafter. During the rearing period, a variation in toxin composition, derived presumably from the transformation of toxin analogues in the clams, was observed, including a reversal of the ratio of C2 to C1, and the appearance of carbamate (gonyautoxin (GTX) 2, 3) and decarbamoyl (dc) derivatives (decarbamoylsaxitoxin (dcSTX) and dcGTX2, 3), which were undetectable in Gc cells. The total amount of toxin contained in clams and residue (remaining Gc cells and/or excrement in the rearing tank) gradually declined, and only about 1% of the supplied toxin was detected at the end of the experiment.
Haritova, Aneliya; Dimitrova, Dimitrichka; Dinev, Toncho; Moutafchieva, Rumyana; Lashev, Lubomir
2013-03-01
A population approach was used to evaluate the pharmacokinetic parameters of 3 fluoroquinolones administered to Japanese quail (Coturnix coturnix japonica). Healthy adult quail (n = 50) were divided into 3 groups, each administered a separate intravenous and oral dose of the compounded drug: enrofloxacin at 10 mg/kg (n = 18; 9 male, 9 female), danofloxacin at 10 mg/kg (n = 12; 6 male, 6 female), and marbofloxacin at 5 mg/kg (n = 20; 10 male, 10 female). A fourth group was used as a control (n = 5). Enrofloxacin was metabolized extensively to ciprofloxacin, while no metabolites of either danofloxacin or marbofloxacin were detected. The volume of distribution was high, greater than 1 in all cases, and highest for danofloxacin, followed by enrofloxacin, then marbofloxacin. The total body clearance was higher in quail than that reported for other avian species with the exception of ostriches. As in mammals, the lowest clearance rate of the 3 fluoroquinolones was observed for marbofloxacin. Enrofloxacin was absorbed most rapidly, followed by marbofloxacin, then danofloxacin. The highest bioavailability was observed for danofloxacin followed by marbofloxacin, while very low bioavailability with significant conversion to ciprofloxacin was observed for enrofloxacin. Population analysis showed low intersubject variability for danofloxacin and marbofloxacin in contrast to that for enrofloxacin and its main metabolite, ciprofloxacin. Because of their more favorable pharmacokinetic properties after oral administration, either danofloxacin or marbofloxacin appears to be preferable to enrofloxacin for the treatment of susceptible bacterial infection in Japanese quail.
Rahman, Sk. Mustafizur; Majhi, Sullip Kumar; Suzuki, Toru; Strussmann, Carlos Augusto; Watanabe, Manabu
Cryopreservation of fish eggs and embryos is a highly desired tool to promote aquaculture production and fisheries resource management, but it is still not technically feasible. The failure to develop successful cryopreservation protocols for fish embryos is largely attributed to poor cryoprotectant permeability. The purpose of this study was to test the effectiveness of CaCl2 to enhance cryoprotectant uptake by fish embryos. In this study, embryos (somites and tail elongation stages) of Japanese whiting Sillago japonica were exposed to 10 and 15% dimethyl sulfoxide (DMSO) in artificial sea water (ASW) or a solution of 0.125M CaCl2 in distilled water for 20 min at 24°C. The toxicity of all solutions was estimated from the hatching rates of the embryos and High Performance Liquid Chromatography was used to determine the amount of DMSO taken up during impregnation. The results showed that DMSO incorporation into the embryos was greatly (›50%) enhanced in the presence of CaCl2 compared to ASW. CaCl2 itself was not toxic to the embryos but, probably as a result of the enhanced DMSO uptake, caused decreases in survival of about 14-44% relative to ASW. Somites stage embryos were more tolerant than tail elongation ones to DMSO both as ASW and CaCl2 solutions. The use of CaCl2 as a vehicle for DMSO impregnation could be a promising aid for the successful cryopreservation of fish embryos.
International Nuclear Information System (INIS)
Maeta, T.; Somegou, M.; Nakahira, K.; Miyazaki, Y.; Kondo, T.
1982-01-01
From microscopic observation of the pollen of induced mutant strains in Sugi (Cryptomeria japonica D. Don), it was found that there were large differences in pollen fertility among the mutant strains, and that it deviated year to year from the mother plants. The large differences in frequency of sterile pollen among mutant strains depended on the genetic characteristics of each mutant strain. Higher frequencies of sterile pollen were observed at the terminal part of branchlets in some mutant strains, and this was considered to be induced by the lateness of flower-bud formation at low temperature conditions in late summer. Delayed formation and gibberellic acid treatment applied for flower induction resulted in low fertility and abnormality of pollen in mutant strains. Chromosome aberration in mutant strains was caused either by gamma irradiation or by some mutational events that responded to environmental conditions. In the former case, aberration might have been maintained for a long period through vegetative propagation. Some of the irregularities were due to mitotic cell division, because cells with micronuclei at the pacytene stage in pollen mother cells and with fragments at MI were observed. Somatic mutability of Kuma-sugi mutants after re-irradiation was investigated. From waxless mutants morphological somatic mutations, which have fat or stout stems and thick and short needles, were frequently produced, whereas from morphological mutants the lowest somatic mutation frequency was induced. In some mutant strains higher rooting ability than the mother plants was found, and the possibility of character improvement was pointed out. (author)
NCBI nr-aa BLAST: CBRC-OSAT-07-0071 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-07-0071 ref|NP_001060484.1| Os07g0650600 [Oryza sativa (japonica cultivar...-group)] dbj|BAC20065.2| BLE2 protein [Oryza sativa (japonica cultivar-group)] dbj|BAD32037.1| BLE2 protein [Oryza sativa (jap...onica cultivar-group)] dbj|BAF22398.1| Os07g0650600 [Oryza sativa (japonica cultivar-group)] NP_001060484.1 0.0 59% ...
Directory of Open Access Journals (Sweden)
Davidson Michael W
2008-03-01
Full Text Available Abstract Background In the 15 years that have passed since the cloning of Aequorea victoria green fluorescent protein (avGFP, the expanding set of fluorescent protein (FP variants has become entrenched as an indispensable toolkit for cell biology research. One of the latest additions to the toolkit is monomeric teal FP (mTFP1, a bright and photostable FP derived from Clavularia cyan FP. To gain insight into the molecular basis for the blue-shifted fluorescence emission we undertook a mutagenesis-based study of residues in the immediate environment of the chromophore. We also employed site-directed and random mutagenesis in combination with library screening to create new hues of mTFP1-derived variants with wavelength-shifted excitation and emission spectra. Results Our results demonstrate that the protein-chromophore interactions responsible for blue-shifting the absorbance and emission maxima of mTFP1 operate independently of the chromophore structure. This conclusion is supported by the observation that the Tyr67Trp and Tyr67His mutants of mTFP1 retain a blue-shifted fluorescence emission relative to their avGFP counterparts (that is, Tyr66Trp and Tyr66His. Based on previous work with close homologs, His197 and His163 are likely to be the residues with the greatest contribution towards blue-shifting the fluorescence emission. Indeed we have identified the substitutions His163Met and Thr73Ala that abolish or disrupt the interactions of these residues with the chromophore. The mTFP1-Thr73Ala/His163Met double mutant has an emission peak that is 23 nm red-shifted from that of mTFP1 itself. Directed evolution of this double mutant resulted in the development of mWasabi, a new green fluorescing protein that offers certain advantages over enhanced avGFP (EGFP. To assess the usefulness of mTFP1 and mWasabi in live cell imaging applications, we constructed and imaged more than 20 different fusion proteins. Conclusion Based on the results of our
Weerakoon, Kosala G; Gordon, Catherine A; Cai, Pengfei; Gobert, Geoffrey N; Duke, Mary; Williams, Gail M; McManus, Donald P
2017-07-01
The current World Health Organization strategic plan targets the elimination of schistosomiasis as a public health problem by 2025 and accurate diagnostics will play a pivotal role in achieving this goal. DNA-based detection methods provide a viable alternative to some of the commonly used tests, notably microscopy and serology, for the diagnosis of schistosomiasis. The detection of parasite cell-free DNA in different clinical samples is a recent valuable advance, which provides significant benefits for accurate disease diagnosis. Here we validated a novel duplex droplet digital PCR assay for the diagnosis of Chinese (SjC) and Philippine (SjP) strains of Schistosoma japonicum infection in a mouse model. The assay proved applicable for both SjC and SjP infections and capable of detecting infection at a very early intra-mammalian stage in conveniently obtainable samples (urine and saliva) as well as in serum and feces. The target DNA copy numbers obtained in the assay showed a positive correlation with the infection burden assessed by direct traditional parasitology. The potential to detect parasite DNA in urine and saliva has important practical implications for large-scale epidemiological screening programmes in the future, particularly in terms of logistical convenience, and the assay has the potential to be a valuable additional tool for the diagnosis of schistosomiasis japonica.
Zhang, Wujun; Wu, Longmei; Ding, Yanfeng; Yao, Xiong; Wu, Xiaoran; Weng, Fei; Li, Ganghua; Liu, Zhenghui; Tang, She; Ding, Chengqiang; Wang, Shaohua
2017-09-01
Stem mechanical strength is an important agricultural quantitative trait that is closely related to lodging resistance in rice, which is known to be reduced by fertilizer with higher levels of nitrogen. To understand the mechanism that regulates stem mechanical strength in response to nitrogen, we analysed stem morphology, anatomy, mechanical properties, cell wall components, and expression of cell wall-related genes, in two varieties of japonica rice, namely, Wuyunjing23 (lodging-resistant variety) and W3668 (lodging-susceptible variety). The results showed that higher nitrogen fertilizer increased the lodging index in both varieties due to a reduction in breaking strength and bending stress, and these changes were larger in W3668. Cellulose content decreased slightly under higher nitrogen fertilizer, whereas lignin content reduced remarkably. Histochemical staining revealed that high nitrogen application decreased lignin deposition in the secondary cell wall of the sclerenchyma cells and vascular bundle cells compared with the low nitrogen treatments, while it did not alter the pattern of cellulose deposition in these cells in both Wuyunjing23 and W3668. In addition, the expression of the genes involved in lignin biosynthesis, OsPAL, OsCoMT, Os4CL3, OsCCR, OsCAD2, OsCAD7, OsCesA4, and OsCesA7, were also down-regulated under higher nitrogen conditions at the early stage of culm growth. These results suggest that the genes involved in lignin biosynthesis are down-regulated by higher nitrogen fertilizer, which causes lignin deficiency in the secondary cell walls and the weakening of mechanical tissue structure. Subsequently, this results in these internodes with reduced mechanical strength and poor lodging resistance.
Miyashita, Yurina; Ohmae, Eiji; Ikura, Teikichi; Nakasone, Kaoru; Katayanagi, Katsuo
2017-05-01
Dihydrofolate (DHF) reductase coded by a plasmid of the extremely halophilic archaeon Haloarcula japonica strain TR-1 (HjDHFR P1) shows moderate halophilicity on enzymatic activity at pH 6.0, although there is no significant effect of NaCl on its secondary structure. To elucidate the salt-activation and -inactivation mechanisms of this enzyme, we investigated the effects of pH and salt concentration, deuterium isotope effect, steady-state kinetics, and rapid-phase ligand-binding kinetics. Enzyme activity was increased eightfold by the addition of 500 mM NaCl at pH 6.0, fourfold by 250 mM at pH 8.0, and became independent of salt concentration at pH 10.0. Full isotope effects observed at pH 10.0 under 0-1000 mM NaCl indicated that the rate of hydride transfer, which was the rate-determining step at the basic pH region, was independent of salt concentration. Conversely, rapid-phase ligand-binding experiments showed that the amplitude of the DHF-binding reaction increased and the tetrahydrofolate (THF)-releasing rate decreased with increasing NaCl concentration. These results suggested that the salt-activation mechanism of HjDHFR P1 is via the population change of the anion-unbound and anion-bound conformers, which are binding-incompetent and -competent conformations for DHF, respectively, while that of salt inactivation is via deceleration of the THF-releasing rate, which is the rate-determining step at the neutral pH region.
Directory of Open Access Journals (Sweden)
Francisco Kanyinji
2014-09-01
Full Text Available This study was conducted to evaluate the effects of replacing maize in quail diets with graded levels of rumen filtrate-fermented cassava meal (FCM on growth and egg production performances. Cassava meal (CM was mixed with dried manure of layer at 75 g/kg CM, which was mixed with freshly collected rumen filtrate (at 1 L/5 kg CM, and finally fermented in sealed bags for 14 days. It was then sun-dried and added in grower or finisher diets at 0, 50, 75 and 100%. Then, 84 three weeks-old Japanese quails (Cortunix japonica were divided into four equal groups; the birds were randomly assigned to 0, 50, 75 and 100% FCM grower/layers diets, and were reared until 56 days of age. Daily feed consumption, weekly body weights, weight gains, feed conversion ratios (FCR, hen-day, and egg weights were monitored. The quails fed with 75% FCM were found to be superior (p0.05 effect on feed intake, body weight, and weight gain, as compared to those of fed control diets. Thus, replacing maize with FCM had no deleterious effects on growth performance, but depressed hen-day. However, better growth performance was obtained when maize was replaced at 75% FCM.
Fu, Xiumin; Kong, Wenbin; Peng, Gang; Zhou, Jingyi; Azam, Muhammad; Xu, Changjie; Grierson, Don; Chen, Kunsong
2012-01-01
Loquat (Eriobotrya japonica Lindl.) can be sorted into red- and white-fleshed cultivars. The flesh of Luoyangqing (LYQ, red-fleshed) appears red-orange because of a high content of carotenoids while the flesh of Baisha (BS, white-fleshed) appears ivory white due to a lack of carotenoid accumulation. The carotenoid content in the peel and flesh of LYQ was approximately 68 μg g−1 and 13 μg g−1 fresh weight (FW), respectively, and for BS 19 μg g−1 and 0.27 μg g−1 FW. The mRNA levels of 15 carotenogenesis-related genes were analysed during fruit development and ripening. After the breaker stage (S4), the mRNA levels of phytoene synthase 1 (PSY1) and chromoplast-specific lycopene β-cyclase (CYCB) were higher in the peel, and CYCB and β-carotene hydroxylase (BCH) mRNAs were higher in the flesh of LYQ, compared with BS. Plastid morphogenesis during fruit ripening was also studied. The ultrastructure of plastids in the peel of BS changed less than in LYQ during fruit development. Two different chromoplast shapes were observed in the cells of LYQ peel and flesh at the fully ripe stage. Carotenoids were incorporated in the globules in chromoplasts of LYQ and BS peel but were in a crystalline form in the chromoplasts of LYQ flesh. However, no chromoplast structure was found in the cells of fully ripe BS fruit flesh. The mRNA level of plastid lipid-associated protein (PAP) in the peel and flesh of LYQ was over five times higher than in BS peel and flesh. In conclusion, the lower carotenoid content in BS fruit was associated with the lower mRNA levels of PSY1, CYCB, and BCH; however, the failure to develop normal chromoplasts in BS flesh is the most convincing explanation for the lack of carotenoid accumulation. The expression of PAP was well correlated with chromoplast numbers and carotenoid accumulation, suggesting its possible role in chromoplast biogenesis or interconversion of loquat fruit. PMID:21994170
Storybook app creation demystified a cast study
Friedlander, Amy
2013-01-01
This case study explains how Wasabi Productions created its first app, Lazy Larry Lizard, and provides insight into the development of soon-to-be-released app, Gorilla Band. Inside, you will find notes on how storybook apps are produced from start to finish, including costs, production process, people, technology, pricing, release cycle, marketing and more. You will also find insights on technology, storyboard development and pricing.
Wan, Peng; Yang, Xiaoman; Cai, Bingna; Chen, Hua; Sun, Huili; Chen, Deke; Pan, Jianyu
2015-08-01
In the present study, ultrasonic extraction technique (UET) is used to improve the yield of polysaccharides from Laminaria japonica (LJPs). And their antioxidative as well as glycosidase inhibitory activities are investigated. Box-Behnken design (BBD) combined with response surface methodology (RSM) is applied to optimize ultrasonic extraction for polysaccharides. The optimized conditions are obtained as extraction time at 54 min, ultrasonic power at 1050 W, extraction temperature at 80°C and ratio of material to solvent at 1:50 (g mL-1). Under these optimal ultrasonic extraction conditions, an actual experimental yield (5.75% ± 0.3%) is close to the predicted result (5.67%) with no significant difference ( P > 0.05). Vitro antioxidative and glycosidase inhibitory activities tests indicate that the crude polysaccharides (LJP) and two major ethanol precipitated fractions (LJP1 and LJP2) are in a concentration-dependent manner. LJP2 (30%-60% ethanol precipitated polysaccharides) possesses the strongest α-glucosidase inhibitory activity and moderate scavenging activity against hydroxyl radicals (66.09% ± 2.19%, 3.0 mg mL-1). Also, the inhibitory activity against α-glucosidase (59.08% ± 3.79%, 5.0 mg mL-1) is close to that of acarbose (63.99% ± 3.27%, 5.0 mg mL-1). LJP1 (30% ethanol precipitated polysaccharides) exhibits the strongest scavenging activity against hydroxyl radicals (99.80% ± 0.00%, 3.0 mg mL-1) and moderate α-glucosidase inhibitory activity (47.76% ± 1.92%, 5.0 mg mL-1). LJP shows the most remarkable DPPH scavenging activity (66.20% ± 0.11%, 5.0 mg mL-1) but weakest α-glucosidase inhibitory activity (37.77% ± 1.30%, 5.0 mg mL-1). However, all these LJPs exert weak inhibitory effects against α-amylase. These results show that UET is an effective method for extracting bioactive polysaccharides from seaweed materials. LJP1 and LJP2 can be developed as a potential ingredient in hypoglycemic agents or functional food for the management of
Langen, Esther M A; von Engelhardt, Nikolaus; Goerlich-Jansson, Vivian C
2018-07-01
The social environment of reproducing females can cause physiological changes, with consequences for reproductive investment and offspring development. These prenatal maternal effects are often found to be sex-specific and may have evolved as adaptations, maximizing fitness of male and female offspring for their future environment. Female hormone levels during reproduction are considered a potential mechanism regulating sex allocation in vertebrates: high maternal androgens have repeatedly been linked to increased investment in sons, whereas high glucocorticoid levels are usually related to increased investment in daughters. However, results are not consistent across studies and therefore still inconclusive. In Japanese quail (Coturnix japonica), we previously found that pair-housed females had higher plasma androgen levels and tended to have higher plasma corticosterone levels than group-housed females. In the current study we investigate whether these differences in maternal social environment and physiology affect offspring sex allocation and physiology. Counter to our expectations, we find no effects of the maternal social environment on offspring sex ratio, sex-specific mortality, growth, circulating androgen or corticosterone levels. Also, maternal corticosterone or androgen levels do not correlate with offspring sex ratio or mortality. The social environment during reproduction therefore does not necessarily modify sex allocation and offspring physiology, even if it causes differences in maternal physiology. We propose that maternal effects of the social environment strongly depend upon the type of social stimuli and the timing of changes in the social environment and hormones with respect to the reproductive cycle and meiosis. Copyright © 2018 Elsevier Inc. All rights reserved.
Wang, Yue; Zheng, Yuanyuan; Tu, Zuoyu; Dai, Yongguo; Xu, Hong; Lv, Li; Wang, Jihong
2017-02-01
Recombinant Lampetra japonica RGD peptide (rLj-RGD3) is a soluble toxin protein with three RGD (Arg-Gly-Asp) motifs and a molecular weight of 13.5kDa. The aim of this study was to investigate the effects and mechanisms of rLj-RGD3 on tumor growth and survival in pancreatic carcinoma Panc-1 cell-bearing mice. A Panc-1 human pancreatic carcinoma-bearing nude mouse model was successfully generated, and the animals were treated with different doses of rLj-RGD3 for 3 weeks. The volume and weight of the subcutaneous tumors, the survival of the nude mice, histopathological changes, the intratumoral MVD, the number of apoptotic Panc-1 cells, and apoptosis-related proteins and gene expressions were determined. rLj-RGD3 significantly decreased the tumor volumes and weights, and the maximum tumor volume and weight IR values were 53.2% (pPanc-1-bearing nude mice treated with rLj-RGD3 was increased by 56.3% (pPanc-1 cells in a nude mouse model, implying that rLj-RGD3 may serve as a potent clinical therapeutic agent for human pancreatic carcinoma. Copyright © 2016 Elsevier Inc. All rights reserved.
Avrova, Anna O; Hyman, Lizbeth J; Toth, Rachel L; Toth, Ian K
2002-04-01
The soft rot bacteria Erwinia carotovora and Erwinia chrysanthemi are important pathogens of potato and other crops. However, the taxonomy of these pathogens, particularly at subspecies level, is unclear. An investigation using amplified fragment length polymorphism (AFLP) fingerprinting was undertaken to determine the taxonomic relationships within this group based on their genetic relatedness. Following cluster analysis on the similarity matrices derived from the AFLP gels, four clusters (clusters 1 to 4) resulted. Cluster 1 contained Erwinia carotovora subsp. carotovora (subclusters 1a and 1b) and Erwinia carotovora subsp. odorifera (subcluster 1c) strains, while cluster 2 contained Erwinia carotovora subsp. atroseptica (subcluster 2a) and Erwinia carotovora subsp. betavasculorum (subcluster 2b) strains. Clusters 3 and 4 contained Erwinia carotovora subsp. wasabiae and E. chrysanthemi strains, respectively. While E. carotovora subsp. carotovora and E. chrysanthemi showed a high level of molecular diversity (23 to 38% mean similarity), E. carotovora subsp. odorifera, E. carotovora subsp. betavasculorum, E. carotovora subsp. atroseptica, and E. carotovora subsp. wasabiae showed considerably less (56 to 76% mean similarity), which may reflect their limited geographical distributions and/or host ranges. The species- and subspecies-specific banding profiles generated from the AFLPs allowed rapid identification of unknown isolates and the potential for future development of diagnostics. AFLP fingerprinting was also found to be more differentiating than other techniques for typing the soft rot erwinias and was applicable to all strain types, including different serogroups.
Directory of Open Access Journals (Sweden)
Qian Lu
Full Text Available The RGD-toxin protein Lj-RGD3 is a naturally occurring 118 amino acid peptide that can be obtained from the salivary gland of the Lampetra japonica fish. This unique peptide contains 3 RGD (Arg-Gly-Asp motifs in its primary structure. Lj-RGD3 is available in recombinant form (rLj-RGD3 and can be produced in large quantities using DNA recombination techniques. The pharmacology of the three RGD motif-containing peptides has not been studied. This study investigated the protective effects of rLj-RGD3, a novel polypeptide, against ischemia/reperfusion-induced damage to the brain caused by middle cerebral artery occlusion (MCAO in a rat stroke model. We also explored the mechanism by which rLj-RGD3 acts by measuring protein and mRNA expression levels, with an emphasis on the FAK and integrin-PI3K/Akt anti-apoptosis pathways.rLj-RGD3 was obtained from the buccal secretions of Lampetra japonica using gene recombination technology. Sprague Dawley (SD rats were randomly divided into the following seven groups: a sham group; a vehicle-treated (VT group; 100.0 μg·kg-1, 50.0 μg·kg-1 and 25.0 μg·kg-1 dose rLj-RGD3 groups; and two positive controls, including 1.5 mg·kg-1 Edaravone (ED and 100.0 μg·kg-1 Eptifibatide (EP. MCAO was induced using a model consisting of 2 h of ischemia and 24 h of reperfusion. Behavioral changes were observed in the normal and operation groups after focal cerebral ischemia/reperfusion was applied. In addition, behavioral scores were evaluated at 4 and 24 h after reperfusion. Brain infarct volumes were determined based on 2,3,5-triphenyltetrazolium chloride (TTC staining. Pathological changes in brain tissues were observed using hematoxylin and eosin (H&E staining. Moreover, neuronal apoptosis was detected using terminal deoxynucleotidyl transferase-mediated dUTP-biotin nick-end labeling (TUNEL assays. We determined the expression levels of focal adhesion kinase (FAK, phosphatidyl inositol 3-kinase (PI3K, protein kinase B
Ohji, Madoka; Harino, Hiroya; Arai, Takaomi
2009-08-01
In order to examine the ecological risks caused by organotin compounds (OTs) in diadromous fish migrating between sea and freshwaters, tributyltin (TBT) and triphenyltin (TPT) compounds and their breakdown products were determined in the catadromous eel Anguilla japonica, which has sea, estuarine and river life histories, collected in Japanese sea, brackish and freshwaters within the same region. Ontogenic changes in otolith strontium (Sr) and calcium (Ca) concentrations were examined along the life history transect to discriminate the migration type. There were generally three different patterns, which were categorized as 'sea eels', 'estuarine eels' and 'river eels' according to the otolith Sr:Ca ratio. The concentrations of TBT in silver eels (mature eels) were significantly higher than that in yellow eels (immature eels), and the percentages of TBT were also higher in silver eels than in yellow eels. A positive correlation was found between TBT concentration and the gonad-somatic index (GSI). It is thus considered that silver eels have a higher risk of contamination by TBT than yellow eels. TBT and TPT concentrations in sea eels were significantly higher than those in river eels, while no significant differences were observed in TBT and TPT concentrations in estuarine eels compared to sea and river eels. These results suggest that sea eels have a higher ecological risk of OT contamination than river eels during their life history, and the risk of OTs in estuarine eels is considered to be intermediate between that of sea and river eels. Positive linear relationships were found between Sr:Ca ratios and the concentrations of TBT and TPT. Therefore, these results suggest that the ecological risk of OTs increase as the sea residence period in the eel becomes longer. TBT and TPT concentrations in sea eels were significantly higher than those in river eels even at the same growth stage. Thus, it is clear that migratory type is the most important factor for OT
Yalcin, H; Konca, Y; Durmuscelebi, F
2018-02-01
This study was conducted in two separate experiments. Experiment I was conducted to investigate the effects of hemp seed (HS) on meat quality traits, and experiment II was designed to determine egg fatty acid (FA) composition in Japanese quail (Coturnix coturnix japonica). In experiment I and experiment II treatments, groups were as follows: (i) control (not included HS0), (ii) 5% HS inclusion to diets, (iii) 10% HS inclusion to diets and (iv) 20% HS inclusion to diets. In experiment I, a total of 192 7-day-old-quail were fed with HS diets for 5 weeks, and end of the experiment I, a total of 64 quail (16 each) slaughtered and meat samples were analysed for meat colour, pH, cooking and thawing loss and FA composition. In experiment II, a total of 120 8-week-old laying quail were fed with experimental diets for 6 weeks and egg FA composition were determined. Breast meat cooking loss was significantly lower in 20% supplemented group (p egg samples were linearly increased with increasing the dietary HS ratio (p eggs (p egg yolk omega-3 FA content and decrease cooking loss of quail meats. © 2017 Blackwell Verlag GmbH.
Directory of Open Access Journals (Sweden)
Eunjin Sohn
2013-01-01
Full Text Available Increasing evidence indicates that advanced glycation end products (AGEs contribute to the pathogenesis of diabetic nephropathy. The aim of this study was to investigate the protective effect of L. japonica extract (LJE against renal damage in the db/db mouse. LJE (100 or 250 mg/kg per day was given to diabetic mice for 12 weeks. Body weight, blood glucose levels, glycated hemoglobin (HbA1c levels, and proteinuria were examined. In in vitro assay of the inhibition of AGE formation, immunohistochemical analysis of podocyte loss and AGE accumulations were performed. In 20-week-old db/db mice, severe hyperglycemia developed, and proteinuria was significantly increased. Diabetes induced markedly morphological alterations to the renal glomerular cells. AGE accumulations and podocyte loss were detected in renal glomeruli. LJE treatment significantly reduced proteinuria and AGE accumulations in diabetic mice. Moreover, the loss of nephrin, an important slit diaphragm component in the kidneys, was restored by LJE treatment. Our studies suggest that LJE might be beneficial for the treatment of diabetic nephropathy. The ability of LJE to attenuate proteinuria and podocyte dysfunction may be mediated by the inhibition of AGE accumulation in the context of diabetic nephropathy in db/db mice.
Yan, Kun; Cui, Mingxing; Zhao, Shijie; Chen, Xiaobing; Tang, Xiaoli
2016-01-01
Honeysuckle ( Lonicera japonica Thunb.) is a traditional medicinal plant in China that is particularly rich in chlorogenic acids, which are phenolic compounds with various medicinal properties. This study aimed to examine the effects of salinity stress on accumulation of chlorogenic acids in honeysuckle, through hydroponic experiments and field trials, and to examine the mechanisms underlying the effects. NaCl stress stimulated the transcription of genes encoding key enzymes in the synthesis of chlorogenic acids in leaves; accordingly, the concentrations of chlorogenic acids in leaves were significantly increased under NaCl stress, as was antioxidant activity. Specifically, the total concentration of leaf chlorogenic acids was increased by 145.74 and 50.34% after 30 days of 150 and 300 mM NaCl stress, respectively. Similarly, the concentrations of chlorogenic acids were higher in the leaves of plants in saline, compared with non-saline, plots, with increases in total concentrations of chlorogenic acids of 56.05 and 105.29% in October 2014 and 2015, respectively. Despite leaf biomass reduction, absolute amounts of chlorogenic acids per plant and phenylalanine ammonia-lyase (PAL) activity were significantly increased by soil salinity, confirming that the accumulation of chlorogenic acids in leaves was a result of stimulation of their synthesis under salinity stress. Soil salinity also led to elevated chlorogenic acid concentrations in honeysuckle flower buds, with significant increases in total chlorogenic acids concentration of 22.42 and 25.14% in May 2014 and 2015, respectively. Consistent with biomass reduction, the absolute amounts of chlorogenic acid per plant declined in flower buds of plants exposed to elevated soil salinity, with no significant change in PAL activity. Thus, salinity-induced chlorogenic acid accumulation in flower buds depended on an amplification effect of growth reduction. In conclusion, salinity stress improved the medicinal quality of
Directory of Open Access Journals (Sweden)
Kun Yan
2016-10-01
Full Text Available Abstract Honeysuckle (Lonicera japonica Thunb. is a traditional medicinal plant in China that is particularly rich in chlorogenic acids, which are phenolic compounds with various medicinal properties. This study aimed to examine the effects of salinity stress on accumulation of chlorogenic acids in honeysuckle, through hydroponic experiments and field trials, and to examine the mechanisms underlying the effects. NaCl stress stimulated the transcription of genes encoding key enzymes in the synthesis of chlorogenic acids in leaves; accordingly, the concentrations of chlorogenic acids in leaves were significantly increased under NaCl stress, as was antioxidant activity. Specifically, the total concentration of leaf chlorogenic acids was increased by 145.74% and 50.34% after 30 days of 150 and 300 mM NaCl stress, respectively. Similarly, the concentrations of chlorogenic acids were higher in the leaves of plants in saline, compared with non-saline, plots, with increases in total concentrations of chlorogenic acids of 56.05% and 105.29% in October 2014 and 2015, respectively. Despite leaf biomass reduction, absolute amounts of chlorogenic acids per plant and phenylalanine ammonia-lyase (PAL activity were significantly increased by soil salinity, confirming that the accumulation of chlorogenic acids in leaves was a result of stimulation of their synthesis under salinity stress. Soil salinity also led to elevated chlorogenic acid concentrations in honeysuckle flower buds, with significant increases in total chlorogenic acids concentration of 22.42% and 25.14% in May 2014 and 2015, respectively. Consistent with biomass reduction, the absolute amounts of chlorogenic acid per plant declined in flower buds of plants exposed to elevated soil salinity, with no significant change in PAL activity. Thus, salinity-induced chlorogenic acid accumulation in flower buds depended on an amplification effect of growth reduction. In conclusion, salinity stress improves
Beyer, W. Nelson; Chen, Yu; Henry, Paula; May, Thomas; Mosby, David; Rattner, Barnett A.; Shearn-Bochsler, Valerie I.; Sprague, Daniel; Weber, John
2014-01-01
This study relates tissue concentrations and toxic effects of Pb in Japanese quail (Coturnix japonica) to the dietary exposure of soil-borne Pb associated with mining and smelting. From 0% to 12% contaminated soil, by weight, was added to 5 experimental diets (0.12 to 382 mg Pb/kg, dry wt) and fed to the quail for 6 weeks. Benchmark doses associated with a 50% reduction in delta-aminolevulinic acid dehydratase activity were 0.62 mg Pb/kg in the blood, dry wt, and 27 mg Pb/kg in the diet. Benchmark doses associated with a 20% increase in the concentration of erythrocyte protoporphyrin were 2.7 mg Pb/kg in the blood and 152 mg Pb/kg in the diet. The quail showed no other signs of toxicity (histopathological lesions, alterations in plasma–testosterone concentration, and body and organ weights). The relation of the blood Pb concentration to the soil Pb concentration was linear, with a slope of 0.013 mg Pb/kg of blood (dry wt) divided by mg Pb/kg of diet. We suggest that this slope is potentially useful in ecological risk assessments on birds in the same way that the intake slope factor is an important parameter in risk assessments of children exposed to Pb. The slope may also be used in a tissue-residue approach as an additional line of evidence in ecological risk assessment, supplementary to an estimate of hazard based on dietary toxicity reference values.
Karthik, R; Govindasamy, Mani; Chen, Shen-Ming; Cheng, Yi-Hui; Muthukrishnan, P; Padmavathy, S; Elangovan, A
2017-05-01
In the present study, sphere-like silver nanoparticles (Ag-NPs) were synthesized by using Camellia japonica leaf extract and its remediation industrial pollutants such as nitrobenzene and Eosin-Y (EY). As-prepared sphere-like Ag-NPs were characterized by various analytical and spectroscopic methods such as UV-visible spectroscopy, X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), High-resolution transmission electron microscopy (HR-TEM), Energy dispersive X-ray spectra (EDX), and the chemical constituents of the leaf extract were also analyzed by using Gas chromatography and Mass Spectroscopy (GC-MS). Fascinatingly, the as-prepared sphere-like Ag-NPs exhibits excellent electrocatalytic and photocatalytic activity for the reduction of nitrobenzene and photo-degradation of EY dye respectively. The Cyclic voltammetry (CV) and amperometric (i-t) studies realized that the electrochemical behavior of sphere-like Ag-NPs modified electrode on nitrobenzene reduction. The proposed nitrobenzene sensor exhibited appreciable wide linear response range and low detection limit of 0.05-21μM, 23-2593μM and 12nM, respectively. The Ag-NPs modified electrode showed excellent selectivity towards the nitrobenzene detection even in the presence of common metal ions and nitroaromatic containing substances. On the other hand, Ag-NPs have excellent photocatalytic activity with >97% degradation of EY dye after irradiated 60min. These results indicated that the growth of sphere-like Ag-NPs should be a proficient. Copyright © 2017 Elsevier B.V. All rights reserved.
Jyske, Tuula; Fujiwara, Takeshi; Kuroda, Katsushi; Iki, Taiichi; Zhang, Chunhua; Jyske, Tuomas K; Abe, Hisashi
2014-08-01
To investigate the biological mechanism by which trees control the changes in microfibril (MF) orientation among secondary cell wall layers of conifer tracheids, we studied seasonal variation in the orientation of newly deposited MFs during tracheid cell wall development in Japanese cedar (Cryptomeria japonica D. Don) trees growing in Central Japan (36°36'N, 140°39'E). Sample blocks were repeatedly collected from four 16-year-old clones of different origins during the growing season of 2010 to investigate the hypotheses that changes in cellulose MF orientation between wall layers exhibited seasonal and clonal differences. The progressive change in the orientation of newly deposited MFs on the primary and secondary cell wall layers of tracheids was detected by field-emission-scanning electron microscopy. Tracheid production and differentiation was studied by light microscopy. We observed a decreasing trend in the orientation of deposited MFs from earlywood to latewood in the S2 and S1 layers, where MFs appeared in a Z-helix. In contrast, no seasonal pattern in the orientation of the MFs in the S-helix was observed. Minor clonal variation was observed in the phenology of tracheid production and differentiation. We concluded that a seasonal decreasing trend in the orientation of the MFs in the Z-helix in S1 and S2 was present, whereas the MFs in other layers exhibited minor random variations. Thus, the orientation of the MFs in S2 was affected by seasonal factors, whereas the MFs in other layers were more intrinsically controlled. The within-ring variations in the MF orientation and thus the resulting average MF angle might also be related to genotypic differences in the tracheid production and differentiation rate. However, our results do not exclude other intrinsic and environmental regulations in the change in MF orientation, which remains a topic for future studies. © The Author 2014. Published by Oxford University Press. All rights reserved. For Permissions
Mishima, Kentaro; Hirao, Tomonori; Tsubomura, Miyoko; Tamura, Miho; Kurita, Manabu; Nose, Mine; Hanaoka, So; Takahashi, Makoto; Watanabe, Atsushi
2018-04-23
Japanese cedar (Cryptomeria japonica) is an important tree for Japanese forestry. Male-sterile marker development in Japanese cedar would facilitate selection of male-sterile plus trees, addressing the widespread social problem of pollinosis and facilitating the identification of heterozygotes, which are useful for breeding. This study used next-generation sequencing for single-nucleotide polymorphism discovery in libraries constructed from several organs, including male-sterile and male-fertile strobili. The single-nucleotide polymorphisms obtained were used to construct a high-density linkage map, which enabled identification of a locus on linkage group 9 strongly correlated with male-sterile trait. Expressed sequence tags corresponding to 11 marker loci from 5 isotigs were associated with this locus within 33.4-34.5 cM. These marker loci explained 100% of the phenotypic variation. Several homologs of these sequences are associated with male sterility in rice or Arabidopsis, including a pre-mRNA splicing factor, a DEAD-box protein, a glycosyl hydrolase, and a galactosyltransferase. These proteins are thus candidates for the causal male-sterile gene at the ms-1 locus. After we used a SNaPshot assay to develop markers for marker-assisted selection (MAS), we tested F 2 progeny between male-sterile and wild-type plus trees to validate the markers and extrapolated the testing to a larger plus-tree population. We found that two developed from one of the candidates for the causal gene were suitable for MAS. More than half of the ESTs and SNPs we collected were new, enlarging the genomic basis for genetic research on Japanese cedar. We developed two SNP markers aimed at MAS that distinguished individuals carrying the male-sterile trait with 100% accuracy, as well as individuals heterozygous at the male-sterile locus, even outside the mapping population. These markers should enable practical MAS for conifer breeding.
Cao, Z-G; Zhao, Y-E; Lee Willingham, A; Wang, T-P
2016-01-01
Schistosomiasis japonica, an endemic, zoonotic tropical parasitic disease caused by Schistosoma japonicum, remains an important public health concern in The People's Republic of China. Unlike other species of Schistosoma, over 40 species of wild and domestic animals can act as reservoir hosts of S. japonicum, which increases the difficulty for the control of this tropical disease. It is widely recognized that domestic animals, particularly water buffaloes and cattle, play an important role in the transmission of S. japonicum. Hence, since the 1950s when The People's Republic of China commenced fight against the disease, the control of animal schistosomiasis has been carried out almost synchronously with that of human schistosomiasis, such that great strides have been made over the past six decades. In this chapter, we review the history and current status of schistosomiasis control in domestic animals in The People's Republic of China. We thoroughly analyse the prevalence of domestic animal schistosomiasis at different stages of schistosomiasis control and the role of different species of domestic animals in transmission of the disease, summarize the control strategies and assess their effectiveness. Furthermore, the challenges ahead are discussed and recommendations for future direction are provided. Copyright © 2016 Elsevier Ltd. All rights reserved.
Termite feeding preference to four wood species after gamma irradiation
International Nuclear Information System (INIS)
Katsumata, N.; Yoshimura, T.; Tsunoda, K.; Imamura, Y.
2007-01-01
The effect of gamma irradiation at 100 kGy and at lower levels on termite resistance was examined in the laboratory by no-choice and choice feeding termite tests (Coptotermes formosanus Shiraki) using four wood species: sapwood of Cryptomeria japonica D. Don, and heartwoods of Pseudotsuga menziesii (Mirbel) Franco, Larix kaempferi (Lambert) Carriere, and Chamaecyparis obtusa Endl. The wood consumption rates in C. japonica and P. menziesii specimens were likely to increase with increases in gamma-irradiation levels, whereas little effect of gamma irradiation was seen in L. kaempferi and C. obtusa. Similar results were obtained in the two-choice test. The current results indicated that in the two-choice test with C. formosanus, 100-kGy-irradiated C. japonica and P. menziesii, which are not rich in antitermite substances, were eaten more than other wood samples with or without gamma irradiation. However, only C. japonica showed significant difference in termite feeding activity. The mass loss in 100-kGy-irradiated C. japonica was significantly higher in the multichoice test
QTL Information Table: 33 [Q-TARO
Lifescience Database Archive (English)
Full Text Available K. (2004). QTLs for branching, floret formation, and pre-flowering floret abortion of rice panicle in a temperate japonica x tropical japonica cross. Theor Appl Genet 109, 1555-1561. ...
Directory of Open Access Journals (Sweden)
Pedro L Undurraga M
2011-12-01
Full Text Available There is some controversy regarding the respiratory pattern of loquat (Eriobotrya japonica [Thunb.] Lindl.. Thus in order to provide information on this aspect of loquat, fruit of 50-70 g, from cv. Golden Nugget were harvested in four stages of maturity: green (BBCH 709, color break (BBCH 801, yellow (BBCH 807, and orange (BBCH 809. The parameters evaluated in each stage were: soluble solids, titratable acidity, respiration, ethylene generation, and activity of the enzymes pectin methyl esterase (PME, peroxidase, polyphenoloxidase (PPO, polygalacturonase (PG, and cellulose, and the soluble solids:acidity ratio was calculated. The results show that ethylene concentration increased at the time of color break, which was not the case for the change in the respiratory rate. The activity of the peroxidase enzyme increased from the green stage to color break, while the enzymes PME, cellulase, and PG showed a constant reduction from the green to the orange stage, and PPO showed no change over the four stages studied. With regards to quality, from color break onwards soluble solids increased to 11.8 °Brix and titratable acidity dropped from 0.67 to 0.28 g L-1 malic acid. Based on these results, the conclusion is that towards the end of its development loquat cv. Golden Nugget evidence enzymatic and ethylene behavior similar to that of climacteric fruits.Existe controversia sobre el patrón respiratorio del níspero (Eriobotrya japonica [Thunb.] Lindl.. Con el fin de aportar información sobre este aspecto, frutos del cv. Golden Nugget entre 50-70 g, fueron cosechados en cuatro estadios de madurez; verde (BBCH 709, quiebre de color (BBCH 801, amarillo (BBCH 807, y anaranjado (BBCH 809. Los parámetros evaluados en cada estadio fueron: sólidos solubles, acidez titulable, relación sólidos solubles acidez, respiración, generación de etileno y la actividad de las enzimas pectin metil esterasa (PME, peroxidasa, polifenoloxidasa (PPO, poligalacturonasa
Influence of predicted climage change elements on Z. ...
Global climate change (GCC) is expected to have pronounced impacts on estuarine and marine habitats including sea level rise, increased storm intensity, increased air and water temperatures, changes in upwelling dynamics and ocean acidification. All of these elements are likely to impact the growth and potential distribution of the non-indigenous seagrass Zostera japonica both within the State of Washington and within the region. Understanding how Z. japonica will respond to GCC requires a thorough understanding of plant physiology and predictions of GCC effects. Furthermore, Washington State is proposing to list Z. japonica as a “noxious weed” which will allow the state to use herbicide controls for management. We present data from manipulative experiments designed to better understand how Z. japonica photosynthetic physiology responds to temperature, salinity and light. We found that Z. japonica is well adapted to moderate temperatures and salinity with maximum photosynthesis of salinity of 20. The Coos Bay population had greater Pmax and saturation irradiance (Ik) than the Padilla bay population (p < 0.001) and tolerates daily exposure to both freshwater and marine water, suggesting that this population tolerates fairly extreme environmental fluctuations. Extreme temperatures (35 °C) were generally lethal to Z. japonica populations from Padilla, Coos and Yaquina Bays. High salinity (35) had lower mortality than either salinity of 5 or 20 (p = 0.0
Oliver, Jason B; Ranger, Christopher M; Reding, Michael E; Moyseenko, James J; Youssef, Nadeer N; Bray, Alicia M
2013-06-01
Japanese beetle, Popillia japonica Newman (Coleoptera: Scarabaeidae), is an important quarantine pest of nurseries. Nursery plant movement from P. japonica-infested regions is regulated by the U.S. Domestic Japanese Beetle Harmonization Plan (DJHP), which classifies states by risk categories. Treatments for category 2 states include preharvest soil surface treatment of nursery plants grown in field soil using Discus SC, Marathon (1G or 60 WP), or Flagship (0.22G or 25 WG). In this study, Discus, Marathon 60 WP, or Flagship 0.22G DJHP standards were compared with labeled rates of non-DJHP-approved insecticides, including neonicotinoids clothianidin (Arena 50WDG), generic imidacloprid (Quali-Pro Imidacloprid 2 F T&O Insecticide, Mallet 2 F T&O Insecticide, and Lada 2 F Insecticide), and imidacloprid + bifenthrin (Allectus SC), as well as the anthranilic diamide, chlorantraniliprole (Acelepryn Insecticide). Arena provided 100% P. japonica control in May, June, and July over four test years, but had one larva recovered during August in two of those 4 yr. Acelepryn did not provide DJHP-acceptable P. japonica control. During July, Allectus provided 100% P. japonica control in three of four test years, but had four larvae in one test year. Other treatments tested only during July, which provided 100% P. japonica control, included Discus (five tests); Marathon, Quali-Pro, and Mallet (two tests); and Lada and Flagship (one test). Generic imidacloprid 2 F formulations were equivalent in P. japonica control to DJHP-approved insecticides. Insecticides generally performed poorly on other scarabs or curculionid larvae. The study supports Arena, Allectus, and generic imidacloprid 2 F products as suitable candidates for the DJHP.
International Nuclear Information System (INIS)
Liu Jun; Luo Qiong; Cui Xiaoyan; Yang Mingliang; Yan Jun
2010-01-01
Objective: To investigate the effect of the Laminaria japonica polysaccharides (LJP) intervention on the male rats' testicular tissue oxidative damage which was caused by repeated low-dose local ionizing radiation. Methods: Male Wistar rats were randomly divided into control group, model group and LJP intervention group. The rats in the LJP intervention group was given with LJP. The rats in each group were exposed to 60 Co γ-ray local irradiation 7 d after adaptability breeding, once per day for 20 times in 4 weeks. Each rat was irradiated with the total dose of 2.3 Gy. The rats were killed at 1, 7 and 14 d post-irradiation, respectively. The testis and the epididymis were taken out. The contents of MDA and GSH, and the activities of SOD, LDH and GSH-Px were measured using spectrophotometer. The amorphous of testicular tissue was observed and the sperm count and viability were analyzed. Results: As compared with those in the model group, the content of MDA decreased in testicular tissue in the LJP group (t=3.66-5.03, P<0.01), while the GSH content increased. The activities of SOD, LDH and GSH-Px (t=2.77-25.52, P<0.05) and the sperm count and viability increased (t=3.11-23.08, P<0.01). Each index was more close to that in the control group 14 d post-irradiation. Conclusions: LJP can promote the recovery of testicular tissue oxidative damage caused by chronic local ionizing radiation. It has a role in promoting the spermatogenic function of male rate. (authors)
Matsuda, Osamu; Hara, Masashi; Tobita, Hiroyuki; Yazaki, Kenichi; Nakagawa, Toshinori; Shimizu, Kuniyoshi; Uemura, Akira; Utsugi, Hajime
2015-01-01
Regeneration of planted forests of Cryptomeria japonica (sugi) and Chamaecyparis obtuse (hinoki) is the pressing importance to the forest administration in Japan. Low seed germination rate of these species, however, has hampered low-cost production of their seedlings for reforestation. The primary cause of the low germinability has been attributed to highly frequent formation of anatomically unsound seeds, which are indistinguishable from sound germinable seeds by visible observation and other common criteria such as size and weight. To establish a method for sound seed selection in these species, hyperspectral imaging technique was used to identify a wavelength range where reflectance spectra differ clearly between sound and unsound seeds. In sound seeds of both species, reflectance in a narrow waveband centered at 1,730 nm, corresponding to a lipid absorption band in the short-wavelength infrared (SWIR) range, was greatly depressed relative to that in adjacent wavebands on either side. Such depression was absent or less prominent in unsound seeds. Based on these observations, a reflectance index SQI, abbreviated for seed quality index, was formulated using reflectance at three narrow SWIR wavebands so that it represents the extent of the depression. SQI calculated from seed area-averaged reflectance spectra and spatial distribution patterns of pixelwise SQI within each seed area were both proven as reliable criteria for sound seed selection. Enrichment of sound seeds was accompanied by an increase in germination rate of the seed lot. Thus, the methods described are readily applicable toward low-cost seedling production in combination with single seed sowing technology. PMID:26083366
Agata, Kiyokazu; Alasaad, Samer; Almeida-Val, Vera Maria Fonseca; Alvarez-Dios, J A; Barbisan, F; Beadell, Jon S; Beltrán, J F; Benítez, M; Bino, G; Bleay, Colin; Bloor, P; Bohlmann, Jörg; Booth, Warren; Boscari, E; Caccone, Adalgisa; Campos, Tatiana; Carvalho, B M; Climaco, Gisele Torres; Clobert, Jean; Congiu, L; Cowger, Christina; Dias, G; Doadrio, I; Farias, Izeni Pires; Ferrand, N; Freitas, Patrícia D; Fusco, G; Galetti, Pedro M; Gallardo-Escárate, Cristian; Gaunt, Michael W; Ocampo, Zaneli Gomez; Gonçalves, H; Gonzalez, E G; Haye, Pilar; Honnay, O; Hyseni, Chaz; Jacquemyn, H; Jowers, Michael J; Kakezawa, Akihiro; Kawaguchi, Eri; Keeling, Christopher I; Kwan, Ye-Seul; La Spina, Michelangelo; Lee, Wan-Ok; Leśniewska, M; Li, Yang; Liu, Haixia; Liu, Xiaolin; Lopes, S; Martínez, P; Meeus, S; Murray, Brent W; Nunes, Aline G; Okedi, Loyce M; Ouma, Johnson O; Pardo, B G; Parks, Ryan; Paula-Silva, Maria Nazaré; Pedraza-Lara, C; Perera, Omaththage P; Pino-Querido, A; Richard, Murielle; Rossini, Bruno C; Samarasekera, N Gayathri; Sánchez, Antonio; Sanchez, Juan A; Santos, Carlos Henrique Dos Anjos; Shinohara, Wataru; Soriguer, Ramón C; Sousa, Adna Cristina Barbosa; Sousa, Carolina Fernandes Da Silva; Stevens, Virginie M; Tejedo, M; Valenzuela-Bustamante, Myriam; Van de Vliet, M S; Vandepitte, K; Vera, M; Wandeler, Peter; Wang, Weimin; Won, Yong-Jin; Yamashiro, A; Yamashiro, T; Zhu, Changcheng
2011-05-01
This article documents the addition of 238 microsatellite marker loci to the Molecular Ecology Resources Database. Loci were developed for the following species: Alytes dickhilleni, Arapaima gigas, Austropotamobius italicus, Blumeria graminis f. sp. tritici, Cobitis lutheri, Dendroctonus ponderosae, Glossina morsitans morsitans, Haplophilus subterraneus, Kirengeshoma palmata, Lysimachia japonica, Macrolophus pygmaeus, Microtus cabrerae, Mytilus galloprovincialis, Pallisentis (Neosentis) celatus, Pulmonaria officinalis, Salminus franciscanus, Thais chocolata and Zootoca vivipara. These loci were cross-tested on the following species: Acanthina monodon, Alytes cisternasii, Alytes maurus, Alytes muletensis, Alytes obstetricans almogavarii, Alytes obstetricans boscai, Alytes obstetricans obstetricans, Alytes obstetricans pertinax, Cambarellus montezumae, Cambarellus zempoalensis, Chorus giganteus, Cobitis tetralineata, Glossina fuscipes fuscipes, Glossina pallidipes, Lysimachia japonica var. japonica, Lysimachia japonica var. minutissima, Orconectes virilis, Pacifastacus leniusculus, Procambarus clarkii, Salminus brasiliensis and Salminus hilarii. © 2011 Blackwell Publishing Ltd.
Duan, Dandan; Wang, Hongyan; Zhou, Rong; Jiang, Qi; Xiao, Rong
2018-02-01
Previous studies have shown that cysteine-rich buccal gland protein (CRBGP) from buccal glands of Lampetra japonica could suppress angiogenesis in chick chorioallantoic membrane models. As CRBGP is composed of a pathogenesis-related group 1 (PR-1) domain and a cysteine-rich domain (CRD), which domain accounts for the effects of CRBGP on anti-angiogenesis? In the present study, recombinant PR-1 and CRD (rL-PR-1 and rL-CRD) were obtained. MTT assays showed rL-PR-1 inhibited the proliferation of HUVECs significantly in a dose-dependent manner with an IC 50 of 2μM, while rL-CRD had no obviously inhibitory effect on the proliferation of HUVECs, suggested that PR-1 is the main function domain on the anti-angiogenic activity of CRBGP. Similar to CRBGP, rL-PR-1 induced apoptosis in HUVECs in a mitochondrial-dependent pathway by affecting the level of BAX, BCL2 and caspase 3. Also, the cytotoxic property of rL-PR-1 might be one of the factors which suppressed the proliferation of HUVECs. Furthermore, rL-PR-1 blocked the adhesion, migration, invasion and tube formation of HUVECs by disturbing the cytoskeleton arrangement and down-regulating the level of matrix metallo-peptidase 2. In summary, rL-PR-1 has the anti-angiogenic activity which would provide the information on the functions and mechanisms of cysteine-rich secretory protein family members. Copyright © 2017 Elsevier B.V. All rights reserved.
Lifescience Database Archive (English)
Full Text Available 合データベースセンター) Photo: Takeru Nakazato (Database Center for Life Science) nakazato 2009/11/04 17:26:47 2010/01/14 20:11:35 ... ...Japanese tree frog Hyla japonica Hyla_japonica_L.png 200.png Takeru Nakazato (Database Center for Life Scien...ce) licensed under CC Attribution2.1 Japan ニホンアマガエル Hyla japonica 撮影:仲里猛留(ライフサイエンス統
Directory of Open Access Journals (Sweden)
Assar Ali Shah
Full Text Available ABSTRACT This study was designed to find the effect of vitamin E supplementation on growth, serum antioxidant enzymes, and some trace elements in Japanese quail (Coturnix coturnix japonica under low ambient temperature. A total of 180 day-old Japanese quails were randomly divided into four groups and provided with 0 (group A, 50 (group B, 100 (group C, and 150 IU/kg (group D vitamin E (dl-α-tocopherol acetate under an average temperature of 9±0.5 °C for an experimental period of 42 days. The result showed that feed intake per day, body weight, weight gain per day, and feed conversion ratio did not differ significantly between the groups. Serum concentrations of superoxide and glutathione peroxidase were significantly high in birds supplemented with 150 mg/kg of vitamin E. The concentration of aspartate aminotransferase was not significantly affected between the control and treated groups; however, alanine transaminase concentration significantly reduced in group D. Zinc concentration in the blood increased significantly in group D, with no significant effect on copper and manganese between the control and treated groups. Vitamin E at the level of 150 IU/kg of feed improves the blood antioxidant status and zinc concentration, with no effect on the performance traits of quail reared under low ambient temperature.
Directory of Open Access Journals (Sweden)
Ke Teng
2016-12-01
Full Text Available Senescence is not only an important developmental process, but also a responsive regulation to abiotic and biotic stress for plants. Stay-green protein plays crucial roles in plant senescence and chlorophyll degradation. However, the underlying mechanisms were not well studied, particularly in non-model plants. In this study, a novel stay-green gene, ZjSGR, was isolated from Zoysia japonica. Subcellular localization result demonstrated that ZjSGR was localized in the chloroplasts. Quantitative real-time PCR results together with promoter activity determination using transgenic Arabidopsis confirmed that ZjSGR could be induced by darkness, ABA and MeJA. Its expression levels could also be up-regulated by natural senescence, but suppressed by SA treatments. Overexpression of ZjSGR in Arabidopsis resulted in a rapid yellowing phenotype; complementary experiments proved that ZjSGR was a functional homologue of AtNYE1 from Arabidopsis thaliana. Overexpression of ZjSGR accelerated chlorophyll degradation and impaired photosynthesis in Arabidopsis. Transmission electron microscopy observation revealed that overexpression of ZjSGR decomposed the chloroplasts structure. RNA sequencing analysis showed that ZjSGR could play multiple roles in senescence and chlorophyll degradation by regulating hormone signal transduction and the expression of a large number of senescence and environmental stress related genes. Our study provides a better understanding of the roles of SGRs, and new insight into the senescence and chlorophyll degradation mechanisms in plants.
Kim, Tae-Su; Shin, Kyungha; Jeon, Joseph H; Choi, Ehn-Kyoung; Choi, Youngjin; Lee, Sung-Pyo; Lee, Yoon-Bok; Kim, Yun-Bae
2015-03-01
Helicobacter pylori-eliminating effects of FEMY-R7, composed of Laminaria japonica and Oenothera biennis extracts, were investigated in mice and humans. Male C57BL/6 mice were infected with the bacteria by intragastric inoculation (1×10(9) CFU/mouse) 3 times at 2-day intervals, and simultaneously, orally treated twice a day with total 20, 64 or 200 mg/kg/day FEMY-R7 for 2 weeks. In Campylobcter-like organism (CLO)-detection tests on gastric mucosa and feces, FEMY-R7 reduced the urease-positive reactivity in a dose-dependent manner; i.e., the positivity ratios were decreased to 70, 20, and 10% for gastric mocosa and to 80, 50, and 20% for feces. In a clinical sudy, human subjects, confirmed to be infected with Helicobacter pylori, were orally administered twice a day with capsules containing total 100, 320 or 1,000 mg/man/day FEMY-R7 (matching doses for 20, 64 or 200 mg/kg/day, respectively, in mice from a body surface area-based dose translation) for 8 weeks. FEMY-R7 decreased the positivity ratios in feces to 70, 40, and 30%, respectively. In bacterial culture, H. pylori was identified from the CLO-positive stools of mice and humans. The bacterial identification ratios exhibited a good correlation between the matching doses in mice and humans. It is suggested that FEMY-R7 could be a promising functional food without tolerance as an adjunct to reduce the dosage of antibiotics for the treatment of recurrent H. pylori infection.
Japanese beetle, Popillia japonica Newman (Coleoptera: Scarabaeidae), is an important quarantine pest of nurseries. Nursery plant movement from P. japonica-infested regions is regulated by the U.S. Domestic Japanese Beetle Harmonization Plan (DJHP), which classifies states by risk categories. Treatm...
A survey of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh.
Nasar, Abu; Rahman, Aminoor; Hoque, Nazmul; Kumar Talukder, Anup; Das, Ziban Chandra
2016-09-01
To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica) farming in selected areas of Bangladesh. The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4%) were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 145.0±0.12, 110.0±0.07, 120.0±0.22, and 128.0±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price, outbreak of endemic diseases, lack of proper knowledge
Gomon, Martin F; Struthers, Carl D
2015-11-19
Descriptions of three new species of the aulopid genus Hime from the central and western Pacific and presumably the easternmost Indian Ocean are presented. Hime surrubea sp. nov., confined to the Hawaiian Island region, has been misidentified in species accounts and faunal lists as H. japonica and although resembling it is separable from that species by its shorter caudal peduncle, slightly larger head, larger eye, especially relative to head size, and slightly smaller pectoral and pelvic fins. Hime capitonis sp. nov. is known conclusively only from seamounts off the southern tip of New Caledonia and Vanuatu, and is distinguishable by its distinctively large head (32.3-35.6% SL) and eyes (orbital diameter 10.8-13.0% SL) and relatively few scales between the anus and anal fin origin (7-9). The Indonesian H. caudizoma sp. nov. is so far known from only 8 specimens, acquired in markets in southeastern Lombok and presumably caught nearby in what would be regarded the eastern reaches of the Indian Ocean. The species is recognisable by its dorsal fin of rather uniform moderate height with nearly straight distal margin and 17 rather than 16 rays, none of which is filamentous in either sex, the second penultimate ray rather than anterior rays the longest in males. Like the other two described here, H. caudizoma has among the largest head and eyes of the family. Observations on the dorsal fin form and other features of H. microps Parin & Kotlyar, 1989 are provided based on a large male specimen collected at Rapa Iti, Austral Islands and a re-evaluation of the original description.
Food habits of fishes on an exposed sandy beach at Fukiagehama, South-West Kyushu Island, Japan
Nakane, Yukinori; Suda, Yusuke; Sano, Mitsuhiko
2011-06-01
To clarify the feeding habits and major food sources of sandy beach fishes, the gut contents of 55 fish species collected on a sandy beach at Fukiagehama, South-West Kyushu Island, Japan, were examined. Ontogenetic changes in food preference were recognized in nine species ( Hypoatherina valenciennei, Lateolabrax japonicus, Trachurus japonicus, Sillago japonica, Sphyraena japonica, Paralichthys olivaceus, Heteromycteris japonica, Paraplagusia japonica, and Takifugu niphobles). A cluster analysis based on dietary overlaps showed that the sandy beach fish assemblage comprised six trophic groups (mysid, amphipod, zooplankton, juvenile fish, terrestrial insect, and mollusk feeders). Of these, the first three groups were the most abundantly represented, whereas the last two were represented by only a single species. These results indicated that epibenthic macrofauna, such as mysids and gammaridean amphipods, and zooplankton, were important food resources for the fish assemblage at the study site, but infaunal macrobenthos, such as polychaetes and bivalves, being relatively unimportant.
Ibraheem, Omodele; Botha, Christiaan E J; Bradley, Graeme
2010-12-01
The regulation of gene expression involves a multifarious regulatory system. Each gene contains a unique combination of cis-acting regulatory sequence elements in the 5' regulatory region that determines its temporal and spatial expression. Cis-acting regulatory elements are essential transcriptional gene regulatory units; they control many biological processes and stress responses. Thus a full understanding of the transcriptional gene regulation system will depend on successful functional analyses of cis-acting elements. Cis-acting regulatory elements present within the 5' regulatory region of the sucrose transporter gene families in rice (Oryza sativa Japonica cultivar-group) and Arabidopsis thaliana, were identified using a bioinformatics approach. The possible cis-acting regulatory elements were predicted by scanning 1.5kbp of 5' regulatory regions of the sucrose transporter genes translational start sites, using Plant CARE, PLACE and Genomatix Matinspector professional databases. Several cis-acting regulatory elements that are associated with plant development, plant hormonal regulation and stress response were identified, and were present in varying frequencies within the 1.5kbp of 5' regulatory region, among which are; A-box, RY, CAT, Pyrimidine-box, Sucrose-box, ABRE, ARF, ERE, GARE, Me-JA, ARE, DRE, GA-motif, GATA, GT-1, MYC, MYB, W-box, and I-box. This result reveals the probable cis-acting regulatory elements that possibly are involved in the expression and regulation of sucrose transporter gene families in rice and Arabidopsis thaliana during cellular development or environmental stress conditions. Copyright © 2010 Elsevier Ltd. All rights reserved.
Jang, Ji Yeon; Kim, Ha Neui; Kim, Yu Ri; Choi, Yung Hyun; Kim, Byung Woo; Shin, Hwa Kyoung; Choi, Byung Tae
2012-05-07
Semen cuscutae has been used traditionally to treat pimples and alleviate freckles and melasma in Korea. The present study aimed to investigate the inhibitory effect of Cuscuta japonica Choisy seeds on alpha-melanocyte-stimulating hormone (α-MSH)-induced melanogenesis. The aqueous fraction from Semen cuscutae (AFSC) was used to determine anti-melanogenic effects by examination of cellular melanin contents, tyrosinase activity assay, cAMP assay and Western blot analysis for melanin synthesis-related signaling proteins in B16F10 mouse melanoma cells. AFSC markedly inhibited α-MSH-induced melanin synthesis and tyrosinase activity, and also decreased α-MSH-induced expression of microphthalmia-associated transcription factor (MITF) and tyrosinase-related proteins (TRPs). Moreover, AFSC significantly decreased the level of phosphorylated p38 mitogen-activated protein kinase (MAPK) signaling through the down-regulation of α-MSH-induced cAMP. Furthermore, we confirmed that the specific inhibitor of p38 MAPK (SB203580)-mediated suppressed melanin synthesis and tyrosinase activity was further attenuated by AFSC. AFSC also further decreased SB203580-mediated suppression of MITF and TRP expression. These results indicate that AFSC inhibits p38 MAPK phosphorylation with suppressed cAMP levels and subsequently down-regulate MITF and TRP expression, which results in a marked reduction of melanin synthesis and tyrosinase activity in α-MSH-stimulated B16F10 cells. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Caterpillar hairs as an anti-parasitoid defence.
Kageyama, Azusa; Sugiura, Shinji
2016-10-01
Caterpillar hairs are thought to act as a physical barrier against natural enemies, including parasitoids. However, very few studies have experimentally demonstrated how hairs protect caterpillars from parasitoid oviposition. To clarify the importance of caterpillar hairs as an anti-parasitoid defence, we observed the generalist endoparasitoid Meteorus pulchricornis (Hymenoptera: Braconidae) attacking both smooth and hairy caterpillars under laboratory conditions. A female Meteorus pulchricornis uses its ovipositor to inject venom and lay a single egg inside host larvae. We placed a smooth Spodoptera litura (Lepidoptera: Noctuidae) caterpillar or a hairy Lymantria dispar japonica (Lepidoptera: Erebidae) caterpillar in front of parasitoid females. We observed that 100 % and 84 % of the parasitoids could successfully stab their ovipositors into the smooth larvae of S. litura and first instars of the hairy caterpillar L. dispar japonica, respectively. However, only 24 % of parasitoids could successfully stab their ovipositors into second-instar L. dispar japonica. A higher rate of successful stabs (94 %) by parasitoids was obtained by cutting the hairs of second instar L. dispar japonica much shorter than the parasitoid ovipositor. The results demonstrate that the long, thick hairs of second and later instars of L. dispar japonica function as a physical barrier against parasitoid oviposition.
Directory of Open Access Journals (Sweden)
Laura Tatiana Moreno-Moyano
2016-09-01
Full Text Available Biofortification of rice (Oryza sativa L. with micronutrients is widely recognized as a sustainable strategy to alleviate human iron (Fe and zinc (Zn deficiencies in developing countries where rice is the staple food. Constitutive overexpression of the rice nicotianamine synthase (OsNAS genes has been successfully implemented to increase Fe and Zn concentrations in unpolished and polished rice grain. Intensive research is now needed to couple this high-micronutrient trait with high grain yields. We investigated associations of increased grain Fe and Zn concentrations with agro-morphological traits of backcross twice second filial (BC2F2 transgenic progeny carrying OsNAS1 or OsNAS2 overexpression constructs under indica/japonica and japonica/japonica genetic backgrounds. Thirteen agro-morphological traits were evaluated in BC2F2 transgenic progeny grown under hydroponic conditions. Concentrations of 8 mineral nutrients (Fe, Zn, copper, manganese, calcium, magnesium, potassium and phosphorus in roots, stems/sheaths, non-flag leaves, flag leaves, panicles and grain were also determined. A distance-based linear model (DistLM was utilized to extract plant tissue nutrient predictors accounting for the largest variation in agro-morphological traits differing between transgenic and non-transgenic progeny. Overall, the BC2F2 transgenic progeny contained up to 148% higher Fe and 336% higher Zn concentrations in unpolished grain compared to non-transgenic progeny. However, unpolished grain concentrations surpassing 23 µg Fe g-1 and 40 µg Zn g-1 in BC2F2 indica/japonica progeny, and 36 µg Fe g-1 and 56 µg Zn g1 in BC2F2 japonica/japonica progeny, were associated with significant reductions in grain yield. DistLM analyses identified grain-Zn and panicle-magnesium as the primary nutrient predictors associated with grain yield reductions in the indica/japonica and japonica/japonica progeny, respectively. We subsequently produced polished grain from high
Pretreatment of macroalgae for volatile fatty acid production.
Pham, Thi Nhan; Um, Youngsoon; Yoon, Hyon Hee
2013-10-01
In this study, a novel method was proposed for the biological pretreatment of macroalgae (Laminaria japonica, Pachymeniopsis elliptica, and Enteromorpha crinita) for production of volatile fatty acid (VFA) by anaerobic fermentation. The amount of VFA produced from 40 g/L of L. japonica increased from 8.3 g/L (control) to 15.6 g/L when it was biologically pretreated with Vibrio harveyi. The biological treatment of L. japonica with Vibrio spp. was most effective likely due to the alginate lyase activity of Vibrio spp. However, a considerable effect was also observed after biological pretreatment of P. elliptica and E. crinita, which are red and green algae, respectively. Alkaline pretreatment of 40 g/L of L. japonica with 0.5 N NaOH resulted in an increase of VFA production to 12.2 g/L. These results indicate that VFA production from macroalgae can be significantly enhanced using the proposed biological pretreatments. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Kelsey Caetano-Anolles
Full Text Available Japanese quail (Coturnix coturnix japonica reach sexual maturity earlier, breed rapidly and successfully, and cost less and require less space than other birds raised commercially. Given the value of this species for food production and experimental use, more studies are necessary to determine chromosomal regions and genes associated with gender and breed-differentiation. This study employed Trinity and edgeR for transcriptome analysis of next-generation RNA-seq data, which included 4 tissues obtained from 3 different breeding lines of Japanese quail (random bred control, heavy weight, low weight. Differentially expressed genes shared between female and male tissue contrast groups were analyzed to identify genes related to sexual dimorphism as well as potential novel candidate genes for molecular sexing. Several of the genes identified in the present study as significant sex-related genes have been previously found in avian gene expression analyses (NIPBL, UBAP2, and other genes found differentially expressed in this study and not previously associated with sex-related differences may be considered potential candidates for molecular sexing (TERA, MYP0, PPR17, CASQ2. Additionally, other genes likely associated with neuronal and brain development (CHKA, NYAP, as well as body development and size differentiation (ANKRD26, GRP87 in quail were identified. Expression of homeobox protein regulating genes (HXC4, ISL1 shared between our two sex-related contrast groups (Female Brain vs. Male Brain and Ovary vs. Testis indicates that these genes may regulate sex-specific anatomical development. Results reveal genetic features of the quail breed and could allow for more effective molecular sexing as well as selective breeding for traits important in commercial production.
Inhibition of TNF-α and IL-1 by compounds from selected plants for ...
African Journals Online (AJOL)
Purpose: To investigate the inhibitory activities of herbal compounds from Curcuma longa, Sophora japonica and Camellia sinensis against tumor necrosis factor alpha (TNF-α) and interleukin-1 (IL-1) using in vivo and in silico tools. Methods: The extracts of the medicinal herbs (Curcuma longa, Sophora japonica and ...
Image collection: 93 [Togo Picture Gallery[Archive
Lifescience Database Archive (English)
Full Text Available 93 Eubalaena_japonica_NL.png セミクジラ Right whale Eubalaena japonica 302098 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,クジラ目
A survey of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh
Directory of Open Access Journals (Sweden)
Abu Nasar Md. Aminoor Rahman
2016-09-01
Full Text Available Aim: To investigate the status, problems and prospects of Japanese quail (Coturnix coturnix japonica farming in selected areas of Bangladesh. Materials and Methods: The study was conducted in 14 districts of Bangladesh, viz., Dhaka, Narayanganj, Munshiganj, Mymensingh, Netrakona, Faridpur, Jessore, Khulna, Satkhira, Kushtia, Bogra, Naogaon, Comilla, and Sylhet during the period from July 2011 to June 2012. A total of 52 quail farmers were interviewed for data collection using a structured questionnaire. Focus group discussions were also carried out with unsuccessful farmers and those want to start quail farming. Workers of quail farms, quail feeds and medicine suppliers, quail eggs and meat sellers were also interviewed regarding the issue. Results: Out of 52 farms, 86.5% were operated by male, 67.3% farmers did not receive any training and 92.3% farmers had no earlier experience of quail farming although 58.0% farmers primary occupation was quail farming. Most of the farms (63.4% were mixed in type having ≤5000 birds of two or three varieties. About 80.7% farms were operated separately round the year with no other poultry and 83.0% farmers wanted to expand their farming. The average pullet weight 14.5±0.12, 11.0±0.07, 12.0±0.22, and 12.8±0.17 g; age at the first lay 46.0±0.04, 42.0±0.31, 42.0±0.09, and 45.2±0.05 days; rearing period 15.0±0.01, 12.0±0.14, 15.0±0.32, and 15.2±0.18 months; culling period 15.5±0.14, 13.0±0.06, 15.0±0.03, and 15.4±0.26 months were for layer, parent stock, hatchery, and mixed farms, respectively. Most of the layer farms had an average egg production of ≤5000/day and net profit BDT 0.75/egg. However, an average number of birds, hatchability and net profit per day-old-chick were ≤5000, 76.8% and BDT 2.75, respectively, in the hatchery. Broiler quails were sold at 30 days with mean weight of 110.8 g and net profit BDT 9.02/bird. The major constraints of quail farming were higher feed price
Directory of Open Access Journals (Sweden)
Marek Bednarczyk
2010-01-01
Full Text Available Descendants ( of S18 generation of Japanese quails (Coturnix coturnix japonica, selected for low (line 11, n=15 or for high (line 12, n=6 yolk cholesterol content were used for this experiment. The high (12 and low (11 lines were developed from a control egg type (line13 wild color plumage stock 07, from Poultry Breeding Station in Ivanka at Danube (Slovakia that was maintained without conscious selection. The results of selected lines were compared to this one from unselected lines, egg type (line 13, n=15 and meat type (line 8, n=15, to study productive performance (growth and carcass weight as well as meat quality traits (intramuscular collagen properties, fatty and cholesterol content. The birds were grown up to 35 days of age. Quails were fed ad libitum with commercial diets according to their ages. Animals had free access to water during the experiment. The body weight of the quails was controlled every week (from week 1 to 5. At the slaughter (at avg. weight of 104.0, 107.7, 110.6 g vs 209.3 g for lines 11, 12, 13 vs 8, respectively; P<0.05 the hot carcass weight was recorded and dressing percentage was calculated. Pectoralis superficialis muscles were removed from the carcasses to assess intramuscular collagen (IMC properties (collagen and crosslink concentrations, intramuscular lipid and cholesterol contents. Growth and slaughter performance, intramuscular fat percentage and IMC properties of Pectoralis superficialis were not different between the birds selected for low (line 11 and high (line 12 yolk cholesterol content and were also found to be similar between the quails of egg type and those selected for yolk cholesterol content (lines 11 and 12. Compared to the birds of egg type line and those selected for yolk cholesterol content, the quails of meat type had higher growth and carcass traits (P<0.05, while meat quality traits were found to be similar. The meat of the quails selected for low cholesterol in the egg yolk (line 11
Suppression or knockout of SaF/SaM overcomes the Sa-mediated hybrid male sterility in rice
Institute of Scientific and Technical Information of China (English)
Yongyao Xie; Baixiao Niu; Yunming Long; Gousi Li; Jintao Tang; Yaling Zhang; Ding Ren; Yao-Guang Liu; Letian Chen
2017-01-01
Hybrids between the indica and japonica subspecies of rice (Oryza sativa) are usually sterile, which hinders utilization of heterosis in the inter-subspecific hybrid breeding. The complex locus Sa comprises two adjacently located genes, SaF and SaM, which interact to cause abortion of pollen grains carrying the japonica allele in japonica-indica hybrids. Here we showed that silencing of SaF or SaM by RNA interference restored male fertility in indica-japonica hybrids with heterozygous Sa. We further used clustered regularly interspaced short palindromic repeats (CRISPR)/Cas9-based genome editing to knockout the SaF and SaM alleles, respectively, of an indica rice line to create hybrid-compatible lines. The resultant artificial neutral alleles did not affect pollen viability and other agricultural traits, but did break down the reproductive barrier in the hybrids. We found that some rice lines have natural neutral allele Sa-n, which was compatible with the typical japonica or indica Sa alleles in hybrids. Our results demonstrate that SaF and SaM are required for hybrid male sterility, but are not essential for pollen development. This study provides effective approaches for the generation of hybrid-compatible lines by knocking out the Sa locus or using the natural Sa-n allele to overcome hybrid male sterility in rice breeding.
Jiang, Jun-fu; Li, Xiong-ying; Wu, Yao-sheng; Luo, Yu; Zhao, Rui-qiang; Lan, Xiu-wan
2009-02-01
To identify the resources of Gynostemma pentaphyllum and its spurious breed plant Cayratia japonica at level of DNA. Two random primers ( WGS001, WGS004) screened were applied to do random amplification with genomic DNA extracted from Gynostemma pentaphyllum and Cayratia japonica which were collected from different habitats. After amplificated with WGS004, one characteristic fragment about 500 bp which was common to all Gynostemma pentaphyllum samples studied but not to Cayratia japonica was cloned and sequenced. Then these sequences obtained were analyzed for identity and compared by Blastn program in GenBank. There were obvious different bands amplified by above two primers in their fingerprints of genomic DNA. On the basis of these different bands of DNA fingerprints, they could distinguish Gynostemma pentaphyllum and Cayratia japonica obviously. Sequence alignment of seven cloned bands showed that their identities ranged from 45.7% - 94.5%. There was no similar genome sequences searched in GenBank. This indicated that these seven DNA fragments had not been reported before and they should be new sequences. RAPD technique can be used for the accurate identification of Gynostemma pentaphyllum and its counterfeit goods Cayratia japonica. Besides, these specific DNA sequences for Gynostemmna pentaphyllum in this study are useful for the further research on identification of species and assisted selection breeding in Gynostemma pentaphyllum.
Directory of Open Access Journals (Sweden)
Esther M A Langen
Full Text Available The social environment can have profound effects on an individual's physiology and behaviour and on the transfer of resources to the next generation, with potential consequences for fecundity and reproduction. However, few studies investigate all of these aspects at once. The present study housed female Japanese quail (Coturnix japonica in pairs or groups to examine the effects on hormone concentrations in plasma and yolk and on reproductive performance. Circulating levels of androgens (testosterone and 5-α-dihydrotestosterone and corticosterone were measured in baseline samples and after standardised challenges to assess the responsiveness of the females' endocrine axes. Effects of the social environment on female fecundity were analysed by measuring egg production, egg mass, fertilization rates, and number of hatched offspring. Counter to expectation, females housed in pairs had higher plasma androgen concentrations and slightly higher corticosterone concentrations than females housed in groups, although the latter was not statistically significant. Pair vs. group housing did not affect the females' hormonal response to standardised challenges or yolk testosterone levels. In contrast to previous studies, the females' androgen response to a gonadotropin-releasing hormone challenge was not related to yolk testosterone levels. Non-significant trends emerged for pair-housed females to have higher egg-laying rates and higher fertility, but no differences arose in egg weight or in the number, weight or size of hatchlings. We propose that our unexpected findings are due to differences in the adult sex ratio in our social treatments. In pairs, the male may stimulate female circulating hormone levels more strongly than in groups where effects are diluted due to the presence of several females. Future studies should vary both group size and sex composition to disentangle the significance of sexual, competitive and affiliative social interactions for
[Molecular authentication of Jinyinhua formula granule by using allele-specific PCR].
Jiang, Chao; Tu, Li-Chan; Yuan, Yuan; Huang, Lu-Qi; Gao, Wei; Jin, Yan
2017-07-01
Traditional authentication method is hard to identify herb's authenticity of traditional Chinese medicine(TCM) formula granules because they have lost all their morphological characteristics. In this study, a new allele-specific PCR method was established for identifying the authentication of Jinyinhua formula granule (made from Lonicerae Japonicae Flos) based on an SNP site in trnL-trnF fragment. Genomic DNA was successfully extracted from Lonicerae Japonicae Flos and its formula granules by using an improved spin column method and then PCR was performed with the designed primer. Approximately 110 bp specific bands was obtained only in the authentic Lonicerae Japonicae Flos and its formula granules, while no bands were found in fake mixed products. In addition, the PCR product sequence was proved from Lonicerae Japonicae Flos trnL-trnF sequence by using BLAST method. Therefore, DNA molecular authentication method could make up the limitations of character identification method and microscopic identification, and quickly identify herb's authenticity of TCM formula granules, with enormous potential for market supervision and quality control. Copyright© by the Chinese Pharmaceutical Association.
A Rapid Monitoring and Evaluation Method of Schistosomiasis Based on Spatial Information Technology.
Wang, Yong; Zhuang, Dafang
2015-12-12
Thanks to Spatial Information Technologies (SITs) such as Remote Sensing (RS) and Geographical Information System (GIS) that are being quickly developed and updated, SITs are being used more widely in the public health field. The use of SITs to study the characteristics of the temporal and spatial distribution of Schistosoma japonicum and to assess the risk of infection provides methods for the control and prevention of schistosomiasis japonica has gradually become a hot topic in the field. The purpose of the present paper was to use RS and GIS technology to develop an efficient method of prediction and assessment of the risk of schistosomiasis japonica. We choose the Yueyang region, close to the east DongTing Lake (Hunan Province, China), as the study area, where a recent serious outbreak of schistosomiasis japonica took place. We monitored and evaluated the transmission risk of schistosomiasis japonica in the region using SITs. Water distribution data were extracted from RS images. The ground temperature, ground humidity and vegetation index were calculated based on RS images. Additionally, the density of oncomelania snails, which are the Schistosoma japonicum intermediate host, was calculated on the base of RS data and field measurements. The spatial distribution of oncomelania snails was explored using SITs in order to estimate the area surrounding the residents with transmission risk of schistosomiasis japonica. Our research result demonstrated: (1) the risk factors for the transmission of schistosomiasis japonica were closely related to the living environment of oncomelania snails. Key factors such as water distribution, ground temperature, ground humidity and vegetation index can be quickly obtained and calculated from RS images; (2) using GIS technology and a RS deduction technique along with statistical regression models, the density distribution model of oncomelania snails could be quickly built; (3) using SITs and analysis with overlaying population
International Nuclear Information System (INIS)
Ramarathnam, N.; Osawa, T.; Namiki, M.; Kawakishi, S.
1989-01-01
Accelerated aging effects, induced by y irradiation, were investigated on the fatty acid composition of lipids and on the content of endogenous antioxidants of four Indica and four Japonica rice seeds with and without intact hull. While the linoleic acid content of the phospholipids decreased gradually with the increase in irradiation doses, there was a corresponding increase in the linoleic acid content of the free fatty acids. Such changes were drastic, especially in the case of Japonica rice seeds irradiated without intact hull. However, the neutral lipids were found to be resistant to γ irradiation. The α-tocopherol content was found to decrease (markedly) in rice seeds irradiated with or without hull, especially in the Japonica rice seeds. At a dose of 15 kGy only traces of a-tocopherol could be detected in Japonica and Indica rice seeds irradiated with and without intact hull. Oryzanol, a relatively weaker anti-oxidant, was found to be more resistant to oxidative damage than a-tocopherol. At 15 kGy, the oryzanol content ranged from 59 μg to 170 μg/g lipid in rice seeds irradiated with intact hull, while the corresponding value for rice seeds irradiated without hull was 52 μg to 153 μg/g lipid. The overall susceptibility to oxidative damage was less in Indica rice seeds, indicating that the antioxidative defense system offered better protection in overcoming oxidative stress in Indica rice hull than in Japonica rice hull
Mutation breeding in rice in India
Energy Technology Data Exchange (ETDEWEB)
Swaminathan, M S; Siddiq, E A; Singh, C B; Pai, R A [Indian Agricultural Research Institute, New Delhi (India)
1970-03-01
Mutation research was continued in rice with the following aims; (a) to enhance the frequency and spectrum of mutations in indica and japonica rice varieties; (b) to change the grain quality of the japonica variety, Tainan-3, into the indica type; (c) to improve the grain quality of the indica variety, IR-8; (d) to increase the recombination frequency in japonica-indica hybrids. Both nitrosoguanidine and 5-MeV fast neutrons gave a high mutation frequency. The japonica variety was more sensitive to all mutagens than the indica types. Chemical mutagens had no particular advantage over ionizing radiations with reference to either mutation frequency or spectrum. Mutants with indica type of grain occurred readily in Tainan-3 in all treatments. Such mutants had a larger grain length/width ratio and were more resistant to alkali digestion. Fine grain types with better cooking quality occurred in the M{sub 2} populations of IR-8. These mutants are likely to render this high-yielding variety more popular. A wide range of chlorophyll and viable mutations occurred in IR-8 and Tainan-3. Some of these, like those involving dwarfing and slow senescence, are of economic interest, besides those affecting grain quality. Recombination frequency can be influenced in japonica x indica hybrids through the irradiation of F{sub 1} sporocytes. The precise influence varies with the stage at which the plant is irradiated, the dose given and the loci involved. (author)
Yan, Xiao-Jun; Wang, Li-Li; Jiang, Yu; Deng, Ai-Xing; Tian, Yun-Lu; Zhang, Wei-Jian
2013-09-01
A pot experiment was conducted to study the CH4 emission features of fourteen leading super-rice varieties (six Japonica rice varieties and eight Indica hybrid rice varieties) and their relationships with the varieties growth characteristics in Yangtze Delta. Two distinct peaks of CH4 emission were detected during the entire growth period of the varieties, one peak occurred at full-tillering stage, and the other appeared at booting stage. The average total CH4 emission of Japonica rice varieties was 37.6% higher than that of the Indica hybrid rice varieties (Price types occurred at the post-anthesis phase. For all the varieties, there was a significant positive correlation between the total CH4 emission and the maximum leaf area, but the correlations between the CH4 emission and the other growth characteristics varied with variety type. The total CH4 emission of Japonica rice varieties had a significant positive correlation with plant height, while the correlations between the total CH4 emission of Indica hybrid rice varieties and their plant height were not significant. The total CH4 emission of Indica hybrid rice varieties had significant negative correlations with the total aboveground biomass, grain yield, and harvest index, but the correlations were not significant for Japonica rice varieties. The lower CH4 emission of Indica hybrid rice varieties was likely due to their significantly higher root biomass, as compared with Japonica rice varieties.
Suppression or knockout of SaF/SaM overcomes the Sa-mediated hybrid male sterility in rice.
Xie, Yongyao; Niu, Baixiao; Long, Yunming; Li, Gousi; Tang, Jintao; Zhang, Yaling; Ren, Ding; Liu, Yao-Guang; Chen, Letian
2017-09-01
Hybrids between the indica and japonica subspecies of rice (Oryza sativa) are usually sterile, which hinders utilization of heterosis in the inter-subspecific hybrid breeding. The complex locus Sa comprises two adjacently located genes, SaF and SaM, which interact to cause abortion of pollen grains carrying the japonica allele in japonica-indica hybrids. Here we showed that silencing of SaF or SaM by RNA interference restored male fertility in indica-japonica hybrids with heterozygous Sa. We further used clustered regularly interspaced short palindromic repeats (CRISPR)/Cas9-based genome editing to knockout the SaF and SaM alleles, respectively, of an indica rice line to create hybrid-compatible lines. The resultant artificial neutral alleles did not affect pollen viability and other agricultural traits, but did break down the reproductive barrier in the hybrids. We found that some rice lines have natural neutral allele Sa-n, which was compatible with the typical japonica or indica Sa alleles in hybrids. Our results demonstrate that SaF and SaM are required for hybrid male sterility, but are not essential for pollen development. This study provides effective approaches for the generation of hybrid-compatible lines by knocking out the Sa locus or using the natural Sa-n allele to overcome hybrid male sterility in rice breeding. © 2017 The Authors. Bioelectromagnetics published by Wiley Periodicals, Inc. © 2017 Institute of Botany, Chinese Academy of Sciences.
Kawakami, Y; Ishihara, M; Saito, T; Fujimoto, T; Adachi, S; Arai, K; Yamaha, E
2012-12-01
Primordial germ cells (PGC) are the only cell type in developing embryos with the potential to transmit genetic information to the next generation. In this study, PGC of Japanese eel (Anguilla japonica) were visualized by injection of mRNA synthesized from a construct carrying the green fluorescent protein (GFP) gene fused to the 3' untranslated region of the Japanese eel nanos gene. We investigated the feasibility of cryopreserving Japanese eel PGC by vitrification of dechorionated whole somite stage embryos. The GFP-labeled PGC were rapidly cooled using liquid nitrogen after exposure to a pretreatment solution containing 1.5 M cryoprotectant (methanol, dimethyl sulfoxide, and glycerol for 10 min and ethylene glycol for 10, 20, and 30 min) and a vitrification solution containing 3 M cryoprotectant and 0.5 M sucrose for 1, 5, and 10 min. Ethylene glycerol is an effective cryoprotectant for embryonic cells and shows no evidence of ice formation after thawing. Vitrified and thawed PGC were transplanted into blastula stage embryos from zebrafish (Danio rerio). The GFP-labeled PGC migrated toward the host gonadal ridge, suggesting maintenance of their normal migration motility. These techniques may assist in achieving inter- and intraspecies germ-line chimers using donor Japanese eel PGC.
Optimization of RAPD-PCR reaction system for genetic relationships ...
African Journals Online (AJOL)
STORAGESEVER
2010-02-08
Feb 8, 2010 ... Golden yellow. Small. Dec.-Feb. 1.45. N3. Jinsiyudie (C. japonica). Bright white. Middle. Jan.-Mar. 1.43. N4. Lianruicha (C. Theopsis) white. Small. Mar. 1.45. N5. Liujiaobai (C. japonica) pure white. Middle. Feb. ..... gene in rice cultivar ARC5984. Crop Prot. 26: 1431-1435. Lin KH, Lai YC, Li HC, Lo SF, Chen ...
Directory of Open Access Journals (Sweden)
Guang Chen
2018-01-01
Full Text Available Salinity imposes a major constraint over the productivity of rice. A set of chromosome segment substitution lines (CSSLs, derived from a cross between the japonica type cultivar (cv. Nipponbare (salinity sensitive and the indica type cv. 9311 (moderately tolerant, was scored using a hydroponics system for their salinity tolerance at the seedling stage. Two of the CSSLs, which share a ∼1.2 Mbp stretch of chromosome 4 derived from cv. Nipponbare, were as sensitive to the stress as cv. Nipponbare itself. Fine mapping based on an F2 population bred from a backcross between one of these CSSLs and cv. 9311 narrowed this region to 95 Kbp, within which only one gene (OsHAK1 exhibited a differential (lower transcript abundance in cv. Nipponbare and the two CSSLs compared to in cv. 9311. The gene was up-regulated by exposure to salinity stress both in the root and the shoot, while a knockout mutant proved to be more salinity sensitive than its wild type with respect to its growth at both the vegetative and reproductive stages. Seedlings over-expressing OsHAK1 were more tolerant than wild type, displaying a superior photosynthetic rate, a higher leaf chlorophyll content, an enhanced accumulation of proline and a reduced level of lipid peroxidation. At the transcriptome level, the over-expression of OsHAK1 stimulated a number of stress-responsive genes as well as four genes known to be involved in Na+ homeostasis and the salinity response (OsHKT1;5, OsSOS1, OsLti6a and OsLti6b. When the stress was applied at booting through to maturity, the OsHAK1 over-expressors out-yielded wild type by 25%, and no negative pleiotropic effects were expressed in plants gown under non-saline conditions. The level of expression of OsHAK1 was correlated with Na+/K+ homeostasis, which implies that the gene should be explored a target for molecular approaches to the improvement of salinity tolerance in rice.
Kuroda, Katsushi; Fujiwara, Takeshi; Hashida, Koh; Imai, Takanori; Kushi, Masayoshi; Saito, Kaori; Fukushima, Kazuhiko
2014-01-01
Background and Aims Heartwood formation is a unique phenomenon of tree species. Although the accumulation of heartwood substances is a well-known feature of the process, the accumulation mechanism remains unclear. The aim of this study was to determine the accumulation process of ferruginol, a predominant heartwood substance of Cryptomeria japonica, in heartwood-forming xylem. Methods The radial accumulation pattern of ferruginol was examined from sapwood and through the intermediate wood to the heartwood by direct mapping using time-of-flight secondary ion mass spectrometry (TOF-SIMS). The data were compared with quantitative results obtained from a novel method of gas chromatography analysis using laser microdissection sampling and with water distribution obtained from cryo-scanning electron microscopy. Key Results Ferruginol initially accumulated in the middle of the intermediate wood, in the earlywood near the annual ring boundary. It accumulated throughout the entire earlywood in the inner intermediate wood, and in both the earlywood and the latewood in the heartwood. The process of ferruginol accumulation continued for more than eight annual rings. Ferruginol concentration peaked at the border between the intermediate wood and heartwood, while the concentration was less in the latewood compared wiht the earlywood in each annual ring. Ferruginol tended to accumulate around the ray parenchyma cells. In addition, at the border between the intermediate wood and heartwood, the accumulation was higher in areas without water than in areas with water. Conclusions TOF-SIMS clearly revealed ferruginol distribution at the cellular level. Ferruginol accumulation begins in the middle of intermediate wood, initially in the earlywood near the annual ring boundary, then throughout the entire earlywood, and finally across to the whole annual ring in the heartwood. The heterogeneous timing of ferruginol accumulation could be related to the distribution of ray parenchyma cells
Tavaniello, S; Maiorano, G; Siwek, M; Knaga, S; Witkowski, A; Di Memmo, D; Bednarczyk, M
2014-08-01
The current research was conducted to compare growth, carcass traits, pH, intramuscular collagen (IMC) properties, and genetic bases of IMC and carcasses (breast-muscle weight) of different lines and generations of adult males and females of Japanese quail (Coturnix japonica). Forty-four quails (generation F0), 22 Pharaoh (F-33) meat-type males and 22 Standard (S-22) laying-type females, were crossed to produce the F1 hybrids generation. The F2 generation was created by mating one F1 male with one F1 female, full siblings. The birds, randomly chosen from F0 (22 males and 22 females), F1 (22 males and 22 females), and F2 (84 males and 152 females) were raised to 20 wk of age in collective cages. Quails were fed ad libitum commercial diets. At slaughter, all birds were individually weighed (after a fasting period of 12 h) and dressing yield (without giblets) was calculated. The carcasses were then dissected. Genomic DNA was extracted from all of the blood, and 30 microsatellite markers located on 2 quail chromosomes were genotyped. The F -: 33 quails had higher in vivo and postmortem performances and a higher abdominal fat percentage than those of the egg line. Meat from S -: 22 quails had a slower collagen maturation (hydroxylysylpyridinoline crosslink/collagen) and a higher ultimate pH. The F1 and F2 generations showed an evident sexual dimorphism, and an additional effect could be due to hybrid heterosis evident in F2. Meat from quails of F1 and F2 generations had a lower IMC amount with a higher degree of collagen maturation compared with parental lines. Two statistically significant QTL have been detected on quail chromosome 2 (CJA02): a QTL with an additive effect (0.50) for IMC in the marker bracket GUJ0037 and GUJ0093; a second QTL with additive (1.32) and dominant (1.91) effects for breast-muscle weight in the marker bracket GUJ0084 and GUJ0073. To our knowledge, this is the first report of a QTL associated with breast-muscle weight and IMC in quail and
Asai, Hiroki; Abe, Natsuko; Matsushima, Ryo; Crofts, Naoko; Oitome, Naoko F; Nakamura, Yasunori; Fujita, Naoko
2014-10-01
Starch synthase (SS) IIIa has the second highest activity of the total soluble SS activity in developing rice endosperm. Branching enzyme (BE) IIb is the major BE isozyme, and is strongly expressed in developing rice endosperm. A mutant (ss3a/be2b) was generated from wild-type japonica rice which lacks SSIIa activity. The seed weight of ss3a/be2b was 74-94% of that of the wild type, whereas the be2b seed weight was 59-73% of that of the wild type. There were significantly fewer amylopectin short chains [degree of polymerization (DP) ≤13] in ss3a/be2b compared with the wild type. In contrast, the amount of long chains (DP ≥25) connecting clusters of amylopectin in ss3a/be2b was higher than in the wild type and lower than in be2b. The apparent amylose content of ss3a/be2b was 45%, which was >1.5 times greater than that of either ss3a or be2b. Both SSIIIa and BEIIb deficiencies led to higher activity of ADP-glucose pyrophosphorylase (AGPase) and granule-bound starch synthase I (GBSSI), which partly explains the high amylose content in the ss3a/be2b endosperm. The percentage apparent amylose content of ss3a and ss3a/be2b at 10 days after flowering (DAF) was higher than that of the wild type and be2b. At 20 DAF, amylopectin biosynthesis in be2b and ss3a/be2b was not observed, whereas amylose biosynthesis in these lines was accelerated at 30 DAF. These data suggest that the high amylose content in the ss3a/be2b mutant results from higher amylose biosynthesis at two stages, up to 20 DAF and from 30 DAF to maturity. © The Author 2014. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Zhang, Jia-Yu; Zhang, Qian; Li, Ning; Wang, Zi-Jian; Lu, Jian-Qiu; Qiao, Yan-Jiang
2013-01-30
A method of modified diagnostic fragment-ion-based extension strategy (DFIBES) coupled to DFIs (diagnostic fragmentation ions) intensity analysis was successfully established to simultaneously screen and identify the chlorogenic acids (CGAs) in Flos Lonicerae Japonicae (FLJ) by HPLC-ESI-MS(n). DFIs, such as m/z 191 [quinic acid-H](-), m/z 179 [caffeic acid-H](-) and m/z 173 [quinic acid-H-H2O](-) were determined or proposed from the fragmentation patterns analysis of corresponding reference substances for every chemical family of CGAs. A "structure extension" method was then proposed based on the well-demonstrated fragmentation patterns and was successively applied into the rapid screening of CGAs in FLJ. Considering that substitution isomerism is a common phenomenon, a full ESI-MS(n) fragmentation analysis according to the intensity of DFIs has been performed to identify the CGA isomers. Based on the DFIs and intensity analysis, 41 peaks attributed to CGAs including 4 caffeoylquinic acids (CQA), 7 CQA glycosides, 6 dicaffeoylquinic acids (DiCQA), 10 DiCQA glycosides, 1 tricaffeoylquinic acids (TriCQA), 4p-coumaroylquinic acids (pCoQA), 3 feruloylquinic acids (FQA) and 6 caffeoylferuloylquinic acids (CFQA) were identified preliminarily in a 65-min chromatographic run. It was the first time to systematically report the presence of CGAs in FLJ, especially for CQA glycosides, DiCQA glycosides, TriCQA, pCoQA and CFQA. All the results indicated that the method of developed DFIBES coupled to DFIs analysis was feasible, reliable and universal for screening and identifying the constituents with the same carbon skeletons especially the isomeric compounds from the complex extract of TCMs. Copyright © 2012 Elsevier B.V. All rights reserved.
Kan, Kotaro; Sato, Masanori; Nagasawa, Kazuya
2016-02-01
Dietary items of the Japanese eel Anguilla japonica inhabiting estuaries were examined by analyses of the gut (stomach and intestine) contents in two areas in Kyushu, western Japan. In a small estuary in Kagoshima Bay, where seven eel guts were examined, almost all of the dietary organisms consisted of Hemigrapsus crabs and Hediste polychaetes, both of which commonly occurred on tidal flats of this site during our survey on the macrobenthic fauna. In another large estuary in the innermost part of the Ariake Sea, where 14 eel guts were examined, 11 macrobenthic species (nine crustaceans, a polychaete, and a gastropod) were found in the gut contents, mostly consisting of mudflat-specific species. The dietary items are almost completely different not only between the two estuaries, but also among three neighboring sites within the large estuary in the Ariake Sea. These results show that Japanese eels feed on various macrobenthic invertebrates inhabiting estuarine tidal flats at each site. The variety of the prey species occupying different habitats indicates that their foraging areas extend to a wide range of estuarine tidal flats from the upper to lower littoral zones. The physalopterid nematode Heliconema anguillae was found parasitic in eel stomachs in both estuaries. The prevalence of the nematode was higher in the estuary in Kagoshima Bay (100%) than that in the Ariake Sea (43%), although the intensity in the former (4-94 nematodes per infected stomach) was comparable to that of the latter (2-96). The relationship between the nematode infection and the dietary items of Japanese eels is discussed.
Impact of model uncertainty on soil quality standards for cadmium in rice paddy fields
International Nuclear Information System (INIS)
Roemkens, P.F.A.M.; Brus, D.J.; Guo, H.Y.; Chu, C.L.; Chiang, C.M.; Koopmans, G.F.
2011-01-01
At present, soil quality standards used for agriculture do not consider the influence of pH and CEC on the uptake of pollutants by crops. A database with 750 selected paired samples of cadmium (Cd) in soil and paddy rice was used to calibrate soil to plant transfer models using the soil metal content, pH, and CEC or soil Cd and Zn extracted by 0.01 M CaCl 2 as explanatory variables. The models were validated against a set of 2300 data points not used in the calibration. These models were then used inversely to derive soil quality standards for Japonica and Indica rice cultivars based on the food quality standards for rice. To account for model uncertainty, strict soil quality standards were derived considering a maximum probability that rice exceeds the food quality standard equal to 10 or 5%. Model derived soil standards based on Aqua Regia ranged from less than 0.3 mg kg -1 for Indica at pH 4.5 to more than 6 mg kg -1 for Japonica-type cultivars in clay soils at pH 7. Based on the CaCl 2 extract, standards ranged from 0.03 mg kg -1 Cd for Indica cultivars to 0.1 mg kg -1 Cd for Japonica cultivars. For both Japonica and Indica-type cultivars, the soil quality standards must be reduced by a factor of 2 to 3 to obtain the strict standards. The strong impact of pH and CEC on soil quality standards implies that it is essential to correct for soil type when deriving national or local standards. Validation on the remaining 2300 samples indicated that both types of models were able to accurately predict (> 92%) whether rice grown on a specific soil will meet the food quality standard used in Taiwan. - Research highlights: → Cadmium uptake by Japonica and Indica rice varieties depends on soil pH and CEC. → Food safety based soil standards range from 0.3 (Indica) to 6 mg kg -1 (Japonica). → Model uncertainty leads to strict soil standards of less than 0.1 mg kg -1 for Indica. → Soil pH and CEC should be considered to obtain meaningful standards for agriculture.
Ethanol production from marine algal hydrolysates using Escherichia coli KO11.
Kim, Nag-Jong; Li, Hui; Jung, Kwonsu; Chang, Ho Nam; Lee, Pyung Cheon
2011-08-01
Algae biomass is a potential raw material for the production of biofuels and other chemicals. In this study, biomass of the marine algae, Ulva lactuca, Gelidium amansii,Laminaria japonica, and Sargassum fulvellum, was treated with acid and commercially available hydrolytic enzymes. The hydrolysates contained glucose, mannose, galactose, and mannitol, among other sugars, at different ratios. The Laminaria japonica hydrolysate contained up to 30.5% mannitol and 6.98% glucose in the hydrolysate solids. Ethanogenic recombinant Escherichia coli KO11 was able to utilize both mannitol and glucose and produced 0.4g ethanol per g of carbohydrate when cultured in L. japonica hydrolysate supplemented with Luria-Bertani medium and hydrolytic enzymes. The strategy of acid hydrolysis followed by simultaneous enzyme treatment and inoculation with E. coli KO11 could be a viable strategy to produce ethanol from marine alga biomass. Copyright © 2011 Elsevier Ltd. All rights reserved.
Bioethanol production from mannitol by a newly isolated bacterium, Enterobacter sp. JMP3.
Wang, Jing; Kim, Young Mi; Rhee, Hong Soon; Lee, Min Woo; Park, Jong Moon
2013-05-01
In this study a new bacterium capable of growing on brown seaweed Laminaria japonica, Enterobacter sp. JMP3 was isolated from the gut of turban shell, Batillus cornutus. In anaerobic condition, it produced high yields of ethanol (1.15 mol-EtOH mol-mannitol(-1)) as well as organic acids from mannitol, the major carbohydrate component of L. japonica. Based on carbon distribution and metabolic flux analysis, it was revealed that mannitol was more favorable than glucose for ethanol production due to their different redox states. This indicates that L. japonica is one of the promising feedstock for bioethanol production. Additionally, the mannitol dehydrogenation pathway in Enterobacter sp. JMP3 was examined and verified. Finally, an attempt was made to explore the possibility of controlling ethanol production by altering the redox potential via addition of external NADH in mannitol fermentation. Copyright © 2012 Elsevier Ltd. All rights reserved.
Schizosaccharomyces japonicus: the fission yeast is a fusion of yeast and hyphae.
Niki, Hironori
2014-03-01
The clade of Schizosaccharomyces includes 4 species: S. pombe, S. octosporus, S. cryophilus, and S. japonicus. Although all 4 species exhibit unicellular growth with a binary fission mode of cell division, S. japonicus alone is dimorphic yeast, which can transit from unicellular yeast to long filamentous hyphae. Recently it was found that the hyphal cells response to light and then synchronously activate cytokinesis of hyphae. In addition to hyphal growth, S. japonicas has many properties that aren't shared with other fission yeast. Mitosis of S. japonicas is referred to as semi-open mitosis because dynamics of nuclear membrane is an intermediate mode between open mitosis and closed mitosis. Novel genetic tools and the whole genomic sequencing of S. japonicas now provide us with an opportunity for revealing unique characters of the dimorphic yeast. © 2013 The Author. Yeast Published by John Wiley & Sons Ltd.
2013-04-01
galli Barnyard grass Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera japonica... Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera japonica Japanese Honeysuckle...crus-galli Barnyard grass Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera
Feng, Jianjun; Guan, Ruizhang; Guo, Songlin; Lin, Peng; Zadlock, Frank
2014-09-01
As a potent pleiotropic cytokine, tumor necrosis factor-alpha (TNF-α) plays an important role in innate immune responses. The cDNA sequence and genomic structure of the TNF-α gene ( Aj TNF-α) in the Japanese eel ( Anguilla japonica) were identified and characterized. The full-length AjTNF-α cDNA was 1 546 bp, including a 5'-untranslated region (UTR) of 13 bp, a 3'-UTR of 879 bp and an open reading frame of 654 bp encoding a protein of 218 amino acids. The full-length genomic sequence of AjTNF-α was 2 392 bp and included four exons and three introns. The putative AjTNF-α protein contained TNF family signature motifs, including a protease cleavage site, a transmembrane domain and two conserved cysteine residues. Quantitative real-time reverse transcription PCR analysis revealed AjTNF-α expression in a wide range of tissues, with predominant expression in blood and liver. Lower levels of expression were seen in spleen, gills, kidney, intestine, heart, and skin, with very low levels in muscle. The modulation of AjTNF-α expression after injection of eels with lipopolysaccharide (LPS), the viral mimic, poly I:C, or Aeromonas hydrophila was assessed in blood, liver, and kidney. In blood, TNF-α mRNA levels increased rapidly and then rapidly decreased after stimulation with LPS, poly I:C or A. hydrophila. However, the response to LPS and A. hydrophila peaked at 6 h while for poly I:C the peak was at 12 h. In liver, after injection with A. hydrophila, an up- and down-regulation of AjTNF-α expression occurred twice, peaking at 6 h and 24 h, respectively. No remarkable increase of AjTNF-α expression appeared in liver until 72 h after LPS or poly I:C treatment. In kidney, AjTNF-α expression increased significantly only at 72 h post-stimulation with LPS or A. hydrophila. Our results suggest that AjTNF-α plays an important role in fish in the defense against viral and bacterial infection.
International Nuclear Information System (INIS)
Liu Yanju; Zhu Yongguan; Ding Hui
2007-01-01
Lead and cadmium uptake was investigated for common deciduous street trees in Beijing in this study. Species having Cd accumulation included Populus tomentosa, Sophora japonica and Catalpa speciosa. P. tomentosa had the highest ratios between leaf and soil Cd (0.848), followed by S. japonica (0.536), C. speciosa (0.493), Paulownia tomentosa (0.453) and Juglans regia (0.415). Pb levels were high in leaves of C. speciosa, J. regia and Pa. tomentosa. S. japonica had the highest ratio between leaf Pb and soil Pb (0.146), followed by Pa. tomentosa (0.143), Ginko biloba (0.103) and C. speciosa (0.095). A predictive foliar metal accumulation index (MAI) was developed and C. speciosa was calculated to have the highest MAI value (53.8). This suggests that C. speciosa would be a good choice for planting in areas of Beijing where soil contamination with Cd and Pb may be a problem. - Catalpa speciosa had the highest MAI value
Suppression of a NAC-like transcription factor gene improves boron-toxicity tolerance in rice.
Ochiai, Kumiko; Shimizu, Akifumi; Okumoto, Yutaka; Fujiwara, Toru; Matoh, Toru
2011-07-01
We identified a gene responsible for tolerance to boron (B) toxicity in rice (Oryza sativa), named BORON EXCESS TOLERANT1. Using recombinant inbred lines derived from the B-toxicity-sensitive indica-ecotype cultivar IR36 and the tolerant japonica-ecotype cultivar Nekken 1, the region responsible for tolerance to B toxicity was narrowed to 49 kb on chromosome 4. Eight genes are annotated in this region. The DNA sequence in this region was compared between the B-toxicity-sensitive japonica cultivar Wataribune and the B-toxicity-tolerant japonica cultivar Nipponbare by eco-TILLING analysis and revealed a one-base insertion mutation in the open reading frame sequence of the gene Os04g0477300. The gene encodes a NAC (NAM, ATAF, and CUC)-like transcription factor and the function of the transcript is abolished in B-toxicity-tolerant cultivars. Transgenic plants in which the expression of Os04g0477300 is abolished by RNA interference gain tolerance to B toxicity.
Suppression of a NAC-Like Transcription Factor Gene Improves Boron-Toxicity Tolerance in Rice1
Ochiai, Kumiko; Shimizu, Akifumi; Okumoto, Yutaka; Fujiwara, Toru; Matoh, Toru
2011-01-01
We identified a gene responsible for tolerance to boron (B) toxicity in rice (Oryza sativa), named BORON EXCESS TOLERANT1. Using recombinant inbred lines derived from the B-toxicity-sensitive indica-ecotype cultivar IR36 and the tolerant japonica-ecotype cultivar Nekken 1, the region responsible for tolerance to B toxicity was narrowed to 49 kb on chromosome 4. Eight genes are annotated in this region. The DNA sequence in this region was compared between the B-toxicity-sensitive japonica cultivar Wataribune and the B-toxicity-tolerant japonica cultivar Nipponbare by eco-TILLING analysis and revealed a one-base insertion mutation in the open reading frame sequence of the gene Os04g0477300. The gene encodes a NAC (NAM, ATAF, and CUC)-like transcription factor and the function of the transcript is abolished in B-toxicity-tolerant cultivars. Transgenic plants in which the expression of Os04g0477300 is abolished by RNA interference gain tolerance to B toxicity. PMID:21543724
Zhang, Jia-yu; Wang, Zi-jian; Li, Yun; Liu, Ying; Cai, Wei; Li, Chen; Lu, Jian-qiu; Qiao, Yan-jiang
2016-01-15
The analytical methodologies for evaluation of multi-component system in traditional Chinese medicines (TCMs) have been inadequate or unacceptable. As a result, the unclarity of multi-component hinders the sufficient interpretation of their bioactivities. In this paper, an ultra-high-performance liquid chromatography coupled with linear ion trap-Orbitrap (UPLC-LTQ-Orbitrap)-based strategy focused on the comprehensive identification of TCM sequential constituents was developed. The strategy was characterized by molecular design, multiple ion monitoring (MIM), targeted database hits and mass spectral trees similarity filter (MTSF), and even more isomerism discrimination. It was successfully applied in the HRMS data-acquisition and processing of chlorogenic acids (CGAs) in Flos Lonicerae Japonicae (FLJ), and a total of 115 chromatographic peaks attributed to 18 categories were characterized, allowing a comprehensive revelation of CGAs in FLJ for the first time. This demonstrated that MIM based on molecular design could improve the efficiency to trigger MS/MS fragmentation reactions. Targeted database hits and MTSF searching greatly facilitated the processing of extremely large information data. Besides, the introduction of diagnostic product ions (DPIs) discrimination, ClogP analysis, and molecular simulation, raised the efficiency and accuracy to characterize sequential constituents especially position and geometric isomers. In conclusion, the results expanded our understanding on CGAs in FLJ, and the strategy could be exemplary for future research on the comprehensive identification of sequential constituents in TCMs. Meanwhile, it may propose a novel idea for analyzing sequential constituents, and is promising for quality control and evaluation of TCMs. Copyright © 2015 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Laxman Kumar Babu
2017-04-01
Full Text Available Aim: The objective of this study was to evaluate the effect of feeding fermented fish silage (FFS on serum biochemical parameters of Japanese quails (Coturnix coturnix japonica. Materials and Methods: A total of 192, 7-day-old broiler Japanese quail chicks of either sex, were randomly distributed into four dietary treatments with four replicates in each group having 12 chicks in each replicate pen. The dietary treatments were T1 - Control diet, T2 - Diet containing 5% FFS, T3 - Diet containing 10% FFS, and T4 - Diet containing 15% FFS. Group body weight and feed consumption were recorded at weekly intervals. Feed conversion ratio (FCR was derived by dividing the feed consumed with the weekly body weight gain. At the end of the experiment, 8 birds from each treatment were selected randomly and sacrificed by cervical dislocation to study the carcass traits expressed as % pre-slaughter live weight. At 5 weeks of age, about 2 ml of blood was taken from the jugular vein of each selected bird, and serum samples were separated after centrifugation. Total protein, albumin/globulin (A/G ratio, calcium, phosphorus, triglyceride, total cholesterol, high density lipoprotein-cholesterol (HDL-C, very low density lipoprotein-cholesterol (VLDL-C, low density lipoprotein-cholesterol (LDL-C, alanine aminotransferase (ALT, and aspartate aminotransferase (AST were estimated in the serum. Results: The cumulative body weight gains from 1 to 5 weeks of age did not vary significantly between control and 5% FFS group. However, a linear decrease in body weight gain was observed by increasing the levels of FFS beyond 5% in the diet. The cumulative feed consumption was significantly higher in case of birds under control group during 1-5 weeks of age as compared to birds fed FFS based diet (5%, 10%, and 15%. No statistical difference in cumulative feed conversion ratio could be noticed during 1-5 weeks of age. The eviscerated yield decreased and giblet weight increased due
Impact of model uncertainty on soil quality standards for cadmium in rice paddy fields
Energy Technology Data Exchange (ETDEWEB)
Roemkens, P.F.A.M., E-mail: paul.romkens@wur.nl [Soil Science Center, Alterra, WageningenUR. P.O. Box 47, 6700AA Wageningen (Netherlands); Brus, D.J. [Soil Science Center, Alterra, WageningenUR. P.O. Box 47, 6700AA Wageningen (Netherlands); Guo, H.Y.; Chu, C.L.; Chiang, C.M. [Taiwan Agricultural Research Institute (TARI), Wufong, Taiwan (China); Koopmans, G.F. [Soil Science Center, Alterra, WageningenUR. P.O. Box 47, 6700AA Wageningen (Netherlands); Department of Soil Quality, Wageningen University, WageningenUR. P.O. Box 47, 6700AA, Wageningen (Netherlands)
2011-08-01
At present, soil quality standards used for agriculture do not consider the influence of pH and CEC on the uptake of pollutants by crops. A database with 750 selected paired samples of cadmium (Cd) in soil and paddy rice was used to calibrate soil to plant transfer models using the soil metal content, pH, and CEC or soil Cd and Zn extracted by 0.01 M CaCl{sub 2} as explanatory variables. The models were validated against a set of 2300 data points not used in the calibration. These models were then used inversely to derive soil quality standards for Japonica and Indica rice cultivars based on the food quality standards for rice. To account for model uncertainty, strict soil quality standards were derived considering a maximum probability that rice exceeds the food quality standard equal to 10 or 5%. Model derived soil standards based on Aqua Regia ranged from less than 0.3 mg kg{sup -1} for Indica at pH 4.5 to more than 6 mg kg{sup -1} for Japonica-type cultivars in clay soils at pH 7. Based on the CaCl{sub 2} extract, standards ranged from 0.03 mg kg{sup -1} Cd for Indica cultivars to 0.1 mg kg{sup -1} Cd for Japonica cultivars. For both Japonica and Indica-type cultivars, the soil quality standards must be reduced by a factor of 2 to 3 to obtain the strict standards. The strong impact of pH and CEC on soil quality standards implies that it is essential to correct for soil type when deriving national or local standards. Validation on the remaining 2300 samples indicated that both types of models were able to accurately predict (> 92%) whether rice grown on a specific soil will meet the food quality standard used in Taiwan. - Research highlights: {yields} Cadmium uptake by Japonica and Indica rice varieties depends on soil pH and CEC. {yields} Food safety based soil standards range from 0.3 (Indica) to 6 mg kg{sup -1} (Japonica). {yields} Model uncertainty leads to strict soil standards of less than 0.1 mg kg{sup -1} for Indica. {yields} Soil pH and CEC should be
Directory of Open Access Journals (Sweden)
González Elena
1986-12-01
Full Text Available An anatomy study was made of following wood easy-to-root species: Aucuba japonica Thunb., Buddleja japonica Hemsley, Buxus sempervirens L., Citrus aurantium. L., Citrus limon (L. Burm. fil., Cvdonia oblonga Miller, Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L., Populus nigra L., Rhododendron ponticum L., Salix atrocinerea Brot., Salix viminalis L., Sambucus nigra L. and Symphoricarpos albus (L. S. F. Blake. It was observed the presence or absence of a discontinous sclerenchyma ring so the species studied had not a mechanical barrier to the emergence of adventitious roots. Se realizó un estudio histológico de las siguientes especies leñosas de fácil enraizamiento: Aucuba japonica Thumb, Buddleja japonica Hemsley, Buxus sempervirens L., Citrus aurantium L., Citrus limon (L. Burm, fil., Cydonia oblonga Miller, Erica arborea L., Escallonia rubra (Ruiz & Pavón Pers., Euonymus japonicus L. fil., Forsythia viridissima Lindl., Hydrangea macrophylla Ser., Morus alba L. Populus nigra L., Rhododendron ponticum L., Salix atrocinerea Brot., Salix viminalis L., Sambucus nigra L. y Syrnphoricarpos albus (L. S. F. Blake. Se observó la presencia o ausencia de un anillo discontinuo de esclerénquima, por lo tanto dichas especies no poseen ningún impedimento mecánico para la emergencia de las raíces adventicias.
Hybrid male sterility in rice is due to epistatic interactions with a pollen killer locus.
Kubo, Takahiko; Yoshimura, Atsushi; Kurata, Nori
2011-11-01
In intraspecific crosses between cultivated rice (Oryza sativa) subspecies indica and japonica, the hybrid male sterility gene S24 causes the selective abortion of male gametes carrying the japonica allele (S24-j) via an allelic interaction in the heterozygous hybrids. In this study, we first examined whether male sterility is due solely to the single locus S24. An analysis of near-isogenic lines (NIL-F(1)) showed different phenotypes for S24 in different genetic backgrounds. The S24 heterozygote with the japonica genetic background showed male semisterility, but no sterility was found in heterozygotes with the indica background. This result indicates that S24 is regulated epistatically. A QTL analysis of a BC(2)F(1) population revealed a novel sterility locus that interacts with S24 and is found on rice chromosome 2. The locus was named Epistatic Factor for S24 (EFS). Further genetic analyses revealed that S24 causes male sterility when in combination with the homozygous japonica EFS allele (efs-j). The results suggest that efs-j is a recessive sporophytic allele, while the indica allele (EFS-i) can dominantly counteract the pollen sterility caused by S24 heterozygosity. In summary, our results demonstrate that an additional epistatic locus is an essential element in the hybrid sterility caused by allelic interaction at a single locus in rice. This finding provides a significant contribution to our understanding of the complex molecular mechanisms underlying hybrid sterility and microsporogenesis.
Directory of Open Access Journals (Sweden)
Jessy Bagh
2016-08-01
Full Text Available Aim: The present study was conducted to evaluate the performance of gray, brown, and white varieties of Japanese quail (Coturnix coturnix japonica with respect to body weight, egg production, and egg quality traits in the coastal climatic condition of Odisha. Materials and Methods: A total of 500-day-old straight run Japanese quail chicks of three varieties, viz., gray, brown, and white were randomly selected and reared in deep litter system at Central Poultry Development Organization, Eastern Region, Bhubaneswar. The weekly body weight of the birds was recorded till their egg production stage (up to 6 weeks of age. The average egg production was recorded every biweekly from 6th to 20th week. Exterior and interior quality of eggs from each variety was determined at 6 weeks of age. Results: The initial average weekly body weight of three varieties did not differ (p>0.05 among the varieties. However, from 1st to 6th week significantly higher body weight was observed in gray than white and brown. Brown varieties had reached 50% egg production 1 week earlier than gray and white. Brown had higher peak hen day (HD production or henhoused egg production followed by white and gray. External quality such as: Egg weight, egg length, egg width, volume, shape index, shell weight, shell thickness depicted no significant difference among the varieties except circumference length and circumference width, which were significantly higher (p≤0.05 in gray varieties than brown varieties. Internal egg characteristics such as: Albumen length, albumen width, albumen height, albumen index, yolk length, yolk width, yolk height, yolk index, albumen weight, yolk weight, Haugh unit revealed no significance difference among the varieties. Conclusion: It may be summarized from the findings that gray excelled in body weight followed by white and brown. Egg production potential in terms of hen house egg production or HD egg production was higher for brown followed by white
International Nuclear Information System (INIS)
Katsuhiro Kojima; Djedidi Salem
2017-01-01
We studied varietal difference in radiocesium accumulation by using Japanese and World rice collection for future development of low accumulation varieties. As a result, the radiocesium activity concentration varied by 12- and 22-fold in seed grains and straws, respectively. When we examined the seed grain to straw ratio of radiocesium activity concentration, paddy rice cultivars of Japonica sub-species showed a lower result than Indica and Javanica paddy rice cultivars. These observations suggest that the Japonica paddy rice cultivars may have the property of repressing radioactive cesium translocation to edible parts. (author)
DEFF Research Database (Denmark)
Chan, B.K.K.; Garm, A.; Høeg, Jens Thorvald
2008-01-01
between cirral setation and feeding mode. The species studied comprise both pedunculate and sessile forms and represent a wide range of marine habitats as well as morphologies, viz., Ibla cumingi, Octolasmis warwickii, Capitulum mitella, Pollicipes polymerus, Tetraclita japonica japonica and Megabalanus...... in the mantle cavity using the setae on their three pairs of maxillipeds. Our results indicate that in thoracican barnacles, adaptations in feeding behaviour are associated with changes in the setation pattern of the cirri. In addition, the setal types and their distribution on the cirri are potential new...
Singh, Sangeeta; Chand, Suresh; Singh, N. K.; Sharma, Tilak Raj
2015-01-01
The resistance (R) genes and defense response (DR) genes have become very important resources for the development of disease resistant cultivars. In the present investigation, genome-wide identification, expression, phylogenetic and synteny analysis was done for R and DR-genes across three species of rice viz: Oryza sativa ssp indica cv 93-11, Oryza sativa ssp japonica and wild rice species, Oryza brachyantha. We used the in silico approach to identify and map 786 R -genes and 167 DR-genes, 672 R-genes and 142 DR-genes, 251 R-genes and 86 DR-genes in the japonica, indica and O. brachyanth a genomes, respectively. Our analysis showed that 60.5% and 55.6% of the R-genes are tandemly repeated within clusters and distributed over all the rice chromosomes in indica and japonica genomes, respectively. The phylogenetic analysis along with motif distribution shows high degree of conservation of R- and DR-genes in clusters. In silico expression analysis of R-genes and DR-genes showed more than 85% were expressed genes showing corresponding EST matches in the databases. This study gave special emphasis on mechanisms of gene evolution and duplication for R and DR genes across species. Analysis of paralogs across rice species indicated 17% and 4.38% R-genes, 29% and 11.63% DR-genes duplication in indica and Oryza brachyantha, as compared to 20% and 26% duplication of R-genes and DR-genes in japonica respectively. We found that during the course of duplication only 9.5% of R- and DR-genes changed their function and rest of the genes have maintained their identity. Syntenic relationship across three genomes inferred that more orthology is shared between indica and japonica genomes as compared to brachyantha genome. Genome wide identification of R-genes and DR-genes in the rice genome will help in allele mining and functional validation of these genes, and to understand molecular mechanism of disease resistance and their evolution in rice and related species. PMID:25902056
Directory of Open Access Journals (Sweden)
XIE Mixue
2013-08-01
Full Text Available The improvement of rice eating quality is a very important direction of rice breeding.Clearing the different genotype of rice eating quality provides the basis for the parent selection on breeding good eating quality rice.Using molecular marker detection technology,genotypes of ten genes related to eating quality of 22 Shanghai important rice varieties,including conventional rice and hybrid parents were detected.The results showed that "Zixiangnuo 861" rice contained many poor genotypes which might affect rice eating quality.The genotypes of 3 male parents,"Xiangqin","R44" and "Fan14" for three kinds of hybrid rice,"Hannyouxiangqing","Qiuyoujinfeng" and "Huayou14",respectively,were not as good as their corresponding female parents,"HanfengA","JinfengA" and "Shen9A" and another conventional rice varieties.Wx polymorphism analysis showed that there were two glutinous rice,four soft rice japonica and 16 non-soft rice japonica."Baonong34","Jinfeng" and "Yinxiang18" had relatively better genotypes of the genes controlling eating quality among the 16 non-soft rice japonica.
Kubo, Takahiko; Yoshimura, Atsushi; Kurata, Nori
2018-02-10
Hybrid male sterility genes are important factors in creating postzygotic reproductive isolation barriers in plants. One such gene, S25, is known to cause severe transmission ratio distortion in inter-subspecific progeny of cultivated rice Oryza sativa ssp. indica and japonica. To further characterize the S25 gene, we fine-mapped and genetically characterized the S25 gene using near-isogenic lines with reciprocal genetic backgrounds. We mapped the S25 locus within the 0.67-1.02 Mb region on rice chromosome 12. Further genetic analyses revealed that S25 substantially reduced male fertility in the japonica background, but not in the indica background. In first-generation hybrid progeny, S25 had a milder effect than it had in the japonica background. These results suggest that the expression of S25 is epistatically regulated by at least one partially dominant gene present in the indica genome. This finding supports our previous studies showing that hybrid male sterility due to pollen killer genes results from epistatic interaction with other genes that are hidden in the genetic background.
Genomic structural variation-mediated allelic suppression causes hybrid male sterility in rice.
Shen, Rongxin; Wang, Lan; Liu, Xupeng; Wu, Jiang; Jin, Weiwei; Zhao, Xiucai; Xie, Xianrong; Zhu, Qinlong; Tang, Huiwu; Li, Qing; Chen, Letian; Liu, Yao-Guang
2017-11-03
Hybrids between divergent populations commonly show hybrid sterility; this reproductive barrier hinders hybrid breeding of the japonica and indica rice (Oryza sativa L.) subspecies. Here we show that structural changes and copy number variation at the Sc locus confer japonica-indica hybrid male sterility. The japonica allele, Sc-j, contains a pollen-essential gene encoding a DUF1618-domain protein; the indica allele, Sc-i, contains two or three tandem-duplicated ~ 28-kb segments, each carrying an Sc-j-homolog with a distinct promoter. In Sc-j/Sc-i hybrids, the high-expression of Sc-i in sporophytic cells causes suppression of Sc-j expression in pollen and selective abortion of Sc-j-pollen, leading to transmission ratio distortion. Knocking out one or two of the three Sc-i copies by CRISPR/Cas9 rescues Sc-j expression and male fertility. Our results reveal the gene dosage-dependent allelic suppression as a mechanism of hybrid incompatibility, and provide an effective approach to overcome the reproductive barrier for hybrid breeding.
Directory of Open Access Journals (Sweden)
Juliano Bolson
2005-10-01
Full Text Available Na cirurgia ortopédica, são freqüentes as situações em que o cirurgião se depara com grandes perdas ósseas, provocadas especialmente por traumatismos de alta energia, tumores ou infecções. A reparação dessas fraturas requer grande conhecimento a respeito de materiais que possam ser utilizados para preencher essas falhas. Esses materiais podem ser derivados biológicos, sintéticos ou metálicos. Dentre eles, destacam-se os enxertos ósseos e os implantes de biomateriais. Com o aumento dos animais exóticos, utilizados como animais de estimação, a casuística clínica e cirúrgica dessa especialidade vem crescendo, tanto em clínicas quanto em hospitais veterinários. Particularmente, as aves constituem a maioria desses animais, e entre seus problemas cirúrgicos as fraturas são os de maior destaque. O objetivo deste trabalho foi estudar o efeito clínico, radiológico, macroscópico e histológico da poliuretana derivada do polímero de mamona (Ricinnus communis implantada no úmero de codornas domésticas (Coturnix japonica. Para isso, foram utilizadas 20 codornas, machos e fêmeas, separadas aleatoriamente em quatro grupos de cinco animais, os quais receberam o implante no úmero esquerdo, com exame clínico diário durante o período pós-operatório, avaliações radiológica imediata e quinzenal e macroscópica e histológica aos 15, 30, 60 e 90 dias. Clinicamente não foram observadas alterações locais, regionais nem sistêmicas. Ao exame radiológico, notou-se aumento de densidade local, sem sinais de alteração óssea, dos tecidos circunjacentes, e de sacos aéreos. A análise macroscópica revelou que a poliuretana de mamona não foi absorvida em nenhum dos quatro grupos permanecendo implantada no seio do osso pneumático, porém, notou-se alteração em sua resistência. O exame histopatológico mostra inicialmente mínima reação inflamatória, discreta fibrose ao redor do implante e osteointegração pela presen
Petritz, Olivia A; Guzman, David Sanchez-Migallon; Hawkins, Michelle G; Kass, Philip H; Conley, Alan J; Paul-Murphy, Joanne
2015-12-01
Reproductive disease in captive avian species is common, and medical management is often chosen over surgical removal of the reproductive tract. In a previous study with Japanese quail, a single 4.7-mg deslorelin acetate implant reversibly decreased egg production in 6 out 10 birds for 70 days. The objective of the current study was to evaluate the effects of two 4.7-mg deslorelin acetate implants versus one 9.4-mg implant on egg production and plasma progesterone concentrations in Japanese quail ( Coturnix coturnix japonica). Following a 10-day period of consistent egg laying, 30 adult female Japanese quail were anesthetized and received two 4.7-mg deslorelin implants (n = 10), one 9.4-mg deslorelin implant (n = 10), or a single, identical placebo implant (n = 10) s.c. between the scapulae. Egg production was monitored daily, and plasma progesterone concentrations were measured on days 0, 14, 29, 120, 148, and 182 via enzyme-linked immunoassay. All birds were weighed periodically and euthanized at day 182, after which their reproductive tracts were evaluated at gross necropsy. Seven out of 10 birds treated with two 4.7-mg implants ceased egg laying 1 wk after implantation and remained nonovulatory for approximately 100 days. Cessation of egg laying for the 9.4-mg treatment group occurred in 7 out of 10 birds; onset was variable (weeks 5-12) and continued for the remainder of the study period. Plasma progesterone concentrations for deslorelin treatment groups were not significantly different compared to the placebo group at any time point. In conclusion, the two 4.7-mg and the one 9.4-mg implant treatments ceased egg laying in a similar number of birds, but the 9.4-mg implant had a slower onset of action and the effects on egg laying were inconsistent throughout the study period. Further studies evaluating use of deslorelin acetate in other avian species are needed.
Influence of x-irradiation on pharyngeal induction in the Planarian, Dugesia japonica japonica
International Nuclear Information System (INIS)
Asai, Etsuo
1980-01-01
Pharyngeal formation was examined in cases where normal or X-irradiated head pieces were transplanted into the postpharyngeal region of normal or irradiated worms. Transplantation experiments were carried out in four different combinations of hosts and grafts: (1) normal host and graft (control), (2) normal host and irradiated graft, (3) irradiated host and normal graft, (4) irradiated host and graft. In the first experiment, well developed pharynges were formed in the areas both anterior and posterior to the graft on the 14th day after transplantation. In the second experiment, formation of new pharynges was delayed compared with that in the first group. In the third experiment, only one pharynx developed in the area posterior to each graft in most cases. In the last experiment, no new pharynx appeared at all. From these results, the influence of X-rays on factors participating in pharyngeal induction was discussed. (author)
Directory of Open Access Journals (Sweden)
Peña, Viviana
2006-06-01
Full Text Available A revision of the genus Dasya in northwestern Iberian Peninsula is presented. Three species (Dasya hutchinsiae, D. ocellata and D. sessilis are confirmed whilst other three (Dasya corymbifera, D. punicea and D. rigidula are excluded from the Galician seaweeds flora. The alien species Dasya sessilis Yamada is a new record for the European Atlantic coasts. The study of the herbarium material reveals that D. sessilis was misidentified with other Dasyaceae species and that it has been collected on the Galician coasts for more than 16 years. Morphological and anatomical features of D. sessilis as well as its distribution and chronological data on the Galician coasts are provided. A comparison of the Iberian specimens with the Mediterranean and Asian plants is also included. Dasya sessilis was found growing on a wide range of substrata, from the lower intertidal to subtidal at moderate wave-exposed and sheltered areas. It is abundant in harbours and aquaculture areas together with other alien species such as Heterosiphonia japonica and Undaria pinnatifida. The comparative study between D. sessilis and similar European and Iberian Dasyaceae species is undertaken to prevent further misidentifications. Dasya sessilis is the largest Dasya species, with broader main axes (1-2 mm wide vs 200-500 µm in D. ocellata and 500-600 µm in D. hutchinsiae; pseudolaterals of D. sessilis are 3-5 times pseudodichotomously branched compared to 5-8 times in D. hutchinsiae and 4-5 times in D. ocellata; pseudolateral tips are broader in D. sessilis than in D. ocellata, but smaller than pseudolateral apices of D. hutchinsiae; tetrasporangial stichidium of Dasya sessilis has 6-7 periaxial cells (and 6-7 tetrasporangia per fertile whorl vs. 4-5 in the rest of the native species; and tetrasporangial stichidia of D. sessilis are longer and cystocarps broader than those in D. hutchinsiae. The alien Dasyaceae species Heterosiphonia japonica, similar in size to Dasya sessilis
Apoptosis induction is involved in UVA-induced autolysis in sea cucumber Stichopus japonicus.
Qi, Hang; Fu, Hui; Dong, Xiufang; Feng, Dingding; Li, Nan; Wen, Chengrong; Nakamura, Yoshimasa; Zhu, Beiwei
2016-05-01
Autolysis easily happens to sea cucumber (Stichopus japonicus, S. japonicus) for external stimulus like UV exposure causing heavy economic losses. Therefore, it is meaningful to reveal the mechanism of S. japonicas autolysis. In the present study, to examine the involvement of apoptosis induction in UVA-induced autolysis of S. japonicas, we investigated the biochemical events including the DNA fragmentation, caspase-3 activation, mitogen-activated protein kinases (MAPKs) phosphorylation and free radical formation. Substantial morphological changes such as intestine vomiting and dermatolysis were observed in S. japonicus during the incubation after 1-h UVA irradiation (10W/m(2)). The degradation of the structural proteins and enhancement of cathepsin L activity were also detected, suggesting the profound impact of proteolysis caused by the UVA irradiation even for 1h. Furthermore, the DNA fragmentation and specific activity of caspase-3 was increased up to 12h after UVA irradiation. The levels of phosphorylated p38 mitogen activated protein kinase (MAPK) and phosphorylated c-Jun.-N-terminal kinase (JNK) were significantly increased by the UVA irradiation for 1h. An electron spin resonance (ESR) analysis revealed that UVA enhanced the free radical formation in S. japonicas, even through we could not identify the attributed species. These results suggest that UVA-induced autolysis in S. japonicas at least partially involves the oxidative stress-sensitive apoptosis induction pathway. These data present a novel insight into the mechanisms of sea cucumber autolysis induced by external stress. Copyright © 2016 Elsevier B.V. All rights reserved.
Effects of cooking methods and starch structures on starch hydrolysis rates of rice.
Reed, Michael O; Ai, Yongfeng; Leutcher, Josh L; Jane, Jay-lin
2013-07-01
This study aimed to understand effects of different cooking methods, including steamed, pilaf, and traditional stir-fried, on starch hydrolysis rates of rice. Rice grains of 3 varieties, japonica, indica, and waxy, were used for the study. Rice starch was isolated from the grain and characterized. Amylose contents of starches from japonica, indica, and waxy rice were 13.5%, 18.0%, and 0.9%, respectively. The onset gelatinization temperature of indica starch (71.6 °C) was higher than that of the japonica and waxy starch (56.0 and 56.8 °C, respectively). The difference was attributed to longer amylopectin branch chains of the indica starch. Starch hydrolysis rates and resistant starch (RS) contents of the rice varieties differed after they were cooked using different methods. Stir-fried rice displayed the least starch hydrolysis rate followed by pilaf rice and steamed rice for each rice variety. RS contents of freshly steamed japonica, indica, and waxy rice were 0.7%, 6.6%, and 1.3%, respectively; those of rice pilaf were 12.1%, 13.2%, and 3.4%, respectively; and the stir-fried rice displayed the largest RS contents of 15.8%, 16.6%, and 12.1%, respectively. Mechanisms of the large RS contents of the stir-fried rice were studied. With the least starch hydrolysis rate and the largest RS content, stir-fried rice would be a desirable way of preparing rice for food to reduce postprandial blood glucose and insulin responses and to improve colon health of humans. © 2013 Institute of Food Technologists®
International Nuclear Information System (INIS)
Osaki, S.; Sugihara, S.; Maeda, Y.; Osaki, T.
2007-01-01
Fall water, stem flow water and falling litter in a coniferous forest (C. japonica) and a broad-leaved forest (L. edulis), and rainwater on a grassland near the forests were collected, and their 7 Be and 210 Pb contents were measured. The average residence times of 7 Be and 210 Pb in the forest crowns were calculated from the balances of their radionuclides, those in the forest crown of C. japonica were 88 days for 7 Be and 9.2 years for 210 Pb, and those in the forest crown of L. edulis were 52 days and <1 year, respectively. (author)
International Nuclear Information System (INIS)
Osaki, S.; Sugihara, S.; Maeda, Y.; Osaki, T.
2007-01-01
The dry deposition rates on various grass fields and two forests have been measured by the use of 212 Pb (T 1/2 = 10.6 hours). The deposition rate on grass fields (average: 7 mm x s -1 ) roughly depends on the logarithms of the heights or densities of the grasses. The dry deposition rates on a broadleaved forest (Lithocarpus edulis) and a coniferous forest (Cryptomeria Japonica) were also measured. The highest (ave. 26 mm x s -1 ) was on the forest of C. Japonica because of the dense and adhesive surfaces of the leaves. (author)
Directory of Open Access Journals (Sweden)
Marie Noelle Ndjiondjop
2018-04-01
Full Text Available Using interspecific crosses involving Oryza glaberrima Steud. as donor and O. sativa L. as recurrent parents, rice breeders at the Africa Rice Center developed several ‘New Rice for Africa (NERICA’ improved varieties. A smaller number of interspecific and intraspecific varieties have also been released as ‘Advanced Rice for Africa (ARICA’. The objective of the present study was to investigate the genetic variation, relatedness, and population structure of 330 widely used rice genotypes in Africa using DArTseq-based single nucleotide polymorphisms (SNPs. A sample of 11 ARICAs, 85 NERICAs, 62 O. sativa spp. japonica, and 172 O. sativa spp. indica genotypes were genotyped with 27,560 SNPs using diversity array technology (DArT-based sequencing (DArTseq platform. Nearly 66% of the SNPs were polymorphic, of which 15,020 SNPs were mapped to the 12 rice chromosomes. Genetic distance between pairs of genotypes that belong to indica, japonica, ARICA, and NERICA varied from 0.016 to 0.623, from 0.020 to 0.692, from 0.075 to 0.763, and from 0.014 to 0.644, respectively. The proportion of pairs of genotypes with genetic distance > 0.400 was the largest within NERICAs (35.1% of the pairs followed by ARICAs (18.2%, japonica (17.4%, and indica (5.6%. We found one pair of japonica, 11 pairs of indica, and 35 pairs of NERICA genotypes differing by <2% of the total scored alleles, which was due to 26 pairs of genotypes with identical pedigrees. Cluster analysis, principal component analysis, and the model-based population structure analysis all revealed two distinct groups corresponding to the lowland (primarily indica and lowland NERICAs and upland (japonica and upland NERICAs growing ecologies. Most of the interspecific lowland NERICAs formed a sub-group, likely caused by differences in the O. glaberrima genome as compared with the indica genotypes. Analysis of molecular variance revealed very great genetic differentiation (FST = 0.688 between the
Ndjiondjop, Marie Noelle; Semagn, Kassa; Sow, Mounirou; Manneh, Baboucarr; Gouda, Arnaud C; Kpeki, Sèdjro B; Pegalepo, Esther; Wambugu, Peterson; Sié, Moussa; Warburton, Marilyn L
2018-01-01
Using interspecific crosses involving Oryza glaberrima Steud. as donor and O. sativa L. as recurrent parents, rice breeders at the Africa Rice Center developed several 'New Rice for Africa (NERICA)' improved varieties. A smaller number of interspecific and intraspecific varieties have also been released as 'Advanced Rice for Africa (ARICA)'. The objective of the present study was to investigate the genetic variation, relatedness, and population structure of 330 widely used rice genotypes in Africa using DArTseq-based single nucleotide polymorphisms (SNPs). A sample of 11 ARICAs, 85 NERICAs, 62 O. sativa spp. japonica , and 172 O. sativa spp. indica genotypes were genotyped with 27,560 SNPs using diversity array technology (DArT)-based sequencing (DArTseq) platform. Nearly 66% of the SNPs were polymorphic, of which 15,020 SNPs were mapped to the 12 rice chromosomes. Genetic distance between pairs of genotypes that belong to indica, japonica, ARICA, and NERICA varied from 0.016 to 0.623, from 0.020 to 0.692, from 0.075 to 0.763, and from 0.014 to 0.644, respectively. The proportion of pairs of genotypes with genetic distance > 0.400 was the largest within NERICAs (35.1% of the pairs) followed by ARICAs (18.2%), japonica (17.4%), and indica (5.6%). We found one pair of japonica, 11 pairs of indica, and 35 pairs of NERICA genotypes differing by <2% of the total scored alleles, which was due to 26 pairs of genotypes with identical pedigrees. Cluster analysis, principal component analysis, and the model-based population structure analysis all revealed two distinct groups corresponding to the lowland (primarily indica and lowland NERICAs) and upland (japonica and upland NERICAs) growing ecologies. Most of the interspecific lowland NERICAs formed a sub-group, likely caused by differences in the O. glaberrima genome as compared with the indica genotypes. Analysis of molecular variance revealed very great genetic differentiation ( F ST = 0.688) between the lowland and upland
Miller, C.; Love, B. A.; Yang, S.
2016-02-01
Atmospheric CO2 emissions are being absorbed at an unprecedented rate by the global and coastal oceans, shifting the baseline pCO2, and inducing anthropogenic ocean acidification (OA). Recent studies have highlighted the potential benefits of near-shore vegetated habitats, such as seagrass beds as carbon sinks, potentially mitigating the effects of OA for vulnerable calcifying organisms. Seagrasses are capable of raising seawater pH and CaCO3 saturation state during times of high photosynthetic activity; however, the converse occurs during periods of dark respiration, resulting in a cyclical pattern of high and low pH and saturation state. A better understanding of diurnal seagrass induced carbonate system variability is needed to determine whether seagrass beds act as refugia from OA, and if individual species differentially affect the carbonate system. We conducted experiments to compare the effects of the native Zostera marina and non-native Zostera japonica on the carbonate system. Leaf clippings were incubated at five different light intensities (including dark) and pCO2 levels, representing the range of light and pCO2 in a given day. Induced changes in dissolved inorganic carbon (DIC) via photosynthesis and respiration were measured as well as pH and alkalinity. As irradiance and concentration of bio-available inorganic carbon are the two main drivers of photosynthetic activity, our measurements of the short-term response of photosynthesis to a spectrum of pCO2 and irradiance intensity can predict the diurnal fluctuation of pH and DIC for both species. This lab study provides a mechanistic background for building complex models based on field monitoring of carbonate chemistry in seagrass communities by comparing and integrating our results with in situ measurements. Interpretation of our findings will be placed in the context of short-term seagrass response to the spatiotemporal variability of pCO2 with respect to the progression of ocean acidification.
Directory of Open Access Journals (Sweden)
Caroline Borges Bevilacqua
Full Text Available Rice (Oryza sativa L. cultivars show impairment of growth in response to environmental stresses such as cold at the early seedling stage. Locally adapted weedy rice is able to survive under adverse environmental conditions, and can emerge in fields from greater soil depth. Cold-tolerant weedy rice can be a good genetic source for developing cold-tolerant, weed-competitive rice cultivars. An in-depth analysis is presented here of diverse indica and japonica rice genotypes, mostly weedy rice, for cold stress response to provide an understanding of different stress adaptive mechanisms towards improvement of the rice crop performance in the field. We have tested a collection of weedy rice genotypes to: 1 classify the subspecies (ssp. grouping (japonica or indica of 21 accessions; 2 evaluate their sensitivity to cold stress; and 3 analyze the expression of stress-responsive genes under cold stress and a combination of cold and depth stress. Seeds were germinated at 25°C at 1.5- and 10-cm sowing depth for 10d. Seedlings were then exposed to cold stress at 10°C for 6, 24 and 96h, and the expression of cold-, anoxia-, and submergence-inducible genes was analyzed. Control plants were seeded at 1.5cm depth and kept at 25°C. The analysis revealed that cold stress signaling in indica genotypes is more complex than that of japonica as it operates via both the CBF-dependent and CBF-independent pathways, implicated through induction of transcription factors including OsNAC2, OsMYB46 and OsF-BOX28. When plants were exposed to cold + sowing depth stress, a complex signaling network was induced that involved cross talk between stresses mediated by CBF-dependent and CBF-independent pathways to circumvent the detrimental effects of stresses. The experiments revealed the importance of the CBF regulon for tolerance to both stresses in japonica and indica ssp. The mechanisms for cold tolerance differed among weedy indica genotypes and also between weedy indica and
Yu, Guoqin; Olsen, Kenneth M; Schaal, Barbara A
2011-01-01
The evolution of metabolic pathways is a fundamental but poorly understood aspect of evolutionary change. One approach for understanding the complexity of pathway evolution is to examine the molecular evolution of genes that together comprise an integrated metabolic pathway. The rice endosperm starch biosynthetic pathway is one of the most thoroughly characterized metabolic pathways in plants, and starch is a trait that has evolved in response to strong selection during rice domestication. In this study, we have examined six key genes (AGPL2, AGPS2b, SSIIa, SBEIIb, GBSSI, ISA1) in the rice endosperm starch biosynthesis pathway to investigate the evolution of these genes before and after rice domestication. Genome-wide sequence tagged sites data were used as a neutral reference to overcome the problems of detecting selection in species with complex demographic histories such as rice. Five variety groups of Oryza sativa (aus, indica, tropical japonica, temperate japonica, aromatic) and its wild ancestor (O. rufipogon) were sampled. Our results showed evidence of purifying selection at AGPL2 in O. rufipogon and strong evidence of positive selection at GBSSI in temperate japonica and tropical japonica varieties and at GBSSI and SBEIIb in aromatic varieties. All the other genes showed a pattern consistent with neutral evolution in both cultivated rice and its wild ancestor. These results indicate the important role of positive selection in the evolution of starch genes during rice domestication. We discuss the role of SBEIIb and GBSSI in the evolution of starch quality during rice domestication and the power and limitation of detecting selection using genome-wide data as a neutral reference.
QTL Analysis of Anoxic Tolerance at Seedling Stage in Rice
Directory of Open Access Journals (Sweden)
Yang WANG
2010-09-01
Full Text Available Coleoptile lengths of 7-day-old seedlings under anoxic stress and normal conditions were investigated in two permanently segregated populations and their parents in rice (Oryza sativa L.. Using anoxic response index, a ratio of coleoptile length under anoxic stress to coleoptile length under normal conditions, as an indicator of seedling anoxic tolerance (SAT, QTLs for SAT were detected. Two loci controlling SAT, designated as qSAT-2-R and qSAT-7-R, were detected in a recombinant inbred line (RIL population (247 lines derived from a cross between Xiushui 79 (japonica variety and C Bao (japonica restorer line. qSAT-2-R, explaining 8.7% of the phenotype variation, was tightly linked with the SSR marker RM525. qSAT-7-R, explaining 9.8% of the phenotype variation, was tightly linked with the marker RM418. The positive alleles of the two loci came from C Bao. Six loci controlling SAT, designated as qSAT-2-B, qSAT-3-B, qSAT-5-B, qSAT-8-B, qSAT-9-B and qSAT-12-B, were detected in a backcross inbred line (BIL population (98 lines derived from a backcross of Nipponbare (japonica/Kasalath (indica//Nipponbare (japonica. The positive alleles of qSAT-2-B, qSAT-3-B and qSAT-9-B, which explained 16.2%, 11.4% and 9.5% of the phenotype variation, respectively, came from Nipponbare. Besides, the positive alleles of qSAT-5-B, qSAT-8-B and qSAT-12-B, which explained 7.3%, 5.8% and 14.0% of the phenotype variation, respectively, were from Kasalath.
Wang, Yong-Jian; Shi, Xue-Ping; Meng, Xue-Feng; Wu, Xiao-Jing; Luo, Fang-Li; Yu, Fei-Hai
2016-01-01
Spatial heterogeneity in two co-variable resources such as light and water availability is common and can affect the growth of clonal plants. Several studies have tested effects of spatial heterogeneity in the supply of a single resource on competitive interactions of plants, but none has examined those of heterogeneous distribution of two co-variable resources. In a greenhouse experiment, we grew one (without intraspecific competition) or nine isolated ramets (with competition) of a rhizomatous herb Iris japonica under a homogeneous environment and four heterogeneous environments differing in patch arrangement (reciprocal and parallel patchiness of light and soil water) and patch scale (large and small patches of light and water). Intraspecific competition significantly decreased the growth of I. japonica, but at the whole container level there were no significant interaction effects of competition by spatial heterogeneity or significant effect of heterogeneity on competitive intensity. Irrespective of competition, the growth of I. japonica in the high and the low water patches did not differ significantly in the homogeneous treatments, but it was significantly larger in the high than in the low water patches in the heterogeneous treatments with large patches. For the heterogeneous treatments with small patches, the growth of I. japonica was significantly larger in the high than in the low water patches in the presence of competition, but such an effect was not significant in the absence of competition. Furthermore, patch arrangement and patch scale significantly affected competitive intensity at the patch level. Therefore, spatial heterogeneity in light and water supply can alter intraspecific competition at the patch level and such effects depend on patch arrangement and patch scale.
Evolution of Microsatellite Loci of Tropical and Temperate Anguilla Eels
Directory of Open Access Journals (Sweden)
Mei-Chen Tseng
2012-04-01
Full Text Available Anguilla eels are divided into temperate and tropical eels, based on their major distributions. The present study collected two temperate eels, Anguilla japonica and Anguilla anguilla, and two tropical eels, Anguilla marmorata and Anguilla bicolor pacifica, to examine two questions: do temperate and tropical Anguilla eels have different genetic polymorphic patterns?; and do temperate Anguilla japonica and Anguilla anguilla have a closer relationship to each other than to tropical eels? In total, 274 sequences were cloned and sequenced from six conserved microsatellite loci to examine polymorphic patterns of these four catadromous eels. Different mutational events, including substitutions, and repeat-unit deletions and insertions, appeared in major regions, while different point mutations were observed in flanking regions. The results implied that parallel patterns of microsatellite sequences occurred within both tropical and temperate freshwater eels. Consensus flanking sequences of six homologous loci from each of the four species were constructed. Genetic distances ranged from 0.044 (Anguilla bicolor pacifica vs. Anguilla marmorata to 0.061 (Anguilla marmorata vs. Anguilla anguilla. The tree topology suggests the hypothesis of Anguilla japonica and Anguilla anguilla being a sister group must be rejected.
Molecular phylogeny of some avian species using Cytochrome b gene sequence analysis
Awad, A; Khalil, S. R; Abd-Elhakim, Y. M
2015-01-01
Veritable identification and differentiation of avian species is a vital step in conservative, taxonomic, forensic, legal and other ornithological interventions. Therefore, this study involved the application of molecular approach to identify some avian species i.e. Chicken (Gallus gallus), Muskovy duck (Cairina moschata), Japanese quail (Coturnix japonica), Laughing dove (Streptopelia senegalensis), and Rock pigeon (Columba livia). Genomic DNA was extracted from blood samples and partial sequence of the mitochondrial cytochrome b gene (358 bp) was amplified and sequenced using universal primers. Sequences alignment and phylogenetic analyses were performed by CLC main workbench program. The obtained five sequences were deposited in GenBank and compared with those previously registered in GenBank. The similarity percentage was 88.60% between Gallus gallus and Coturnix japonica and 80.46% between Gallus gallus and Columba livia. The percentage of identity between the studied species and GenBank species ranged from 77.20% (Columba oenas and Anas platyrhynchos) to 100% (Gallus gallus and Gallus sonneratii, Coturnix coturnix and Coturnix japonica, Meleagris gallopavo and Columba livia). Amplification of the partial sequence of mitochondrial cytochrome b gene proved to be practical for identification of an avian species unambiguously. PMID:27175180
International Nuclear Information System (INIS)
Wang Xi; Tao Longxing; Tian Shulan; Huang Xiaolin; Yu Meiyu
2000-01-01
Some hybrid rice combinations and their restorers, II you2070 (indica/Indica) and its restorer2070, Shuangyou23 (Japonica/Japonica) with its restorer 91-23, sub-species hybrid rice Xieyou 413 (Indica/Japonica) with its restorer Zhong 413, were selected as rice material and planted in pot and field to study the differences of absorption ability for labelled carbohydrate between vigorous and weak spikelets, and to demonstrate the phenomenon of 'inter-grain apical dominance' in rice. It was shown that the absorbing rate of hybrid rice and it restorer for store material and for photo-material was 50% and 80% respectively, and the absorbing rate of hybrid rice was a litter higher than that of its restorer. However, there was a big difference between vigorous spikelets and weak spikelets in the absorbing ability for carbohydrate. The absorbing amount of vigorous spikelets was 10 times higher than that of the weak spikelets, especially in hybrid rice combinations. It was also observed that the 'inter-grain apical dominance' in hybrid rice was stronger than its restorer, which might be one of the main reasons for low seed setting in hybrid rice combination
Zoonotic onchocerciasis caused by a parasite from wild boar in Oita, Japan
Directory of Open Access Journals (Sweden)
Takaoka H.
2004-09-01
Full Text Available Histological examination of a nodule removed from the back of the hand of a 58-year-old woman from Oita, Kyushu, Japan showed an Onchocerca female sectioned through the posterior region of the worm (ovaries identifiable and young (thin cuticle. Six Onchocerca species are enzootic in that area: O. gutturosa and O. lienalis in cattle, O. suzukii in serows (Capricornis crispus, O. skrjabini and an Onchocerca sp. in Cervus nippon nippon, and O. dewittei japonica in wild boar (Sus scrofa leucomystax. Diagnostic charactets of female Onchocerca species, such as the cuticle and its ridges, change along the body length. Tables of the histologic morphology of the mid- and posterior body-regions of the local species are presented. In addition, it was observed that transverse ridges arose and thickened during the adult stage (examination of fourth stage and juvenile females of O. volvulus. The specimen described in this report, with its prominent and widely spaced ridges, was identified as O. d. japonica. Four of the 10 zoonotic cases of onchocerciasis reported worldwide were from Oita, three of them being caused by O. d. japonica, the prevalence of which in local wild boar was 22 of 24 (92 %.
Protein (Viridiplantae): 399301 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available :239 ... 147380:239 ... 4527:239 ... 4530:309 ... 39947:309 Os04g0497700 Oryza sativa Japonica Group MEGDDKSAVVGGAYWGLAARACDACGGEAARLFCRADA...AFLCAGCDARAHGPGSRHARVWLCEVCEHAPAAVTCRADAAALCAACDADIHSANPLARRH
Skin tests of pollen grains of taxodiaceae and cupressaceae in children with bronchial asthma.
Midoro-Horiuti, T; Nouno, S; Seino, Y
1992-10-01
Atmospheric cedar pollen in the southern region of Okayama Prefecture (situated in south-western Japan) has been counted since 1988. Pollen of different species of the Taxodiaceae family (Cryptomeria japonica, Sequoia sempervirens and Metasequoia glyptostroboides) and Japanese juniper (Juniperus rigida) in the Cupressaceae family, which are propagated mainly in the southern region of Okayama Prefecture, were found among the atmospheric pollen. Scratch tests using the pollen extract from Taxodiaceae and Cupressaceae were performed on children with bronchial asthma. Forty (25%) and 30 (18.8%) of the 160 patients reacted positively to an allergen extract from the pollen grains of Japanese cedar (Cryptomeria japonica) and Japanese juniper, respectively.
Dicty_cDB: Contig-U14908-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available id:none) Oryza sativa (japonica cultivar... 86 2e-15 FJ787361_1( FJ787361 |pid:none) Nicotiana repanda prote...|pid:none) Oryza sativa (japonica cultivar-gr... 84 8e-15 FJ787374_1( FJ787374 |pid:none) Nicotiana repanda ...15 FJ787369_1( FJ787369 |pid:none) Nicotiana repanda protein kinase-c... 84 8e-15 EU722820_1( EU722820 |pid:... 1e-14 AB016885_14( AB016885 |pid:none) Arabidopsis thaliana genomic DNA,... 83 1e-14 FJ787371_1( FJ787371 |pid:none) Nicotiana repan...da protein kinase-c... 83 1e-14 A84518( A84518 ) probable receptor-like protein kin
Decay spectroscopy with EURICA in the region of {sup 100}Sn
Energy Technology Data Exchange (ETDEWEB)
Faestermann, Thomas; Gernhaeuser, Roman; Lubos, Daniel; Steiger, Konrad [Technische Universitaet Muenchen (Germany); Collaboration: EURICA RIBF09-Collaboration
2015-07-01
The most recent experiment on properties of nuclei in the region of {sup 100}Sn has been performed at the radioisotope beam factory (RIBF) at the RIKEN Nishina Center. For the decay spectroscopy, we used the detector arrays EURICA and WASABI which consist of Ge- and LaBr- as well as Si-detectors, respectively. The experiment has revealed new nuclei along the N=Z-2 line and an increase of statistics by a factor of ∝10 for N=Z-1 nuclei and {sup 100}Sn compared to previous experiments. The presentation gives an overview on the dedicated high efficiency setup and the experimental program. A status of the on-going analysis with regard to {sup 100}Sn and selected results for several nuclei and isomers in this region will be discussed.
Roh, Jong Sung; Lee, Hyunghee; Woo, Sangee; Yoon, Miso; Kim, Jeongjun; Park, Sun Dong; Shin, Soon Shik; Yoon, Michung
2015-08-02
Adipocyte lipid accumulation due to impaired fatty acid oxidation causes adipocyte hypertrophy and adipose tissue increment, leading to obesity. The aim of this study was to determine the antiobesity effects of the herbal composition Gambigyeongsinhwan (4) (GGH(4)) composed of Curcuma longa L. (Zingiberaceae), Alnus japonica (Thunb.) Steud. (Betulaceae), and the fermented traditional Korean medicine Massa Medicata Fermentata. The effects of GGH(4) and the individual components on lipid accumulation in 3T3-L1 adipocytes and body weight gain in Otsuka Long-Evans Tokushima Fatty (OLETF) rats were examined using Oil red O staining, hematoxylin and eosin staining, quantitative real-time PCR, and peroxisome proliferator-activated receptor α (PPARα) transactivation assay. GGH(4), individual components, and an active principle of Curcuma longa curcumin inhibited lipid accumulation and mRNA levels of adipocyte-specific genes (PPARγ, aP2, and C/EBPα) in 3T3-L1 adipocytes compared with control cells. Treatment with GGH(4), the individual components or curcmumin increased mRNA levels of mitochondrial (CPT-1, MCAD, and VLCAD) and peroxisomal (ACOX and thiolase) PPARα target genes. GGH(4) and the individual components also increased PPARα reporter gene expression compared with control cells. These effects were most prominent in GGH(4)-treated cells. However, the PPARα antagonist GW6471 reversed the inhibitory effects of GGH(4) on adipogenesis. An in vivo study showed that GGH(4) decreased body weight gain, adipose tissue mass, and visceral adipocyte size with increasing mRNA levels of adipose tissue PPARα target genes in OLETF rats. These results demonstrate that GGH(4) has an antiobesity effects through the inhibition of adipocyte lipid accumulation, and this process may be mediated in part through adipose PPARα activation. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
FON2 SPARE1 redundantly regulates floral meristem maintenance with FLORAL ORGAN NUMBER2 in rice.
Directory of Open Access Journals (Sweden)
Takuya Suzaki
2009-10-01
Full Text Available CLAVATA signaling restricts stem cell identity in the shoot apical meristem (SAM in Arabidopsis thaliana. In rice (Oryza sativa, FLORAL ORGAN NUMBER2 (FON2, closely related to CLV3, is involved as a signaling molecule in a similar pathway to negatively regulate stem cell proliferation in the floral meristem (FM. Here we show that the FON2 SPARE1 (FOS1 gene encoding a CLE protein functions along with FON2 in maintenance of the FM. In addition, FOS1 appears to be involved in maintenance of the SAM in the vegetative phase, because constitutive expression of FOS1 caused termination of the vegetative SAM. Genetic analysis revealed that FOS1 does not need FON1, the putative receptor of FON2, for its action, suggesting that FOS1 and FON2 may function in meristem maintenance as signaling molecules in independent pathways. Initially, we identified FOS1 as a suppressor that originates from O. sativa indica and suppresses the fon2 mutation in O. sativa japonica. FOS1 function in japonica appears to be compromised by a functional nucleotide polymorphism (FNP at the putative processing site of the signal peptide. Sequence comparison of FOS1 in about 150 domesticated rice and wild rice species indicates that this FNP is present only in japonica, suggesting that redundant regulation by FOS1 and FON2 is commonplace in species in the Oryza genus. Distribution of the FNP also suggests that this mutation may have occurred during the divergence of japonica from its wild ancestor. Stem cell maintenance may be regulated by at least three negative pathways in rice, and each pathway may contribute differently to this regulation depending on the type of the meristem. This situation contrasts with that in Arabidopsis, where CLV signaling is the major single pathway in all meristems.
Responses of sri lankan traditional rice to photoperiod at early vegetative stage
International Nuclear Information System (INIS)
Rathnathunga, U.U.E.; Geekiyanage, S.
2017-01-01
Rice is a photoperiod sensitive plant for flowering initiation. Effect of photoperiod can be important in vegetative growth and yield determination in rice. The objective of the research was to determine the effect of photoperiod on the vegetative responses of Sri Lankan traditional rice germplasm (SLTRG). Forty five traditional rice accessions (TRA), 5 improved rice varieties (IR), Sri Lankan wild rice (Oryza nivara and Oryza rufipogan) and Oryza japonica accessions 6782 and 6752 were grown in short day (SD), day neutral (DN) and long day (LD) conditions. Days to reach the fifth leaf stage (DFL), plant height (PH) and tiller number (TN) at the fifth leaf stage were recorded. Twenty three genotypes including 21 TRA, Oryza japonica 6752 and Oryza nivara did not respond to photoperiod having non-significant values for DFL, PH and TN among photoperiods. The DFL was affected in 25 genotypes; among them both DFL and PH were affected in 7 genotypes. DFL was significantly increased during LD in 4 TRA while DFL was significantly reduced in all 5 IR and 5 TRA. DFL was significantly increased in Oryza japonica 6782 and 5 TRA under SD. In 4 TRA, DFL was reduced under SD. The TN was affected in Oryza japonica 6782 only under SD with increased DFL. The DFL was significantly increased under DN in Oryza rufipogan, 5 TRA and 2 IR. Both SD and LD photoperiods differently affected the interaction between DFL and PH in TRA while only LD affected that of IR. DN had an effect on the interaction between DFL and PH only in wild rice Oryza rufipogon. Variation of vegetative growth response to photoperiod may depict the wide genetic basis of SLTRG. (author)
Directory of Open Access Journals (Sweden)
Yinghua Pan
Full Text Available Low temperature affects the rice plants at all stages of growth. It can cause severe seedling injury and male sterility resulting in severe yield losses. Using a mini core collection of 174 Chinese rice accessions and 273 SSR markers we investigated cold tolerance at the germination and booting stages, as well as the underlying genetic bases, by association mapping. Two distinct populations, corresponding to subspecies indica and japonica showed evident differences in cold tolerance and its genetic basis. Both subspecies were sensitive to cold stress at both growth stages. However, japonica was more tolerant than indica at all stages as measured by seedling survival and seed setting. There was a low correlation in cold tolerance between the germination and booting stages. Fifty one quantitative trait loci (QTLs for cold tolerance were dispersed across all 12 chromosomes; 22 detected at the germination stage and 33 at the booting stage. Eight QTLs were identified by at least two of four measures. About 46% of the QTLs represented new loci. The only QTL shared between indica and japonica for the same measure was qLTSSvR6-2 for SSvR. This implied a complicated mechanism of old tolerance between the two subspecies. According to the relative genotypic effect (RGE of each genotype for each QTL, we detected 18 positive genotypes and 21 negative genotypes in indica, and 19 positive genotypes and 24 negative genotypes in japonica. In general, the negative effects were much stronger than the positive effects in both subspecies. Markers for QTL with positive effects in one subspecies were shown to be effective for selection of cold tolerance in that subspecies, but not in the other subspecies. QTL with strong negative effects on cold tolerance should be avoided during MAS breeding so as to not cancel the effect of favorable QTL at other loci.
Understanding of amount and dynamics of radioactive cesium deposited on trees in Fukushima
Energy Technology Data Exchange (ETDEWEB)
Endo, Izuki; Ohte, Nobuhito; Iseda, Kohei; Tanoi, Keitaro; Hirose, Atsushi; Kobayashi, Natsuko I. [The University of Tokyo, 113-8657, 1-1-1 Yayoi Bunkyo-ku, Tokyo (Japan); Ishii, Nobuyoshi [National Institute of Radiological Sciences, 263-8555, 4-9-1 Anagawa, Inage-ku, Chiba-shi, Chiba (Japan); Ohashi, Mizue [University of Hyogo, 670-0092, 1-1-12 Shinzaike-Honcho, Himeji, Hyogo (Japan)
2014-07-01
The accident of Fukushima Daiichi nuclear power plant after the earthquake and Tsunami in March 11, 2011 caused large amount of radioactive cesium ({sup 134}Cs, {sup 137}Cs) deposition onto the forest in the surrounding areas. River water from the forest area is used for food production and also for drinking water in these regions. In order to predict how radioactive Cs diffuse and discharge from the forest catchments, it is important to understand the amount and dynamics of radioactive Cs deposited on the trees. In this report, we show our preliminary results of {sup 137}Cs deposition in forest. Study was conducted in the forest at the upstream of Kami-Oguni River catchment, northern part of Fukushima Prefecture. Three plots (2 deciduous stands and 1 Japanese cedar (Cryptomeria japonica) plantation) were set in the forest. Quercus serrata and C. japonica, a representative of deciduous and evergreen tree species in this region, were chosen from each plot. Sample trees were logged in October 2012. Stem samples were collected every 2 m from above the ground to tree top and separated into bark, sapwood and heartwood. Litter traps were set in each plot and collected every month. Leaf litter was classified among species. Also, soil samples were collected in the cylinder of 5 cm in diameter and maximum 30 cm in depth from the forest floor every month. {sup 137}Cs concentration of all samples were measured by germanium semiconductor detector or NaI(Tl) scintillation counter. Deposited {sup 137}Cs was attached strongly on the bark of Q. serrata at high concentration (9-18 kBq/kg) but there were no clear relationship with tree height. In C. japonica, {sup 137}Cs concentration was about half times lower than that of Q. serrata at 0-10 m part of the tree. {sup 137}Cs concentration in wood of C. japonica was higher than Q. serrata. {sup 137}Cs concentration of sapwood was as high as that of heartwood in C. japonica, but in Q. serrata, {sup 137}Cs concentration in sapwood was
Lifescience Database Archive (English)
Full Text Available ... Same as: E00207 Therapeutic category: 5100 ... Caprifoliaceae (honeysuckle family) Lonicera japonica flower bud; Standards for non-pharmacopoeial crude drugs ... PubChem: 96025820 ...
Rita S. Valente; Pol Nadal-Jimenez; André F. P. Carvalho; Filipe J. D. Vieira; Karina B. Xavier; Bonnie Bassler
2017-01-01
This deposit is composed by the main article plus the supplementary materials of the publication. Bacterial communities can sense their neighbors, regulating group behaviors in response to cell density and environmental changes. The diversity of signaling networks in a single species has been postulated to allow custom responses to different stimuli; however, little is known about how multiple signals are integrated and the implications of this integration in different ecological contexts....
Lifescience Database Archive (English)
Full Text Available E00287 Inula flower Crude drug ... Inula japonica [TAX:453958], Inula linariaefolia, Inula britannica [TAX...:119176], Inula [TAX:41589] ... Asteraceae (daisy family) Inula flower ...
Efficiency of producing anion and relative humidity of the indigenous woody plants in Jeju islands
Son, S.-G.; Kim, K.-J.; Kim, H.-J.; Kim, C.-M.; Byun, K.-O.
2009-04-01
This study is to evaluate the ability of interior plants to produce anion and relative humidity that can purify polluted indoor air. Four indigenous woody plants in Jeju islands such as Sarcandra glaber (Thunb.) Nakai, Illicium anisatum L, Cleyera japonica Thunb. and Ilex rotunda Thunb. were used. Sansevieria trifasciata cv. Laurentii was also used as a comparative plant. The amount of anion and increment of relative humidity produced by five species of indoor plants was assessed by anion measurement (ITC-201A)in a sealed acryl chamber (118Ã-118Ã-119.5cm). The highest amount of anion was 515 ea/cm3produced by I. rotunda. The amounts of anion were 293 ea/cm3, 273 ea/cm3, and 211 ea/cm3 in S. glaber, I. anisatum and C. japonica, respecively while it was 220 ea/cm3 in S. trifasciata. The increment of relative humidity was highest in I. anisatum as 27.4% while it was lowest in S. trifasciata as 14.0%. This result suggested that all four indigenous plants tested were more effective to purify the indoor polluted air than S. trifasciata. Key words: interior plant, S. glaber, I. anisatum, C. japonica, I. rotunda, indoor polluted air
Rice Varieties in Archaic East Asia: Reduction of Its Diversity from Past to Present Times.
Kumagai, Masahiko; Kanehara, Masaaki; Shoda, Shin'ya; Fujita, Saburo; Onuki, Shizuo; Ueda, Shintaroh; Wang, Li
2016-10-01
The Asian cultivated rice, Oryza sativa, is one of the most important crops feeding more than a third of global population. In spite of the studies for several decades, the origin and domestication history of rice varietal groups, japonica and indica, have not been fully unveiled. Genetic information of ancient rice remains is essential for direct and exclusive insight into the domestication history of rice. We performed ancient DNA analysis of 950- to 2,800-year-old rice remains excavated from Japan and Korea. We found the presence of both japonica- and indica-type varieties in the Yayoi period and the middle ages of Japan and the middle part of Korea Peninsula 2,000 years ago. It is popularly considered that japonica has been exclusively cultivated in northern part of East Asia including Japan and Korea. Our result disclosed unexpectedly wide diversity of rice varieties in archaic East Asia. The present results from ancient rice DNA reveal an exclusive insight for the domestication history of rice which is not provided as far as contemporary rice. © The Author 2016. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Lamiaa Elsayed Mokhtar Deef
2017-08-01
Full Text Available ABSTRACT Quail is an important and interesting group of galliform birds. The Common quail (Coturnix coturnix; the Japanese quail (Coturnix japonica; the Panda quail (Coturnix japonica; the Dotted white quail (Coturnix japonica and the Bobwhite quail (Colinus virginianus were used in this study. PCR-RFLP and SDS-proteins were performed to reveal the genetic characterization and genetic relationship of the studied quails. Analysis of fragments generated by digestion of PCR product with restriction enzyme NlaIII recorded highly polymorphic restriction profiles. There is a wide intraspecific COI, SEMA3E and TLX genes variability among the studied quails. Protein bands varied from10 to 18 between quails with minimum number of bands were in the Dotted white quail (10 bands and the maximum were in the Japanese quail (18 bands as measured by SDS-polyacrylamide gel electrophoresis. The Dotted white quail revealed the lowest similarity to the Bobwhite with a coefficient of 0.18 while The similarity coefficients between the Common quail and each one of the other quails were 0.67, 0.62, 0.45 and 0.42 for the Japanese, Panda, Dotted white and the Bobwhite quails, respectively. The results indicate that, PCR-RFLP and protein analyses are good techniques to evaluate genetic characterization and genetic relationship of these quails.
[Effect comparison between two ELISA kits in IgG antibody detection of Echinococcus granulosus].
Chu, Yan-Hong; Cai, Yu-Chun; Ai, Lin; Lu, Yan; Zhang, Jia; Chen, Jia-Xu
2013-06-01
To compare the effects of two ELISA kits on IgG antibody detection of human Echinococcus granulosus. A Total of 134 sera of patients with echinococcosis, paragonimiasis westermani, clonorchiasis sinensis, schistosomiasis japonica, and cysticercosis cellulosae, and normal persons were detected by two IgG ELISA kits produced by different companies. Furthermore, the specificity, sensitivity and cross reactivity were counted and analyzed statistically. The sensitivity and specificity were extremely high of the two kits as 100.00%. The cross-reactivity rates were 25.00% (paragonimiasis westermani), 26.09% (clonorchiasis sinensis), 10.00% (schistosomiasis japonica), and 87.5% (cysticercosis), respectively, by using the kit produced by the Combined Company in Shenzhen; the cross-reactivity rates were 5.00% (paragonimiasis westermani), 13.04% (clonorchiasis sinensis), 20.00% (schistosomiasis japonica), and 93.75% (cysticercosis) respectively, by using the kit produced by Haitai Company in Zhuhai. In addition, there was a significant difference of Paragonimus westermani detection (P 0.05) between the two kits. Both ELISA kits on IgG antibody detection of human Echinococcus granulosus have the advantages of a high sensitivity, specificity, convenience and high-speed. However, it is also in urgent need to further solve the cross-reactivity of Echinococcus granulosus with other parasites, in order to improve the accuracy of early diagnosis.
Oishi, Takuya; Uraguchi, Kohji; Abramov, Alexei V; Masuda, Ryuichi
2010-12-01
In order to clarify the morphological differences between two subspecies of the red fox (Vulpes vulpes) on the Japanese Islands and test the validity of Bergmann's rule, we examined geographical variations in 25 cranial and 24 dental characters in V. v. schrencki from Hokkaido and V. v. japonica from the other main islands of Japan (Honshu, Shikoku, and Kyushu). Many skull measurements, including the male greatest length, condylobasal length, and the length of upper and lower tooth rows, were significantly larger for V. v. japonica than for V. v. schrencki, whereas most tooth measurements, especially the length of molars and premolars, in V. v. schrencki were larger than those in V. v. japonica. Although the two subspecies were morphologically well-differentiated from each other, the results did not support that they have evolved following Bergmann's rule of adaptation to cold climates. Based on consideration of the relatively large differences of their tooth sizes, which are not easily influenced by food abundance, and previous genetic research on the different migration histories of the two subspecies, the morphological differences detected in the present study may have resulted not only from the present ecological differences between the two subspecies, but also from the difference of migration history and evolutionary constraints.
Research on the Strength Variation of Root-Clay Systems under Freeze-Thaw Action
Directory of Open Access Journals (Sweden)
Lin Yang
2017-01-01
Full Text Available The aim of this paper is to study the influence of an effective root system of rhizome plants on the reinforcement of slope soil under freeze-thaw conditions. This study focused on the mechanical properties between roots and clay in the root system of four plant species from different regions of China (northeast, northern, central, and southern areas: Setaria viridis, Eleusine indica, Zoysia japonica, and Carex leucochlora. Based on the interfacial friction effects between the plant roots and the soil, pull-out tests and unconfined compressive strength tests were conducted on the reinforced soil system for varying numbers of freeze-thaw cycles. Several stages of the pull-out process of the root system in clay are explicitly proposed based on the interfacial friction test results. The results showed that the friction effect between Zoysia japonica roots and the soil was the most significant and that these roots had the best reinforcement effect. In contrast, the friction and reinforcement effects between Setaria viridis roots and the soil were the worst, and the resulting unconfined compressive strength was the smallest. However, the freeze-thaw resistance ability of the Setaria viridis and soil system was stronger than that of the Zoysia japonica system.
Directory of Open Access Journals (Sweden)
Fukuda M.
2010-03-01
Full Text Available Wild female black flies attracted to a man or an idling automobile were collected at Oita, Japan where five cases of zoonotic onchocerciasis had occurred. Among the five Simulium species captured, 2% of Simulium bidentatum, the predominant species, were infected with filarial larvae. There were at least two types of infective larvae, types A and B, based on morphometric observation. Moreover, molecular analysis of the mitochondrial cytochrome c oxidase subunit 1 (CO1 gene revealed that types A and B were represented by a single unknown species of Onchocerca and two species, i.e., Onchocerca dewittei japonica from wild boar, the causative agent of zoonotic onchocerciasis in Japan, and an undescribed Onchocerca sp. from wild boar, respectively. Phylogenetic analysis based on the sequences of the mitochondrial 12S ribosomal RNA (12S rRNA gene also showed that type A is likely to be an unknown species of Onchocerca. Natural infection of black flies with infective larvae of O. dewittei japonica and O. sp. was demonstrated for the first time. The present study strongly suggests that S. bidentatum plays a role as a vector in the transmission of zoonotic onchocerciasis due to O. dewittei japonica in Japan.
Long, Yunming; Zhao, Lifeng; Niu, Baixiao; Su, Jing; Wu, Hao; Chen, Yuanling; Zhang, Qunyu; Guo, Jingxin; Zhuang, Chuxiong; Mei, Mantong; Xia, Jixing; Wang, Lan; Wu, Haibin; Liu, Yao-Guang
2008-12-02
Sterility is common in hybrids between divergent populations, such as the indica and japonica subspecies of Asian cultivated rice (Oryza sativa). Although multiple loci for plant hybrid sterility have been identified, it remains unknown how alleles of the loci interact at the molecular level. Here we show that a locus for indica-japonica hybrid male sterility, Sa, comprises two adjacent genes, SaM and SaF, encoding a small ubiquitin-like modifier E3 ligase-like protein and an F-box protein, respectively. Most indica cultivars contain a haplotype SaM(+)SaF(+), whereas all japonica cultivars have SaM(-)SaF(-) that diverged by nucleotide variations in wild rice. Male semi-sterility in this heterozygous complex locus is caused by abortion of pollen carrying SaM(-). This allele-specific gamete elimination results from a selective interaction of SaF(+) with SaM(-), a truncated protein, but not with SaM(+) because of the presence of an inhibitory domain, although SaM(+) is required for this male sterility. Lack of any one of the three alleles in recombinant plants does not produce male sterility. We propose a two-gene/three-component interaction model for this hybrid male sterility system. The findings have implications for overcoming male sterility in inter-subspecific hybrid rice breeding.
Impacts of aerosol lead to natural ecosystems
International Nuclear Information System (INIS)
Murozumi, Masayo; Nakamura, Seiji; Yoshida, Katsumi
1982-01-01
Impacts of aerosol lead have changed the concentration and isotopic ratios of the element circulating in remote ecosystems in the Hidaka and Tarumae mountains. Concentrations of lead in successive each 10 years ring veneer of Cercidiphyllum Japonica show that amount of the element residing on the bark and supwood layers has increased by a factor of 2 or more in comparison with that of the core part. The isotopic ratios of lead in the basement rocks and soils under the ecosystems converge to a certain narrow spot along the isochron Iine of the element, and distinguish their geochronogical characteristics from other leads of different sources. In these ecosystems, however, the lead isotopic ratios of materials exposed to the atmosphere are similar to those of foreign and anthropogenic aerosol lead but are evidently dissimilar to those of the rocks and soils. Furthermore, the lead isotopic ratios in yearly ring veneers of Ceridiphyllum Japonica and Ostrya Japonica show a certain differentiation towards the bark from the core, i.e., an approach to those of anthropogenic aerosol lead from those of the basement rocks and soils, as listed in Table 7. The lead burden per hectare in these remote ecosystems has increased to 4 g by the impact of 2 g of aerosol lead. (author)
Directory of Open Access Journals (Sweden)
L.L. Lanna
2013-08-01
Full Text Available As dimensões e o peso testicular foram avaliados em 25 machos adultos de codornas japonesas (Coturnix coturnix japonica e correlacionados entre si, a fim de se buscar obter informações que possibilitem a criação de um parâmetro preditivo da capacidade de produção espermática. As aves foram abatidas e os testículos removidos para mensuração e pesagem. As dimensões e o peso entre os testículos esquerdo e direito foram comparados. Os parâmetros testiculares foram correlacionados entre si por meio da determinação do coeficiente de correlação linear. O índice gonadossomático também foi determinado, indicando alocação de 3,68% do peso corporal em testículos nos machos avaliados, resultado maior do que os descritos na literatura. Apesar da diferença de formato entre os testículos esquerdo e direito, o peso foi semelhante, sugerindo que não há diferença na capacidade de produção espermática entre eles. Diferença estatística entre os valores biométricos indica que o testículo esquerdo é mais curto e mais arredondado, enquanto o direito é mais longo e estreito. O peso corporal apresentou baixa correlação com o peso testicular, 0,14 e 0,12 para os testículos esquerdo e direito, respectivamente. Os parâmetros que melhor se correlacionaram com o peso testicular foram a largura e a espessura. Considerando-se a identificação de um parâmetro único para comparação entre machos, a espessura do testículo esquerdo apresentou coeficiente de correlação linear de 0,89 com o somatório do peso dos dois testículos. Com base nessa informação, métodos não invasivos, como a ultrassonografia, poderiam ser utilizados para estimar o potencial reprodutivo e auxiliar na comparação de machos de codornas japonesas em núcleos de seleção de aves elite, contribuindo para melhoramento genético da espécie.
78 FR 34347 - Endangered and Threatened Species; Recovery Plan for the North Pacific Right Whale
2013-06-07
... and Threatened Species; Recovery Plan for the North Pacific Right Whale AGENCY: National Marine... Recovery Plan (Plan) for the North Pacific right whale (Eubalaena japonica). ADDRESSES: Electronic copies...
Lifescience Database Archive (English)
Full Text Available Clone Detail Mapping Pseudomolecule data detail Detail information Mapping to the T...IGR japonica Pseudomolecules kome_mapping_pseudomolecule_data_detail.zip kome_mapping_pseudomolecule_data_detail ...
Computational Approaches to Modeling Artificial Emotion -– An overview of the Proposed Solutions
Directory of Open Access Journals (Sweden)
Zdzislaw eKOWALCZUK
2016-04-01
Full Text Available Cybernetic approach to modeling artificial emotion through the use of different theories of psychology is considered in this paper, presenting a review of twelve proposed solutions: ActAffAct, FLAME, EMA, ParleE, FearNot!, FAtiMA, WASABI, Cathexis, KARO, MAMID, FCM, and xEmotion. The main motivation for this study is founded on the hypothesis that emotions can play a definite utility role of scheduling variables in the construction of intelligent autonomous systems, agents and mobile robots. In this review we also include an innovative and panoptical, comprehensive system, referred to as the Intelligent System of Decision-making (ISD, which has been employed in practical applications of various autonomous units, and which applies as its part the xEmotion, taking into consideration the personal aspects of emotions, affects (short term emotions and mood (principally, long term emotions.
Directory of Open Access Journals (Sweden)
Dae-Jung Kim
2016-09-01
Full Text Available Monoclonal antibodies were generated against recombinant follicle-stimulating hormone (rec-FSH from Japanese eel Anguilla japonica; rec-FSH was produced in Escherichia coli and purified using Ni-NTA Sepharose column chromatography.In support of our recent publication, ''Production and characterization of monoclonal antibodies against recombinant tethered follicle-stimulating hormone from Japanese eel Anguilla japonica'' [1], it was important to characterize the specificity of eel follicle-stimulating hormone antibodies. Here, the production and ELISA system of these monoclonal antibodies are presented. The affinity-purified monoclonal antibodies specifically detected eel rec-FSH in ELISA and on western blots of rec-FSH produced from CHO cells. Immunohistochemical analysis revealed that FSH staining was specifically localized in the eel pituitary. Keywords: Japanese eel, FSH, Monoclonal Antibody
Micro-PIXE line-scan measurements of the yellow eel's otolith
Energy Technology Data Exchange (ETDEWEB)
Zheng, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Guo, H.; Tang, W.; Wei, K. [Laboratory of Ichthyology, Shanghai Ocean University, Shanghai 201306 (China); Shen, H., E-mail: haoshen@fudan.edu.cn [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China); Yang, M.; Mi, Y. [Applied Ion Beam Physics Laboratory, Institute of Modern Physics, Fudan University, Shanghai 200433 (China)
2011-10-15
Anguilla japonica has a high economic value. The abundance had decreased significantly due to excessive fishing and change in the aquatic ecology. Life history patterns of A. japonica have been studied to prevent excessive fishing and make management plans. Strontium (Sr)-calcium (Ca) ratio along a line down the long axis from the core to the edge of the yellow eel's otolith was measured using micro proton induced X-ray emission (micro-PIXE). An efficient and precise method was proposed to locate the core where an otolith begins to grow, based on Sr concentration and distribution. Using this method, life history patterns of the yellow eels collected from Jingjiang River in China were investigated. In general, there are two types, river eels and estuarine eels.
Micro-PIXE line-scan measurements of the yellow eel's otolith
International Nuclear Information System (INIS)
Zheng, Y.; Guo, H.; Tang, W.; Wei, K.; Shen, H.; Yang, M.; Mi, Y.
2011-01-01
Anguilla japonica has a high economic value. The abundance had decreased significantly due to excessive fishing and change in the aquatic ecology. Life history patterns of A. japonica have been studied to prevent excessive fishing and make management plans. Strontium (Sr)-calcium (Ca) ratio along a line down the long axis from the core to the edge of the yellow eel's otolith was measured using micro proton induced X-ray emission (micro-PIXE). An efficient and precise method was proposed to locate the core where an otolith begins to grow, based on Sr concentration and distribution. Using this method, life history patterns of the yellow eels collected from Jingjiang River in China were investigated. In general, there are two types, river eels and estuarine eels.
Ochiai, K; Uemura, S; Shimizu, A; Okumoto, Y; Matoh, T
2008-06-01
Boron toxicity tolerance of rice plants was studied. Modern japonica subspecies such as Koshihikari, Nipponbare, and Sasanishiki were tolerant, whereas indica subspecies such as Kasalath and IR36 were intolerant to excessive application of boron (B), even though their shoot B contents under B toxicity were not significantly different. Recombinant inbred lines (RILs) of japonica Nekken-1 and indica IR36 were used for quantitative trait locus (QTL) analysis to identify the gene responsible for B toxicity tolerance. A major QTL that could explain 45% of the phenotypic variation was detected in chromosome 4. The QTL was confirmed using a population derived from a recombinant inbred line which is heterogenic at the QTL region. The QTL was also confirmed in other chromosome segment substitution lines (CSSLs).
African Journals Online (AJOL)
Eighty Wistar rats were randomly allocated to 4 treatment groups or a ... Aster Tataricus, Stemona Japonica, Platycodon Grandiflorus, Cortex Mori, Herba Houttuyniae, Folium .... behavioural changes, skin, eyes, fur and somatic motor activity.
Zhang, Xiao-Hui; Cui, Jian-Yu; Lan, Yan; Zhao, Yang-Yang; Hu, Lin
2011-01-01
Domestic sewage was treated with subsurface wastewater infiltration system covered by two different turfgrass, namely, Festuca arundinacea Schres. and Zoysia japonica Steud.. The result shows that all the different systems have good removal rates to COD. The concentration of COD decreased to less than 48 mg x L(-1) from 97-357 mg x L(-1) which achieve the second class criteria specified in Integrated Wastewater Discharge Standard, and there are no prominent difference among different systems. The concentration of NH4(+) -N decreased to less than 0.5 mg x L(-1) from 76.3-125.8 mg x L(-1) which achieve the IV criteria (Groundwater Quality Standard, the effluent concentration of NH4(+) -N in naked system are prominently higher than that in system covered by Festuca arundinacea Schres., and there are no prominent difference compared with system covered by Zoysia japonica Steud.. The concentration of TP in different systems decreased to less than 0.05 mg x L(-1) from 3.70-18.42 mg x L(-1) which achieve the II criteria (rates of TN and nitrate were all not good enough, the probability which achieve the III criteria (Groundwater Quality Standard are less than one third, and the effluent concentration of TN and nitrate in naked system are prominently higher than that in systems covered by Festuca arundinacea Schres. and Zoysia japonica Steud..
Directory of Open Access Journals (Sweden)
Fukuda M.
2008-06-01
Full Text Available Microfilariae of five Onchocerca species, O. dewittei japonica (the causative agent of zoonotic onchocerciasis in Oita, Kyushu, Japan from wild boar (Sus scrofa, O. skrjabini and O. eberhardi from sika deer (Cervus nippon, O. lienalis from cattle, and an as yet unnamed Onchocerca sp. from wild boar, were injected intrathoracically into newly-emerged black flies of several species from Oita to search the potential vector(s of these parasites and identify their infective larvae. Development of O. dewittei japonica microfilariae to the infective larvae occurred in Simulium aokii, S. arakawae, S. bidentatum, S. japonicum, S. quinquestriatum, and S. rufibasis while development of infective larvae of O. skrjabini, O. eberhardi, and the unnamed Onchocerca sp. was observed in S. aokii, S. arakawae, and S. bidentatum. Development of O. lienalis microfilaria to infective larvae occurred in S. arakawae. Based on the morphology of infective larvae obtained, we proposed a key of identification of Onchocerca infective larvae found in Oita. We also reconsider the identification of three types of infective larvae previously recovered from Simulium species captured at cattle sheds: the large type I larvae that may be an undescribed species; the small type III identified as O. lienalis may include O. skrjabini too; the intermediary type II that may be O. gutturosa, or O. dewittei japonica, or the unnamed Onchocerca sp. of wild boar.
Directory of Open Access Journals (Sweden)
Yan-Fang Zhao
2014-01-01
Full Text Available Arsenite [As (III], arsenate [As (V], methylarsonate (MMA, and dimethylarsinate (DMA in five edible seaweeds (the brown algae Laminaria japonica, red algae Porphyra yezoensis, brown algae Undaria pinnatifida, brown algae Hizikia fusiformis, and green algae Enteromorpha prolifera were analyzed using in vitro digestion method determined by high-performance liquid chromatography inductively coupled plasma mass spectrometry. The results showed that DMA was found in the water extracts of all samples; As (III were detected in L. japonica and U. pinnatifida and about 23.0 and 0.15 mg/kg of As (V were found in H. fusiformis and E. prolifera respectively. However, after the gastrointestinal digestion, As (V was not detected in any of the five seaweeds. About 0.19 and 1.47 mg/kg of As (III was detected in the gastric extracts of L. japonica and H. fusiformis, respectively, and about 0.31 and 0.10 mg/kg of As (III were extracted from the intestinal extracts of Porphyra yezoensis and U. pinnatifida, respectively. The present results successfully reveal the differences of As species and levels in the water and biomimetic extracts of five edible seaweeds. The risk assessment of the inorganic arsenic in the five edible seaweeds based on present data showed almost no hazards to human health.
Funahashi, Aki; Itakura, Takao; Hassanin Abeer, A I; Komatsu, Masaharu; Hayashi, Seiichi; Kaminishi, Yoshio
2017-03-01
In this study, the localization of fluorescent protein (FP) was characterized in the muscles of four species and two subspecies of eels Anguilla anguilla, A. australis, A. bicolor bicolor (b.), A. bicolor pacifica (p.) and A. mossambica in addition to the previously reported A. japonica. The open reading frame of each eel FP was 417 bp encoding 139 amino acid residues. The deduced amino acid sequences among the four species and two subspecies exhibited 91.4-100% identity, and belonged to the fatty-acid-binding protein (FABP) family. The gene structure of eel FPs in A. japonica, A. anguilla, A. australis, A. bicolor b., A. bicolor p. and A. mossambica have four exons and three introns, and were common to that of FABP family. The apo eel FPs expressed by Escherichia coli with recombinant eel FP genes were analysed for the fluorescent properties in the presence of bilirubin. The excitation and emission spectra of holo eel FPs had the maximum wavelengths of 490-496 and 527-530 nm, respectively. The holo eel FPs indicated that the fluorescent intensities were stronger in A. japonica and A. bicolor than in A. mossambica, A. australis and A. anguilla. The comparison of amino acid sequences revealed two common substitutions in A. mossambica, A. australis and A. anguilla with weak fluorescent intensity.
Uptake and translocation of radiocesium in cedar leaves following the Fukushima nuclear accident.
Nishikiori, Tatsuhiro; Watanabe, Mirai; Koshikawa, Masami K; Takamatsu, Takejiro; Ishii, Yumiko; Ito, Shoko; Takenaka, Akio; Watanabe, Keiji; Hayashi, Seiji
2015-01-01
Cryptomeria japonica trees in the area surrounding Fukushima, Japan, intercepted (137)Cs present in atmospheric deposits soon after the Fukushima nuclear accident in March 2011. To study the uptake and translocation of (137)Cs in C. japonica leaves, we analyzed activity concentrations of (137)Cs and the concentration ratios of (137)Cs to (133)Cs ((137)Cs/(133)Cs) in old and new leaves of C. japonica collected from a forest on Mount Tsukuba between 9 and 15 months after the accident. Both isotopes were also analyzed in throughfall, bulk precipitation and soil extracts. Water of atmospheric and soil origin were used as proxies for deciphering the absorption from leaf surfaces and root systems, respectively. Results indicate that 20-40% of foliar (137)Cs existed inside the leaf, while 60-80% adhered to the leaf surface. The (137)Cs/(133)Cs ratios inside leaves that had sprouted before the accident were considerably higher than that of the soil extract and lower than that of throughfall and bulk precipitation. Additionally, more than 80% of (137)Cs in throughfall and bulk precipitation was present in the dissolved form, which is available for foliar uptake, indicating that a portion of the (137)Cs inside old leaves was presumably absorbed from the leaf surface. New leaves that sprouted after the accident had similar (137)Cs/(133)Cs ratios to that of the old leaves, suggesting that internal (137)Cs was translocated from old to new leaves. For 17 species of woody plants other than C. japonica, new leaves that sprouted after the accident also contained (137)Cs, and their (137)Cs/(133)Cs ratios were equal to or higher than that of the soil extract. These results suggested that foliar uptake and further translocation of (137)Cs is an important vector of contamination in various tree species during or just after radioactive fallout. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kono, Y; Matsumura, H; Kobayashi, T [Central Research Institute of Electric Power Industry, Tokyo (Japan)
1995-09-10
Two-year-old seedlings of Sugi (Japanese cedar: Cryptomeria japonica D. Don) and Hinoki (Japanese cypress: Chamaecyparis obtusa Sieb. et Zucc.) were grown for 4 months in 1/5 Hoagland`s No.2 nutrient culture solution containing aluminum chloride in the concentration range of 0.5 to 20 mM within the pH range of 3.5 to 4.0. Aluminium supplied at or below 1 mM of Al had no effect on the mortality of these species. However, the increase Al concentration higher than 2 mM increased the mortality. While they showed significant growth reduction at or higher Al concentration of 5 mM, there were no difference in growth response to Al between the two species in this experiment. While Al contents in leaf and root significantly increased with increasing Al concentration in the solution, contents of Ca, Mg and P in leaf decreased. Roof p content in Sugi increased with the increase of Al concentration in the solution, while no such change was observed in Hinoki root. This result suggests that Al might make phosphate immobile or inviolable form in Sugi root and this might lead to the reduced translocation of P into the leaf. In contrast, Al did not interfere with the uptake of phosphate in the root, however, it might interrupt phosphate transport into leaf from root system in Hinoki. The Al concentration such as 5 mM in the root sphere induced growth reductions in Sugi and Hinoki, with no significant difference in the response between the two species. This concentration was much higher than those reported in the field crops, vegetables and/or herbs. Thus, if soil acidification will be induced by acidic deposition in future, these herbaceous plants will be influenced faster than the conifer trees. This also means that ground vegetation change will be observed earlier than the conifer decline by the soil acidification stress. 23 refs., 5 figs., 3 tabs.
Tropical Journal of Pharmaceutical Research - Vol 15, No 1 (2016)
African Journals Online (AJOL)
... var japonica Attenuates Neuroinflammatory Responses in Activated BV2 Murine ... Extract against Liver and Kidney Toxicity Induced by Carbon Tetrachloride in Mice .... Determination of 8 Synthetic Food Dyes by Solid Phase Extraction and ...
AFSC/NMML: North Pacific Right Whale Photo-ID Catalog
National Oceanic and Atmospheric Administration, Department of Commerce — The eastern population of the North Pacific right whale (Eubalaena japonica) is the most endangered stock of whales in the world, with recent abundance estimates...
Purwaningsih, Endang; Dewi, Kartika; Hasegawa, Hideo
2015-06-24
During a survey on the parasites of amphibians of Indonesia, toads (30 Bufo melanostictus) and 246 frogs (213 Fejervarya cancrivora, 11 F. limnocharis, 22 Rana macrodon from West Java and 68 F. cancrivora from Central Java) were examined for parasitic nematodes. Three species of nematodes were found and described, i.e. Meteterakis wonosoboensis n. sp. from Fejervaria cancrivora; Meteterakis japonica from Bufo melanostictus, F. cancrivora and F. limnocharis; and Chabaudus sp. from F. cancrivora, F. limnocharis and Rana macrodon. Meteterakis wonosoboensis n. sp. is distinguished from other species of the genus by the length and shape of spicules, the number of caudal papillae, the presence of gubernaculum in male and the presence of vulval flap in female. Bufo melanostictus and Java are recorded as new host and locality for M. japonica, respectively.
Energy Technology Data Exchange (ETDEWEB)
Jeong, Y.H.; Ota, Y.
1981-12-01
In order to determine the effects of nitrogen application on ABA content of rice plants and their ozone-sensitivity, ABA production and ozone injuries were observed under different levels of nitrogen application with two Japonica and two Japonica X Indica type varieties. In all varieties, endogenous ABA content decreased with the increasing level of nitrogen applied, although total nitrogen content increased with the increasing level of nitrogen applied. Ozone injury was found with increasing level of nitrogen applied and to change depending on the varieties. Ozone injury was found to be more serious with increasing nitrogen content in Jinheung and Nongback, however it was less pronounced in Tongil and Milyang No. 23. Endogenous ABA content and ozone-sensitivity were related to the nitrogen content in the rice plants.
Kim, Suk-Man; Sohn, Jae-Keun
2005-08-31
This study was carried out to identify a high-resolution marker for a gene conferring resistance to brown planthopper (BPH) biotype 1, using japonica type resistant lines. Bulked segregant analyses were conducted using 520 RAPD primers to identify RAPD fragments linked to the BPH resistance gene. Eleven RAPDs were shown to be polymorphic amplicons between resistant and susceptible progeny. One of these primers, OPE 18, which amplified a 923 bp band tightly linked to resistance, was converted into a sequence-tagged-site (STS) marker. The STS marker, BpE18-3, was easily detectable as a dominant band with tight linkage (3.9cM) to Bph1. It promises to be useful as a marker for assisted selection of resistant progeny in backcross breeding programs to introgress the resistance gene into elite japonica cultivars.
Kabanova, Anastasia; Shneider, Mikhail; Bugaeva, Eugenia; Ha, Vo Thi Ngoc; Miroshnikov, Kirill; Korzhenkov, Aleksei; Kulikov, Eugene; Toschakov, Stepan; Ignatov, Alexander; Miroshnikov, Konstantin
2018-02-08
Bacteriophage vB_PpaP_PP74 (PP74) is a novel virulent phage that infects members of the species Pectobacterium parmentieri, a newly established species of soft-rot-causing bacteria in the family Pectobacteriaceae, derived from potato-specific Pectobacterium wasabiae. vB_PpaP_PP74 was identified as a member of the family Podoviridae by transmission electron microscopy. The phage has a 39,790-bp dsDNA genome containing 50 open reading frames (ORFs). Because of the absence of genes encoding toxins or lysogeny factors, PP74 may be considered a candidate phage for pathogen biocontrol applications. The genome layout is similar to genomes of T7-like phages within the subfamily Autographivirinae, and therefore, functions can be attributed to most of ORFs. However, the closest nucleotide sequence homologs of phage PP74 are unclassified Escherichia phages. Based on phylogenetic analysis, vB_PpaP_PP74 is a sensu lato T7-like phage, but it forms a distant subgenus group together with homologous enterobacterial phages.
Lifescience Database Archive (English)
Full Text Available nsaturated acid Viola mandshurica [TAX:316491], Viola japonica [TAX:316487], Viola yedoensis [TAX:316493], Viola verecunda [TAX...:316478], Viola diffusa [TAX:591085], Viola patrinii [TAX:316489] ... Violaceae (violet family) Viola harb (dried) ...
Optimization of RAPD-PCR reaction system for genetic relationships ...
African Journals Online (AJOL)
STORAGESEVER
2010-02-08
Feb 8, 2010 ... Camellia features beautiful tree shape, various petal color, .... (Huzhuabai (C. japonica)) was randomly selected for optimization of .... Afr. J. Biotechnol. Figure 1. Agarose gel electrophoresis analysis by primer S256 (left-up), ...
Mitochondrial DNA analysis reveals a low nucleotide diversity of ...
African Journals Online (AJOL)
STORAGESEVER
2009-06-17
Jun 17, 2009 ... gene sequences of C. japonica in China to assess nucleotide sequence diversity (GenBank ... provide a scientific basis for the regional control of forestry .... population (AB015869) was downloaded from GenBank database.
You-Sheng, Liang; Yi-An, Wang; Xue-Hui, Shen; Wei, Wang; Guo-Li, Qu; Yun-Tian, Xing; Jian-Rong, Dai
2016-10-18
To quantitatively estimate the range and area of environmental contamination by the feces of Schistosoma japonicum -infected that were freely grazed, so as to provide the theoretical evidence for the scientific assessment of the role of the freely grazed goat in the transmission of schistosomiasis japonica and development of control strategy. All the fecal samples excreted by the infected goat at daytime (12 h) were collected by using a self-made goat fecal collector, weighed and counted. The quantity and dispersal of the feces excreted by the freely grazed goat at daytime under a natural condition were investigated, and the walking route and speed of the freely grazed goat at daytime were recorded with a multifunction GPS data logger. The maximum range and area of the environment contaminated by the feces of the freely grazed goat at daytime were estimated, and the maximum range and area of the Oncomelania hupensis snails that may be infected by the schistosome miracidium released from the eggs in the fecal samples of the freely graze goat at daytime were calculated. During the walking along the marshland at daytime (12 h), the quantity of the feces execrated by the freely grazed infected goat was (232.8 ± 39.8) g per goat, and the fecal samples were composed of (819.2 ± 152.1) pellets. The goat had a mean walking speed of (0.522 7 ± 0.099 7) km/h, and the longest distance, largest radius and largest range of walking activity were (6.272 4 ± 1.195 8) km, 3.136 2 km and (3 191.113 0 ± 1 189.709 4) hm 2 at daytime, respectively. The area of the snails that may be infected by the miracidium released from the eggs in the fecal samples of the freely graze goat (range of key regions for infected snails detection and control) at daytime was estimated to be (3 210.717 5 ± 1 190.907 3) hm 2 . The intensity of environmental contamination by the eggs in the fecal samples of the freely grazed goat is linked to the number of infected goat. The contamination range caused
Mitigation of TGF-β/Smad signaling pathway-associated liver fibrosis ...
African Journals Online (AJOL)
2112 ... PF'on Schistosomiasis japonica-induced liver fibrosis have also been ... with “National Research Council for Animal Care”. [11]. .... Smad 7 as observed following exposure to CCl4, ... Jia Z, He J. Paeoniflorin ameliorates rheumatoid arthritis.
Old Hickory Lake Appendix M To Park Management Shoreline Management Plan
2014-07-01
attractors, establishment of nesting/forage habitat such as monarch butterfly way stations, construction of chimney swift towers, etc. 22. Leases...Elaeagnus umbellata Thunb.) Japanese Bush honeysuckles (Lonicera japonica.) Amur Bush honeysuckle (Lonicera maackii.) Marrows Bush honeysuckle (Lonicera
Ulmus davidiana var japonica Attenuates Neuroinflammatory ...
African Journals Online (AJOL)
induced increase in the production of nitric oxide was concentration- ... 70 % ethanol at room temperature for 72 h and filtered. ... Cells were washed in cold PBS three times and lysed in a .... expression in rodent glial cells and muscle cells. [11].
Suaeda japonica Makino Attenuates Lipopolysaccharide- Induced ...
African Journals Online (AJOL)
HP
Tropical Journal of Pharmaceutical Research June 2013; 12 (3): 351-356 ... expression and production of inflammatory mediators determined by Western blot analysis. Results: SJE significantly ..... This work was supported by Business for.
Ulmus davidiana var japonica Attenuates Neuroinflammatory ...
African Journals Online (AJOL)
substrate (Lab-Frontier, Seoul, Korea) on X-ray film. ... mean ± S.E.M. (n = 3) for three independent experiments. ***p < 0.001, when compared with control group by one-way analysis of variance, followed by Dunnett's multiple range tests.
Asian wild rice is a hybrid swarm with extensive gene flow and feralization from domesticated rice.
Wang, Hongru; Vieira, Filipe G; Crawford, Jacob E; Chu, Chengcai; Nielsen, Rasmus
2017-06-01
The domestication history of rice remains controversial, with multiple studies reaching different conclusions regarding its origin(s). These studies have generally assumed that populations of living wild rice, O. rufipogon , are descendants of the ancestral population that gave rise to domesticated rice, but relatively little attention has been paid to the origins and history of wild rice itself. Here, we investigate the genetic ancestry of wild rice by analyzing a diverse panel of rice genomes consisting of 203 domesticated and 435 wild rice accessions. We show that most modern wild rice is heavily admixed with domesticated rice through both pollen- and seed-mediated gene flow. In fact, much presumed wild rice may simply represent different stages of feralized domesticated rice. In line with this hypothesis, many presumed wild rice varieties show remnants of the effects of selective sweeps in previously identified domestication genes, as well as evidence of recent selection in flowering genes possibly associated with the feralization process. Furthermore, there is a distinct geographical pattern of gene flow from aus , indica , and japonica varieties into colocated wild rice. We also show that admixture from aus and indica is more recent than gene flow from japonica , possibly consistent with an earlier spread of japonica varieties. We argue that wild rice populations should be considered a hybrid swarm, connected to domesticated rice by continuous and extensive gene flow. © 2017 Wang et al.; Published by Cold Spring Harbor Laboratory Press.
Smith, Maria S; Fridley, Jason D; Goebel, Marc; Bauerle, Taryn L
2014-01-01
Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native) versus L. sempervirens (native) and Frangula alnus (non-native) versus Rhamnus alnifolia (native), over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.
Directory of Open Access Journals (Sweden)
Maria S Smith
Full Text Available Belowground processes are rarely considered in comparison studies of native verses invasive species. We examined relationships between belowground fine root production and lifespan, leaf phenology, and seasonal nitrogen dynamics of Lonicera japonica (non-native versus L. sempervirens (native and Frangula alnus (non-native versus Rhamnus alnifolia (native, over time. First and second order fine roots were monitored from 2010 to 2012 using minirhizotron technology and rhizotron windows. 15N uptake of fine roots was measured across spring and fall seasons. Significant differences in fine root production across seasons were seen between Lonicera species, but not between Frangula and Rhamnus, with both groups having notable asynchrony in regards to the timing of leaf production. Root order and the number of root neighbors at the time of root death were the strongest predictors of root lifespan of both species pairs. Seasonal 15N uptake was higher in spring than in the fall, which did not support the need for higher root activity to correspond with extended leaf phenology. We found higher spring 15N uptake in non-native L. japonica compared to native L. sempervirens, although there was no difference in 15N uptake between Frangula and Rhamnus species. Our findings indicate the potential for fast-growing non-native Lonicera japonica and Frangula alnus to outcompete native counterparts through differences in biomass allocation, root turnover, and nitrogen uptake, however evidence that this is a general strategy of invader dominance is limited.
Influence of reaction conditions on fast pyrolysis of macroalge
International Nuclear Information System (INIS)
Bae, Yoon Ju; Kim, Jung Hwan; Cho, Hye Jung; Ko, Jeong Huy; Heo, Hyeon Su; Park, Hye Jin; Park, Young Kwon
2010-01-01
Full text: The importance of renewable energy sources has increased rapidly due to the high international crude oil prices and environmental concerns over fossil fuel use. Recently, there has been a growing interest in aquatic biomass, especially marine macro algae, and a number of studies have been initiated to evaluate its potential for bio-energy. This paper reports a fast pyrolysis of macro algae under different reaction conditions such as pyrolysis temperature, particle size and sample quantity. Various macro algae such as Undaria pinnatifida, Laminaria japonica and Porphyra tenera were fast pyro lysed at temperatures between 300-600 degree Celsius in a batch reactor and the main product of bio-oil was obtained. The optimal reaction temperature for the production of bio-oil was 500 degree Celsius. At this temperature, the maximum bio-oil yields were 40.4 wt % ( by Undaria pinnatifida), 37.6 wt % (by Laminaria japonica) and 47.4 wt % (by Porphyra tenera), respectively. In particular, after pre-treatment with 2.0M HCl solution, the product yield of bio-oil was increased in macro algae, Undaria pinnatifida. The pyroylsis gases were analyzed by using GC-TCD and GC-FID and qualitative analyses of bio-oil were performed using GC-MS. The maximum yield of bio-oil, Undaria pinnatifida, Laminaria japonica and Porphyra tenera, was obtained at 500 degree Celsius (40.4 wt %, 37.6 wt % and 47.4 wt %, respectively). (author)
Directory of Open Access Journals (Sweden)
Keyan Zhao
2010-05-01
Full Text Available The domestication of Asian rice (Oryza sativa was a complex process punctuated by episodes of introgressive hybridization among and between subpopulations. Deep genetic divergence between the two main varietal groups (Indica and Japonica suggests domestication from at least two distinct wild populations. However, genetic uniformity surrounding key domestication genes across divergent subpopulations suggests cultural exchange of genetic material among ancient farmers.In this study, we utilize a novel 1,536 SNP panel genotyped across 395 diverse accessions of O. sativa to study genome-wide patterns of polymorphism, to characterize population structure, and to infer the introgression history of domesticated Asian rice. Our population structure analyses support the existence of five major subpopulations (indica, aus, tropical japonica, temperate japonica and GroupV consistent with previous analyses. Our introgression analysis shows that most accessions exhibit some degree of admixture, with many individuals within a population sharing the same introgressed segment due to artificial selection. Admixture mapping and association analysis of amylose content and grain length illustrate the potential for dissecting the genetic basis of complex traits in domesticated plant populations.Genes in these regions control a myriad of traits including plant stature, blast resistance, and amylose content. These analyses highlight the power of population genomics in agricultural systems to identify functionally important regions of the genome and to decipher the role of human-directed breeding in refashioning the genomes of a domesticated species.
Radiocesium migration in the litter layer of different forest types in Fukushima, Japan.
Kurihara, Momo; Onda, Yuichi; Kato, Hiroaki; Loffredo, Nicolas; Yasutaka, Tetsuo; Coppin, Frederic
2018-07-01
Cesium-137 ( 137 Cs) migration in the litter layer consists of various processes, such as input via throughfall, output via litter decomposition, and input from deeper layers via soil organism activity. We conducted litter bag experiments over 2 years (December 2014-November 2016) to quantify the inputs and outputs of 137 Cs in the litter layer in a Japanese cedar plantation (Cryptomeria japonica) and a mixed broadleaf forest dominated by Quercus serrata located 40 km northwest of the Fukushima Dai-ichi Nuclear Power Plant. The experiments included four conditions, combining contaminated and non-contaminated litter and deeper layer material, and the inputs and outputs were estimated from the combination of 137 Cs increases and decreases in the litter layer under each condition. The 137 Cs dynamics differed between the two forests. In the C. japonica forest, some 137 Cs input via throughfall remained in the litter layer, and downward 137 Cs flux passed through the litter layer was 0.42 (/year).Upward flux of 137 Cs from the deeper layer was very restricted, layers was restricted, downward 137 Cs flux was less than 0.003 (/year).Upward input of 137 Cs from the deeper layer was prominent, 0.037 (/year). 137 Cs output via litter decomposition was observed in both forests. The flux in the C. japonica forest was slower than that in the broadleaf forest, 0.12 and 0.15 (/year), respectively. Copyright © 2018 Elsevier Ltd. All rights reserved.
Investigation of the Antiasthmatic Properties of Ethanol Extract of ...
African Journals Online (AJOL)
Investigation of the Antiasthmatic Properties of Ethanol Extract of Callophyllis japonica in Mice. WS Park, KS Lee, JH Chun, SH Urm, DS Lee, DY Lee, SG Park, SK Seo, SJ Heo, ZJ Qian, WK Jung, IW Choi ...
Effect of dietary supplementation of olive leaves on performance and ...
African Journals Online (AJOL)
Λευτέρης
cholesterol and triglycerides concentrations were determined. ... Keywords: Pimpinella anisum, vitamin E, Coturnix japonica, performance, egg .... 8 mg vitamin B2; 3 mg vitamin B6; 20 μg vitamin B12; 85 mg vitamin niacin; 20 mg pantothenic.
Adult beetles of three different white grub species, Japanese beetle, Popillia japonica, June beetle, Phyllophaga spp., and masked chafer, Cyclocephala spp. were exposed to experimental and commercially available granules containing Metarhizium brunneum (Petch) strain F52, to determine susceptibilit...